F410457

General Info

Members Datasets Scaffolds Average Seq Length
331 190 662 172

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101399579|Ga0075428_1013995791
Length 200
Sequence MPSALEDPSGGQSIPGNKTGPTSVSKELMGSRVFEETVLPHLDAAFNYARWLAKNETEAEDVVQDACVRAMRFFSSLRDEDARPWLLAIVRNTWYSRVSRRASTTEAALGTTGDERPDDALDPEERLLQQHTAERVRAAIEQLPADYREVLVLREMEGMSYKEIAAVVQVPIGTVMSRLARSRERLVAILKLSPPREALR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
112 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 15.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101399579 3300006844 Bacteria 734
2 JGI24746J21847_1015159 3300001977 Bacteria 1110
3 JGI24751J29686_10019262 3300002459 Bacteria 1412
4 Ga0065712_10000195 3300005290 Bacteria 23099
5 Ga0065712_10118798 3300005290 Bacteria 1701
6 Ga0065712_10441338 3300005290 Unclassified 691
7 Ga0065715_10059379 3300005293 Bacteria 973
8 Ga0065715_10598846 3300005293 Unclassified 709
9 Ga0065707_10001545 3300005295 Bacteria 7914
10 Ga0065707_10103718 3300005295 Unclassified 2733
11 Ga0070683_100600654 3300005329 Bacteria 1053
12 Ga0070690_100471661 3300005330 Bacteria 934
13 Ga0070690_100548752 3300005330 Bacteria 871
14 Ga0070670_100128509 3300005331 Bacteria 2187
15 Ga0070670_100411589 3300005331 Unclassified 1195
16 Ga0068869_100441531 3300005334 Bacteria 1077
17 Ga0070666_10724258 3300005335 Bacteria 730
18 Ga0070680_100111716 3300005336 Unclassified 2275
19 Ga0068868_100256250 3300005338 Unclassified 1474
20 Ga0070689_100017011 3300005340 Bacteria 5334
21 Ga0070669_100003576 3300005353 Bacteria 11217
22 Ga0070669_100036464 3300005353 Bacteria 3563
23 Ga0070669_100261244 3300005353 Unclassified 1382
24 Ga0070675_100000324 3300005354 Bacteria 32228
25 Ga0070675_100279380 3300005354 Unclassified 1467
26 Ga0070675_100394944 3300005354 Bacteria 1233
27 Ga0070675_100834781 3300005354 Bacteria 843
28 Ga0070674_100047706 3300005356 Bacteria 2937
29 Ga0070674_100352368 3300005356 Unclassified 1189
30 Ga0070673_100162468 3300005364 Bacteria 1900
31 Ga0070688_100013446 3300005365 Bacteria 4615
32 Ga0070688_100075782 3300005365 Unclassified 2163
33 Ga0070659_100134502 3300005366 Bacteria 2010
34 Ga0070659_100586348 3300005366 Bacteria 957
35 Ga0070700_100170373 3300005441 Bacteria 1507
36 Ga0070694_100206794 3300005444 Bacteria 1466
37 Ga0070708_100122888 3300005445 Bacteria 2396
38 Ga0070708_100709198 3300005445 Bacteria 947
39 Ga0070678_101472945 3300005456 Bacteria 637
40 Ga0070662_100409373 3300005457 Bacteria 1120
41 Ga0070681_10029256 3300005458 Bacteria 5531
42 Ga0070681_10715504 3300005458 Bacteria 917
43 Ga0070685_10056847 3300005466 Bacteria 2276
44 Ga0070685_11140837 3300005466 Unclassified 590
45 Ga0070706_100562024 3300005467 Unclassified 1061
46 Ga0070698_100671360 3300005471 Bacteria 978
47 Ga0070679_100447553 3300005530 Unclassified 1236
48 Ga0070679_101032713 3300005530 Unclassified 766
49 Ga0070684_100061198 3300005535 Unclassified 3295
50 Ga0070684_101145294 3300005535 Bacteria 731
51 Ga0070672_100047132 3300005543 Bacteria 3343
52 Ga0070686_100049653 3300005544 Bacteria 2663
53 Ga0070686_100143601 3300005544 Bacteria 1664
54 Ga0070686_100194376 3300005544 Bacteria 1450
55 Ga0070693_100010552 3300005547 Unclassified 4632
56 Ga0068855_100240250 3300005563 Bacteria 2024
57 Ga0068855_100672461 3300005563 Bacteria 1110
58 Ga0068857_100055075 3300005577 Bacteria 3530
59 Ga0068857_100112122 3300005577 Bacteria 2452
60 Ga0068857_100656454 3300005577 Bacteria 994
61 Ga0070702_100264730 3300005615 Bacteria 1172
62 Ga0068859_100000507 3300005617 Bacteria 38390
63 Ga0068859_100024221 3300005617 Bacteria 6091
64 Ga0068859_100056410 3300005617 Bacteria 3953
65 Ga0068859_100143995 3300005617 Unclassified 2457
66 Ga0068859_100214138 3300005617 Bacteria 2013
67 Ga0068859_101250465 3300005617 Bacteria 818
68 Ga0068864_100081811 3300005618 Bacteria 2832
69 Ga0068864_100115458 3300005618 Bacteria 2395
70 Ga0068864_100371019 3300005618 Bacteria 1354
71 Ga0068861_100613576 3300005719 Bacteria 1000
72 Ga0068851_10108744 3300005834 Bacteria 1478
73 Ga0068870_10247848 3300005840 Bacteria 1103
74 Ga0068870_10263758 3300005840 Bacteria 1073
75 Ga0068863_100014431 3300005841 Bacteria 7609
76 Ga0068863_100446028 3300005841 Unclassified 1270
77 Ga0068863_100735944 3300005841 Bacteria 981
78 Ga0068858_100007289 3300005842 Bacteria 10718
79 Ga0068858_100062201 3300005842 Bacteria 3451
80 Ga0068858_100485397 3300005842 Bacteria 1193
81 Ga0068860_100064764 3300005843 Bacteria 3471
82 Ga0068860_100125309 3300005843 Bacteria 2462
83 Ga0068860_100622556 3300005843 Bacteria 1086
84 Ga0068860_101068671 3300005843 Unclassified 826
85 Ga0068860_101217876 3300005843 Unclassified 773
86 Ga0068862_100013552 3300005844 Bacteria 6755
87 Ga0068862_100016333 3300005844 Bacteria 6179
88 Ga0068862_100042600 3300005844 Bacteria 3867
89 Ga0068862_100368877 3300005844 Unclassified 1336
90 Ga0081455_10036722 3300005937 Bacteria 4358
91 Ga0070716_100131215 3300006173 Bacteria 1584
92 Ga0070716_101118107 3300006173 Bacteria 629
93 Ga0068871_101155395 3300006358 Bacteria 725
94 Ga0075428_100004536 3300006844 Bacteria 15353
95 Ga0075428_100012169 3300006844 Bacteria 9569
96 Ga0075428_100063303 3300006844 Bacteria 4049
97 Ga0075428_100862151 3300006844 Bacteria 961
98 Ga0075431_100457990 3300006847 Bacteria 1270
99 Ga0075433_10023934 3300006852 Bacteria 5148
100 Ga0075433_10059365 3300006852 Bacteria 3347
101 Ga0075433_10674633 3300006852 Unclassified 906
102 Ga0075434_100000061 3300006871 Bacteria 55262
103 Ga0075434_100012378 3300006871 Bacteria 8085
104 Ga0075434_100022229 3300006871 Bacteria 6178
105 Ga0075434_100030998 3300006871 Bacteria 5271
106 Ga0075434_100242311 3300006871 Bacteria 1823
107 Ga0075434_100816951 3300006871 Bacteria 948
108 Ga0075429_100084599 3300006880 Bacteria 2765
109 Ga0075429_100218944 3300006880 Bacteria 1668
110 Ga0068865_100270504 3300006881 Bacteria 1349
111 Ga0075436_100000167 3300006914 Bacteria 41150
112 Ga0075436_100245741 3300006914 Unclassified 1273
113 Ga0097620_100000507 3300006931 Bacteria 38390
114 Ga0097620_100024221 3300006931 Bacteria 6091
115 Ga0097620_100056411 3300006931 Bacteria 3953
116 Ga0097620_100143995 3300006931 Unclassified 2457
117 Ga0097620_100214139 3300006931 Bacteria 2013
118 Ga0097620_101250591 3300006931 Bacteria 818
119 Ga0075435_100000023 3300007076 Bacteria 88404
120 Ga0075435_100002847 3300007076 Bacteria 11580
121 Ga0075435_100002968 3300007076 Bacteria 11399
122 Ga0075435_100123885 3300007076 Bacteria 2158
123 Ga0075435_100226462 3300007076 Bacteria 1588
124 Ga0075435_100567256 3300007076 Bacteria 983
125 Ga0105240_10070862 3300009093 Bacteria 4311
126 Ga0111539_10091944 3300009094 Bacteria 3565
127 Ga0111539_10131486 3300009094 Bacteria 2930
128 Ga0111539_10350939 3300009094 Bacteria 1717
129 Ga0111539_10410884 3300009094 Bacteria 1576
130 Ga0111539_10507467 3300009094 Bacteria 1405
131 Ga0111539_10877082 3300009094 Bacteria 1044
132 Ga0111539_11274772 3300009094 Unclassified 853
133 Ga0114129_10013282 3300009147 Bacteria 11734
134 Ga0114129_10015097 3300009147 Bacteria 10991
135 Ga0114129_10092802 3300009147 Bacteria 4182
136 Ga0114129_10117899 3300009147 Bacteria 3657
137 Ga0105243_11276257 3300009148 Unclassified 751
138 Ga0105241_10300184 3300009174 Bacteria 1378
139 Ga0105248_10064644 3300009177 Bacteria 4107
140 Ga0105248_10918069 3300009177 Bacteria 989
141 Ga0105249_10001741 3300009553 Bacteria 18981
142 Ga0105249_10116124 3300009553 Unclassified 2537
143 Ga0105246_10091877 3300011119 Bacteria 2189
144 Ga0157339_1039580 3300012505 Bacteria 586
145 Ga0157374_10091621 3300013296 Bacteria 2899
146 Ga0157378_10534361 3300013297 Unclassified 1176
147 Ga0157372_10284368 3300013307 Bacteria 1923
148 Ga0157375_10027881 3300013308 Bacteria 5284
149 Ga0157375_10168213 3300013308 Bacteria 2338
150 Ga0157375_10687220 3300013308 Bacteria 1178
151 Ga0163163_10009692 3300014325 Bacteria 8618
152 Ga0163163_10078604 3300014325 Bacteria 3296
153 Ga0163163_10195446 3300014325 Unclassified 2071
154 Ga0157377_10586720 3300014745 Unclassified 793
155 Ga0157379_10170620 3300014968 Unclassified 1964
156 Ga0157376_10313765 3300014969 Bacteria 1488
157 Ga0157376_10604330 3300014969 Unclassified 1092
158 Ga0157376_10697080 3300014969 Bacteria 1020
159 Ga0207647_10426466 3300025904 Unclassified 745
160 Ga0207643_10279676 3300025908 Bacteria 1035
161 Ga0207654_10455028 3300025911 Bacteria 898
162 Ga0207707_10192339 3300025912 Bacteria 1780
163 Ga0207707_10610598 3300025912 Bacteria 922
164 Ga0207695_10051699 3300025913 Bacteria 4311
165 Ga0207660_10491605 3300025917 Unclassified 995
166 Ga0207662_10375339 3300025918 Unclassified 960
167 Ga0207652_10055876 3300025921 Bacteria 3397
168 Ga0207652_10991396 3300025921 Unclassified 739
169 Ga0207681_10038667 3300025923 Bacteria 3163
170 Ga0207681_10258810 3300025923 Bacteria 1362
171 Ga0207681_10762472 3300025923 Unclassified 807
172 Ga0207650_10027590 3300025925 Bacteria 4066
173 Ga0207650_10102932 3300025925 Bacteria 2201
174 Ga0207659_10000511 3300025926 Bacteria 23289
175 Ga0207659_10032174 3300025926 Bacteria 3597
176 Ga0207659_10300272 3300025926 Bacteria 1319
177 Ga0207644_10174850 3300025931 Bacteria 1679
178 Ga0207644_10584267 3300025931 Bacteria 927
179 Ga0207690_10152211 3300025932 Bacteria 1716
180 Ga0207690_10172718 3300025932 Bacteria 1621
181 Ga0207670_10578542 3300025936 Unclassified 920
182 Ga0207669_10116720 3300025937 Bacteria 1802
183 Ga0207704_10681561 3300025938 Bacteria 849
184 Ga0207665_10753652 3300025939 Bacteria 768
185 Ga0207691_10061902 3300025940 Bacteria 3398
186 Ga0207691_10074807 3300025940 Bacteria 3054
187 Ga0207711_10771439 3300025941 Bacteria 896
188 Ga0207689_10449552 3300025942 Unclassified 1077
189 Ga0207689_10609466 3300025942 Bacteria 919
190 Ga0207679_10131934 3300025945 Bacteria 2006
191 Ga0207667_10344680 3300025949 Bacteria 1520
192 Ga0207651_10267314 3300025960 Unclassified 1407
193 Ga0207651_10518385 3300025960 Bacteria 1033
194 Ga0207712_10530827 3300025961 Unclassified 1010
195 Ga0207677_10640484 3300026023 Bacteria 937
196 Ga0207703_10010965 3300026035 Bacteria 7063
197 Ga0207703_10194718 3300026035 Bacteria 1798
198 Ga0207708_10147642 3300026075 Bacteria 1849
199 Ga0207708_11000802 3300026075 Unclassified 726
200 Ga0207641_10003580 3300026088 Bacteria 13729
201 Ga0207641_10402106 3300026088 Bacteria 1315
202 Ga0207641_10615734 3300026088 Unclassified 1064
203 Ga0207676_10039768 3300026095 Bacteria 3600
204 Ga0207676_10078158 3300026095 Bacteria 2679
205 Ga0207674_10067554 3300026116 Bacteria 3599
206 Ga0207674_10128168 3300026116 Bacteria 2502
207 Ga0207674_10656116 3300026116 Bacteria 1013
208 Ga0207675_100397820 3300026118 Bacteria 1357
209 Ga0207675_100448591 3300026118 Bacteria 1278
210 Ga0209974_10048718 3300027876 Bacteria 1421
211 Ga0207428_10105256 3300027907 Bacteria 2176
212 Ga0268265_10762480 3300028380 Bacteria 940
213 Ga0268264_10006593 3300028381 Bacteria 9765
214 Ga0268264_10244239 3300028381 Bacteria 1665
215 Ga0268264_10297624 3300028381 Bacteria 1518
216 Ga0268264_10358845 3300028381 Bacteria 1389
217 Ga0373930_0006485 3300034816 Bacteria 1981
218 Ga0373950_0000627 3300034818 Bacteria 4377
219 Ga0373959_0001407 3300034820 Bacteria 3844
220 Ga0373928_0003287 3300035084 Bacteria 3097
221 Ga0373929_0002243 3300035085 Bacteria 3574
222 Ga0373929_0134869 3300035085 Bacteria 650
223 Ga0373934_0129977 3300035086 Bacteria 1027
224 Ga0373940_0001877 3300035088 Bacteria 3946
225 Ga0373949_0000220 3300035090 Bacteria 21606
226 Ga0373951_0000688 3300035091 Bacteria 9290
227 Ga0373952_0001390 3300035092 Bacteria 4421
228 Ga0373932_0001248 3300035112 Bacteria 7220
229 Ga0373939_0016975 3300035114 Bacteria 1927
230 Ga0373939_0022204 3300035114 Bacteria 1746
231 Ga0373939_0164259 3300035114 Bacteria 817
232 Ga0373941_0003273 3300035115 Bacteria 3655
233 Ga0373941_0174252 3300035115 Bacteria 803
234 Ga0373945_0205498 3300035116 Bacteria 819
235 Ga0373954_0326525 3300035118 Bacteria 757
236 Ga0373956_0155558 3300035119 Bacteria 1076
237 Ga0373960_0004095 3300035121 Bacteria 3332
238 Ga0373943_0494183 3300035170 Bacteria 714
239 Ga0373942_0012713 3300035207 Bacteria 2015
240 Ga0373961_0005495 3300035241 Bacteria 3045
241 Ga0373962_0001447 3300035242 Bacteria 5616
242 Ga0373962_0028764 3300035242 Unclassified 1510
243 Ga0373924_0100657 3300035410 Bacteria 1243
244 Ga0373931_0515884 3300035691 Bacteria 773
245 Ga0373931_0745187 3300035691 Unclassified 650
246 Ga0373935_1267986 3300035692 Bacteria 550
247 Ga0373937_0137945 3300036401 Bacteria 2281
248 Ga0373937_0250342 3300036401 Bacteria 1670
249 Ga0373925_0783208 3300037068 Bacteria 786
250 Ga0466963_0348748 3300044694 Unclassified 1042
251 Ga0451576_0071175 3300045051 Bacteria 3619
252 Ga0451576_0199822 3300045051 Bacteria 2088
253 Ga0451576_0883218 3300045051 Bacteria 938
254 Ga0451576_2116558 3300045051 Unclassified 578
255 Ga0466967_0029172 3300045976 Bacteria 4615
256 Ga0466967_0242983 3300045976 Bacteria 1718
257 Ga0495592_0108524 3300046454 Bacteria 1967
258 Ga0495603_0071526 3300046455 Bacteria 2039
259 Ga0495582_0011665 3300046473 Bacteria 4843
260 Ga0495582_0069899 3300046473 Bacteria 1942
261 Ga0495664_0157429 3300046477 Bacteria 1378
262 Ga0495584_0450476 3300046491 Bacteria 655
263 Ga0495585_0168928 3300046492 Unclassified 1131
264 Ga0495608_0004909 3300046511 Bacteria 9578
265 Ga0495618_0108471 3300046514 Bacteria 1778
266 Ga0495628_0137101 3300046516 Bacteria 1869
267 Ga0495630_0036361 3300046517 Bacteria 3681
268 Ga0495652_0116758 3300046529 Bacteria 2136
269 Ga0495587_0416903 3300046536 Bacteria 745
270 Ga0495598_0071702 3300046537 Unclassified 1092
271 Ga0495609_0225170 3300046538 Bacteria 778
272 Ga0495645_0173316 3300046543 Bacteria 1483
273 Ga0495667_0023870 3300046559 Bacteria 4119
274 Ga0495656_0344276 3300046615 Bacteria 771
275 Ga0495634_0136182 3300046642 Bacteria 1562
276 Ga0495657_0310850 3300046675 Bacteria 938
277 Ga0495599_0056400 3300046678 Bacteria 2459
278 Ga0495623_0331460 3300046679 Bacteria 833
279 Ga0495658_0363438 3300046683 Bacteria 920
280 Ga0495669_0114986 3300046684 Bacteria 1259
281 Ga0495613_0000490 3300046689 Bacteria 33424
282 Ga0495670_0055906 3300046691 Bacteria 1979
283 Ga0495589_0410919 3300046794 Bacteria 621
284 Ga0495600_0011286 3300046809 Bacteria 5563
285 Ga0495604_0010705 3300047317 Bacteria 7280
286 Ga0495674_0043076 3300047319 Bacteria 4021
287 Ga0495680_0325423 3300047322 Bacteria 1075
288 Ga0495684_0000269 3300047471 Bacteria 41576
289 Ga0496100_0343048 3300048903 Bacteria 1127
290 Ga0496112_0298262 3300048915 Bacteria 1557
291 Ga0496112_0324309 3300048915 Bacteria 1484
292 Ga0496113_0761969 3300048916 Unclassified 770
293 Ga0501298_038507 3300049521 Bacteria 963
294 Ga0501034_0345663 3300049571 Bacteria 1417
295 Ga0501034_0747851 3300049571 Bacteria 873
296 Ga0501047_0336607 3300049581 Bacteria 1347
297 Ga0501073_0452373 3300049589 Bacteria 888
298 Ga0501249_047342 3300049679 Bacteria 983
299 Ga0501272_042641 3300049769 Bacteria 610
300 Ga0501044_0003961 3300049823 Bacteria 16585
301 nmdc:mga05p37_31803_c1 3300050507 Bacteria 6448
302 nmdc:mga09592_1150565_c1 3300050508 Bacteria 643
303 nmdc:mga09592_147298_c1 3300050508 Bacteria 2030
304 nmdc:mga09592_703969_c1 3300050508 Bacteria 859
305 nmdc:mga06r32_70328_c1 3300050510 Bacteria 3384
306 nmdc:mga08y16_181668_c1 3300050511 Bacteria 2184
307 nmdc:mga08y16_257117_c1 3300050511 Bacteria 1804
308 nmdc:mga08y16_305978_c1 3300050511 Bacteria 1638
309 nmdc:mga08y16_313440_c1 3300050511 Bacteria 1616
310 nmdc:mga08y16_692686_c1 3300050511 Bacteria 1020
311 nmdc:mga0n895_12631_c1 3300050512 Bacteria 7581
312 nmdc:mga0n895_13_c1 3300050512 Bacteria 110482
313 nmdc:mga0n895_339849_c1 3300050512 Bacteria 1521
314 nmdc:mga0n895_634686_c1 3300050512 Bacteria 1068
315 nmdc:mga0n895_73377_c1 3300050512 Bacteria 3397
316 nmdc:mga0rr50_12_c1 3300050513 Bacteria 215691
317 nmdc:mga0rr50_1608_c1 3300050513 Bacteria 12426
318 nmdc:mga0rr50_23319_c1 3300050513 Bacteria 4265
319 nmdc:mga0rr50_247120_c1 3300050513 Bacteria 1480
320 nmdc:mga0rr50_383375_c1 3300050513 Unclassified 1186
321 nmdc:mga0rr50_611334_c1 3300050513 Bacteria 929
322 nmdc:mga08x19_240_c1 3300050514 Bacteria 41821
323 nmdc:mga08x19_56977_c1 3300050514 Bacteria 2524
324 nmdc:mga0a205_12807_c1 3300050515 Bacteria 7778
325 nmdc:mga0a205_310518_c1 3300050515 Bacteria 1449
326 nmdc:mga0a205_50467_c1 3300050515 Bacteria 4017
327 nmdc:mga0a205_600052_c1 3300050515 Unclassified 954
328 Ga0495601_0012566 3300053077 Bacteria 5077
329 Ga0495595_0120637 3300053084 Bacteria 1277
330 Ga0495619_0001198 3300053085 Bacteria 17092
331 Ga0495619_0039980 3300053085 Bacteria 3064
332 Ga0075428_101399579
333 JGI24746J21847_1015159
334 JGI24751J29686_10019262
335 Ga0065712_10000195
336 Ga0065712_10118798
337 Ga0065712_10441338
338 Ga0065715_10059379
339 Ga0065715_10598846
340 Ga0065707_10001545
341 Ga0065707_10103718
342 Ga0070683_100600654
343 Ga0070690_100471661
344 Ga0070690_100548752
345 Ga0070670_100128509
346 Ga0070670_100411589
347 Ga0068869_100441531
348 Ga0070666_10724258
349 Ga0070680_100111716
350 Ga0068868_100256250
351 Ga0070689_100017011
352 Ga0070669_100003576
353 Ga0070669_100036464
354 Ga0070669_100261244
355 Ga0070675_100000324
356 Ga0070675_100279380
357 Ga0070675_100394944
358 Ga0070675_100834781
359 Ga0070674_100047706
360 Ga0070674_100352368
361 Ga0070673_100162468
362 Ga0070688_100013446
363 Ga0070688_100075782
364 Ga0070659_100134502
365 Ga0070659_100586348
366 Ga0070700_100170373
367 Ga0070694_100206794
368 Ga0070708_100122888
369 Ga0070708_100709198
370 Ga0070678_101472945
371 Ga0070662_100409373
372 Ga0070681_10029256
373 Ga0070681_10715504
374 Ga0070685_10056847
375 Ga0070685_11140837
376 Ga0070706_100562024
377 Ga0070698_100671360
378 Ga0070679_100447553
379 Ga0070679_101032713
380 Ga0070684_100061198
381 Ga0070684_101145294
382 Ga0070672_100047132
383 Ga0070686_100049653
384 Ga0070686_100143601
385 Ga0070686_100194376
386 Ga0070693_100010552
387 Ga0068855_100240250
388 Ga0068855_100672461
389 Ga0068857_100055075
390 Ga0068857_100112122
391 Ga0068857_100656454
392 Ga0070702_100264730
393 Ga0068859_100000507
394 Ga0068859_100024221
395 Ga0068859_100056410
396 Ga0068859_100143995
397 Ga0068859_100214138
398 Ga0068859_101250465
399 Ga0068864_100081811
400 Ga0068864_100115458
401 Ga0068864_100371019
402 Ga0068861_100613576
403 Ga0068851_10108744
404 Ga0068870_10247848
405 Ga0068870_10263758
406 Ga0068863_100014431
407 Ga0068863_100446028
408 Ga0068863_100735944
409 Ga0068858_100007289
410 Ga0068858_100062201
411 Ga0068858_100485397
412 Ga0068860_100064764
413 Ga0068860_100125309
414 Ga0068860_100622556
415 Ga0068860_101068671
416 Ga0068860_101217876
417 Ga0068862_100013552
418 Ga0068862_100016333
419 Ga0068862_100042600
420 Ga0068862_100368877
421 Ga0081455_10036722
422 Ga0070716_100131215
423 Ga0070716_101118107
424 Ga0068871_101155395
425 Ga0075428_100004536
426 Ga0075428_100012169
427 Ga0075428_100063303
428 Ga0075428_100862151
429 Ga0075431_100457990
430 Ga0075433_10023934
431 Ga0075433_10059365
432 Ga0075433_10674633
433 Ga0075434_100000061
434 Ga0075434_100012378
435 Ga0075434_100022229
436 Ga0075434_100030998
437 Ga0075434_100242311
438 Ga0075434_100816951
439 Ga0075429_100084599
440 Ga0075429_100218944
441 Ga0068865_100270504
442 Ga0075436_100000167
443 Ga0075436_100245741
444 Ga0097620_100000507
445 Ga0097620_100024221
446 Ga0097620_100056411
447 Ga0097620_100143995
448 Ga0097620_100214139
449 Ga0097620_101250591
450 Ga0075435_100000023
451 Ga0075435_100002847
452 Ga0075435_100002968
453 Ga0075435_100123885
454 Ga0075435_100226462
455 Ga0075435_100567256
456 Ga0105240_10070862
457 Ga0111539_10091944
458 Ga0111539_10131486
459 Ga0111539_10350939
460 Ga0111539_10410884
461 Ga0111539_10507467
462 Ga0111539_10877082
463 Ga0111539_11274772
464 Ga0114129_10013282
465 Ga0114129_10015097
466 Ga0114129_10092802
467 Ga0114129_10117899
468 Ga0105243_11276257
469 Ga0105241_10300184
470 Ga0105248_10064644
471 Ga0105248_10918069
472 Ga0105249_10001741
473 Ga0105249_10116124
474 Ga0105246_10091877
475 Ga0157339_1039580
476 Ga0157374_10091621
477 Ga0157378_10534361
478 Ga0157372_10284368
479 Ga0157375_10027881
480 Ga0157375_10168213
481 Ga0157375_10687220
482 Ga0163163_10009692
483 Ga0163163_10078604
484 Ga0163163_10195446
485 Ga0157377_10586720
486 Ga0157379_10170620
487 Ga0157376_10313765
488 Ga0157376_10604330
489 Ga0157376_10697080
490 Ga0207647_10426466
491 Ga0207643_10279676
492 Ga0207654_10455028
493 Ga0207707_10192339
494 Ga0207707_10610598
495 Ga0207695_10051699
496 Ga0207660_10491605
497 Ga0207662_10375339
498 Ga0207652_10055876
499 Ga0207652_10991396
500 Ga0207681_10038667
501 Ga0207681_10258810
502 Ga0207681_10762472
503 Ga0207650_10027590
504 Ga0207650_10102932
505 Ga0207659_10000511
506 Ga0207659_10032174
507 Ga0207659_10300272
508 Ga0207644_10174850
509 Ga0207644_10584267
510 Ga0207690_10152211
511 Ga0207690_10172718
512 Ga0207670_10578542
513 Ga0207669_10116720
514 Ga0207704_10681561
515 Ga0207665_10753652
516 Ga0207691_10061902
517 Ga0207691_10074807
518 Ga0207711_10771439
519 Ga0207689_10449552
520 Ga0207689_10609466
521 Ga0207679_10131934
522 Ga0207667_10344680
523 Ga0207651_10267314
524 Ga0207651_10518385
525 Ga0207712_10530827
526 Ga0207677_10640484
527 Ga0207703_10010965
528 Ga0207703_10194718
529 Ga0207708_10147642
530 Ga0207708_11000802
531 Ga0207641_10003580
532 Ga0207641_10402106
533 Ga0207641_10615734
534 Ga0207676_10039768
535 Ga0207676_10078158
536 Ga0207674_10067554
537 Ga0207674_10128168
538 Ga0207674_10656116
539 Ga0207675_100397820
540 Ga0207675_100448591
541 Ga0209974_10048718
542 Ga0207428_10105256
543 Ga0268265_10762480
544 Ga0268264_10006593
545 Ga0268264_10244239
546 Ga0268264_10297624
547 Ga0268264_10358845
548 Ga0373930_0006485
549 Ga0373950_0000627
550 Ga0373959_0001407
551 Ga0373928_0003287
552 Ga0373929_0002243
553 Ga0373929_0134869
554 Ga0373934_0129977
555 Ga0373940_0001877
556 Ga0373949_0000220
557 Ga0373951_0000688
558 Ga0373952_0001390
559 Ga0373932_0001248
560 Ga0373939_0016975
561 Ga0373939_0022204
562 Ga0373939_0164259
563 Ga0373941_0003273
564 Ga0373941_0174252
565 Ga0373945_0205498
566 Ga0373954_0326525
567 Ga0373956_0155558
568 Ga0373960_0004095
569 Ga0373943_0494183
570 Ga0373942_0012713
571 Ga0373961_0005495
572 Ga0373962_0001447
573 Ga0373962_0028764
574 Ga0373924_0100657
575 Ga0373931_0515884
576 Ga0373931_0745187
577 Ga0373935_1267986
578 Ga0373937_0137945
579 Ga0373937_0250342
580 Ga0373925_0783208
581 Ga0466963_0348748
582 Ga0451576_0071175
583 Ga0451576_0199822
584 Ga0451576_0883218
585 Ga0451576_2116558
586 Ga0466967_0029172
587 Ga0466967_0242983
588 Ga0495592_0108524
589 Ga0495603_0071526
590 Ga0495582_0011665
591 Ga0495582_0069899
592 Ga0495664_0157429
593 Ga0495584_0450476
594 Ga0495585_0168928
595 Ga0495608_0004909
596 Ga0495618_0108471
597 Ga0495628_0137101
598 Ga0495630_0036361
599 Ga0495652_0116758
600 Ga0495587_0416903
601 Ga0495598_0071702
602 Ga0495609_0225170
603 Ga0495645_0173316
604 Ga0495667_0023870
605 Ga0495656_0344276
606 Ga0495634_0136182
607 Ga0495657_0310850
608 Ga0495599_0056400
609 Ga0495623_0331460
610 Ga0495658_0363438
611 Ga0495669_0114986
612 Ga0495613_0000490
613 Ga0495670_0055906
614 Ga0495589_0410919
615 Ga0495600_0011286
616 Ga0495604_0010705
617 Ga0495674_0043076
618 Ga0495680_0325423
619 Ga0495684_0000269
620 Ga0496100_0343048
621 Ga0496112_0298262
622 Ga0496112_0324309
623 Ga0496113_0761969
624 Ga0501298_038507
625 Ga0501034_0345663
626 Ga0501034_0747851
627 Ga0501047_0336607
628 Ga0501073_0452373
629 Ga0501249_047342
630 Ga0501272_042641
631 Ga0501044_0003961
632 nmdc:mga05p37_31803_c1
633 nmdc:mga09592_1150565_c1
634 nmdc:mga09592_147298_c1
635 nmdc:mga09592_703969_c1
636 nmdc:mga06r32_70328_c1
637 nmdc:mga08y16_181668_c1
638 nmdc:mga08y16_257117_c1
639 nmdc:mga08y16_305978_c1
640 nmdc:mga08y16_313440_c1
641 nmdc:mga08y16_692686_c1
642 nmdc:mga0n895_12631_c1
643 nmdc:mga0n895_13_c1
644 nmdc:mga0n895_339849_c1
645 nmdc:mga0n895_634686_c1
646 nmdc:mga0n895_73377_c1
647 nmdc:mga0rr50_12_c1
648 nmdc:mga0rr50_1608_c1
649 nmdc:mga0rr50_23319_c1
650 nmdc:mga0rr50_247120_c1
651 nmdc:mga0rr50_383375_c1
652 nmdc:mga0rr50_611334_c1
653 nmdc:mga08x19_240_c1
654 nmdc:mga08x19_56977_c1
655 nmdc:mga0a205_12807_c1
656 nmdc:mga0a205_310518_c1
657 nmdc:mga0a205_50467_c1
658 nmdc:mga0a205_600052_c1
659 Ga0495601_0012566
660 Ga0495595_0120637
661 Ga0495619_0001198
662 Ga0495619_0039980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

139

187

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

133

186

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

37

104

0.91

Map