F410434

General Info

Members Datasets Scaffolds Average Seq Length
331 178 662 194

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_101009453|Ga0068864_1010094531
Length 218
Sequence VAASTLVAGNFGNSGFQTLRREINEAPDGALECLMLTTLIELQRLKGLDRTGWVLRGFPNGTESVAAHSFGVGVTAMLLADELIAQGVAVDVEKILRIALLHDWAEARVGDMPRTATMYFGAEARKQAETAAFRDLTGNNDVYTSLYHQYEERNTLEARLVKAADVIDLLVQALALERAGGRGLDEFWEVADNPQLQLEGPAKQLVDDLLKSLLKARD

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
153 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
159 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
164 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
165 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
170 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
171 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.02
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 19.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_101009453 3300005618 Bacteria 825
2 MBSR1b_contig_5337256 2162886012 Unclassified 983
3 MBSR1b_contig_948035 2162886012 Bacteria 1033
4 CNAas_1002409 3300000532 Unclassified 1334
5 rootL2_10083878 3300003322 Unclassified 4019
6 Ga0065712_10180276 3300005290 Unclassified 1196
7 Ga0065715_10047568 3300005293 Bacteria 1032
8 Ga0065715_10172643 3300005293 Bacteria 1535
9 Ga0065715_10192113 3300005293 Bacteria 1409
10 Ga0065707_10088586 3300005295 Bacteria 4613
11 Ga0070690_100033871 3300005330 Unclassified 3199
12 Ga0070690_100340112 3300005330 Unclassified 1086
13 Ga0070670_100125350 3300005331 Bacteria 2217
14 Ga0068869_100009811 3300005334 Bacteria 6219
15 Ga0068869_100062663 3300005334 Unclassified 2730
16 Ga0068869_100064996 3300005334 Bacteria 2685
17 Ga0068869_100355306 3300005334 Bacteria 1195
18 Ga0068869_100464641 3300005334 Bacteria 1051
19 Ga0070666_10084621 3300005335 Unclassified 2171
20 Ga0070680_100001034 3300005336 Bacteria 19934
21 Ga0068868_100803010 3300005338 Bacteria 849
22 Ga0070687_100012235 3300005343 Bacteria 3782
23 Ga0070669_100051769 3300005353 Bacteria 3003
24 Ga0070669_100424012 3300005353 Bacteria 1092
25 Ga0070675_100067019 3300005354 Bacteria 2970
26 Ga0070671_100138132 3300005355 Bacteria 2056
27 Ga0070671_100338816 3300005355 Bacteria 1282
28 Ga0070673_100034442 3300005364 Unclassified 3833
29 Ga0070673_100230677 3300005364 Bacteria 1606
30 Ga0070673_100259980 3300005364 Bacteria 1516
31 Ga0070667_100148418 3300005367 Unclassified 2058
32 Ga0070703_10002889 3300005406 Bacteria 4918
33 Ga0070701_10070448 3300005438 Bacteria 1868
34 Ga0070700_100021786 3300005441 Bacteria 3729
35 Ga0070694_100111935 3300005444 Bacteria 1946
36 Ga0070694_100142052 3300005444 Unclassified 1745
37 Ga0070694_100280297 3300005444 Bacteria 1271
38 Ga0070708_100069518 3300005445 Bacteria 3166
39 Ga0070708_100228445 3300005445 Bacteria 1746
40 Ga0070708_100272462 3300005445 Bacteria 1592
41 Ga0070708_100467621 3300005445 Bacteria 1190
42 Ga0070708_100910403 3300005445 Unclassified 826
43 Ga0070662_100160135 3300005457 Unclassified 1760
44 Ga0070681_10000103 3300005458 Bacteria 63054
45 Ga0070681_10948890 3300005458 Bacteria 779
46 Ga0068867_100488448 3300005459 Bacteria 1056
47 Ga0070706_100003593 3300005467 Bacteria 15213
48 Ga0070706_100029188 3300005467 Bacteria 5082
49 Ga0070706_100339450 3300005467 Bacteria 1401
50 Ga0070706_100890478 3300005467 Bacteria 822
51 Ga0070707_100120784 3300005468 Unclassified 2544
52 Ga0070698_100035506 3300005471 Bacteria 5155
53 Ga0070698_100100641 3300005471 Bacteria 2862
54 Ga0070699_100005202 3300005518 Bacteria 11438
55 Ga0070699_100010950 3300005518 Bacteria 7843
56 Ga0070699_100019935 3300005518 Bacteria 5779
57 Ga0070699_100097892 3300005518 Bacteria 2570
58 Ga0070699_100298232 3300005518 Bacteria 1446
59 Ga0070679_100000492 3300005530 Bacteria 33622
60 Ga0070697_100001663 3300005536 Bacteria 16961
61 Ga0070697_100070837 3300005536 Bacteria 2859
62 Ga0070697_100094764 3300005536 Bacteria 2474
63 Ga0070697_100183193 3300005536 Bacteria 1775
64 Ga0068853_100438395 3300005539 Bacteria 1227
65 Ga0068853_100491840 3300005539 Bacteria 1157
66 Ga0068853_100510850 3300005539 Unclassified 1135
67 Ga0070686_100002485 3300005544 Bacteria 10151
68 Ga0070695_100068923 3300005545 Unclassified 2311
69 Ga0070696_100094853 3300005546 Bacteria 2130
70 Ga0070696_100120300 3300005546 Bacteria 1900
71 Ga0070696_100127906 3300005546 Unclassified 1845
72 Ga0070693_100000878 3300005547 Bacteria 13388
73 Ga0070693_100016751 3300005547 Bacteria 3799
74 Ga0070693_100131993 3300005547 Bacteria 1563
75 Ga0070704_100057907 3300005549 Bacteria 2758
76 Ga0070704_100076720 3300005549 Bacteria 2445
77 Ga0070704_100088922 3300005549 Unclassified 2296
78 Ga0070704_100179904 3300005549 Bacteria 1690
79 Ga0068855_100493097 3300005563 Bacteria 1332
80 Ga0068855_101005351 3300005563 Bacteria 876
81 Ga0068855_101022688 3300005563 Unclassified 867
82 Ga0070664_100483709 3300005564 Unclassified 1139
83 Ga0068857_100580747 3300005577 Bacteria 1058
84 Ga0068856_100001146 3300005614 Bacteria 27859
85 Ga0070702_100013435 3300005615 Bacteria 4134
86 Ga0070702_100045045 3300005615 Bacteria 2494
87 Ga0070702_100549582 3300005615 Bacteria 857
88 Ga0068852_100082242 3300005616 Bacteria 2861
89 Ga0068859_100241352 3300005617 Bacteria 1896
90 Ga0068859_100529934 3300005617 Bacteria 1273
91 Ga0068859_101444524 3300005617 Bacteria 759
92 Ga0068864_100002379 3300005618 Bacteria 15560
93 Ga0068861_100002995 3300005719 Bacteria 11149
94 Ga0068861_100009256 3300005719 Bacteria 6796
95 Ga0068861_100684615 3300005719 Bacteria 951
96 Ga0068851_10002032 3300005834 Bacteria 8924
97 Ga0068863_100476603 3300005841 Bacteria 1227
98 Ga0068863_100545841 3300005841 Bacteria 1144
99 Ga0068863_100814453 3300005841 Unclassified 932
100 Ga0068858_100015801 3300005842 Bacteria 7099
101 Ga0068858_100020383 3300005842 Bacteria 6201
102 Ga0068858_100103838 3300005842 Bacteria 2652
103 Ga0068858_100128373 3300005842 Bacteria 2376
104 Ga0068860_100019122 3300005843 Bacteria 6651
105 Ga0068860_100232634 3300005843 Unclassified 1791
106 Ga0068862_100007480 3300005844 Bacteria 9055
107 Ga0081539_10002144 3300005985 Bacteria 29163
108 Ga0070716_100028287 3300006173 Bacteria 3019
109 Ga0097621_100002148 3300006237 Unclassified 13491
110 Ga0097621_100125419 3300006237 Bacteria 2181
111 Ga0075428_100324995 3300006844 Bacteria 1653
112 Ga0075428_100554724 3300006844 Unclassified 1228
113 Ga0075430_100016493 3300006846 Bacteria 6291
114 Ga0075431_100046506 3300006847 Bacteria 4475
115 Ga0075433_10046821 3300006852 Bacteria 3762
116 Ga0075433_10136233 3300006852 Bacteria 2183
117 Ga0075433_10222720 3300006852 Bacteria 1675
118 Ga0075433_10248588 3300006852 Unclassified 1578
119 Ga0075434_100152346 3300006871 Bacteria 2332
120 Ga0075434_100278149 3300006871 Unclassified 1693
121 Ga0075429_100050573 3300006880 Bacteria 3615
122 Ga0075436_100132654 3300006914 Bacteria 1747
123 Ga0097620_100241344 3300006931 Bacteria 1896
124 Ga0097620_100529923 3300006931 Bacteria 1273
125 Ga0097620_101444648 3300006931 Bacteria 759
126 Ga0075435_100110105 3300007076 Bacteria 2290
127 Ga0075435_100771574 3300007076 Bacteria 837
128 Ga0105240_11631138 3300009093 Unclassified 674
129 Ga0111539_10021254 3300009094 Bacteria 7990
130 Ga0111539_10104016 3300009094 Bacteria 3332
131 Ga0111539_10179180 3300009094 Bacteria 2476
132 Ga0105247_10041711 3300009101 Bacteria 2809
133 Ga0114129_10016614 3300009147 Bacteria 10483
134 Ga0114129_10019683 3300009147 Bacteria 9607
135 Ga0114129_10030695 3300009147 Bacteria 7602
136 Ga0114129_10031920 3300009147 Bacteria 7447
137 Ga0114129_10284903 3300009147 Bacteria 2206
138 Ga0114129_10819279 3300009147 Bacteria 1186
139 Ga0114129_10858060 3300009147 Bacteria 1154
140 Ga0105243_10518903 3300009148 Bacteria 1133
141 Ga0105241_10089170 3300009174 Bacteria 2430
142 Ga0105241_10138043 3300009174 Unclassified 1982
143 Ga0105241_10304291 3300009174 Bacteria 1369
144 Ga0105241_10473001 3300009174 Bacteria 1112
145 Ga0105241_10801142 3300009174 Unclassified 868
146 Ga0105242_10399074 3300009176 Unclassified 1283
147 Ga0105248_10005745 3300009177 Bacteria 13628
148 Ga0105248_10115346 3300009177 Bacteria 3030
149 Ga0105248_10144446 3300009177 Bacteria 2685
150 Ga0105248_10890024 3300009177 Bacteria 1005
151 Ga0105237_10006325 3300009545 Bacteria 13163
152 Ga0105237_10116725 3300009545 Unclassified 2663
153 Ga0105249_10022747 3300009553 Bacteria 5618
154 Ga0105249_10401128 3300009553 Bacteria 1402
155 Ga0105239_10153522 3300010375 Unclassified 2570
156 Ga0105246_10872608 3300011119 Bacteria 805
157 Ga0157374_10069663 3300013296 Bacteria 3312
158 Ga0157374_10104763 3300013296 Bacteria 2716
159 Ga0157378_10001621 3300013297 Bacteria 20349
160 Ga0157378_10028324 3300013297 Unclassified 4942
161 Ga0157378_10062813 3300013297 Bacteria 3317
162 Ga0157378_10104820 3300013297 Bacteria 2585
163 Ga0157378_10174466 3300013297 Bacteria 2018
164 Ga0157378_11003600 3300013297 Unclassified 869
165 Ga0163162_10001376 3300013306 Bacteria 22623
166 Ga0163162_10045786 3300013306 Bacteria 4383
167 Ga0163162_10197667 3300013306 Bacteria 2140
168 Ga0163162_10227552 3300013306 Bacteria 1995
169 Ga0163162_10851689 3300013306 Bacteria 1027
170 Ga0157372_10029226 3300013307 Bacteria 6017
171 Ga0157375_10076890 3300013308 Bacteria 3366
172 Ga0157375_10169117 3300013308 Bacteria 2333
173 Ga0157375_10240109 3300013308 Bacteria 1971
174 Ga0157375_10420443 3300013308 Bacteria 1502
175 Ga0157375_11507553 3300013308 Bacteria 794
176 Ga0163163_10000801 3300014325 Bacteria 26677
177 Ga0163163_10001930 3300014325 Bacteria 17559
178 Ga0157380_10001184 3300014326 Bacteria 16877
179 Ga0157380_10062510 3300014326 Unclassified 2983
180 Ga0157380_10719133 3300014326 Unclassified 1006
181 Ga0157380_10758972 3300014326 Bacteria 982
182 Ga0157379_10087959 3300014968 Bacteria 2786
183 Ga0157379_10165859 3300014968 Bacteria 1993
184 Ga0157379_10671351 3300014968 Bacteria 971
185 Ga0157376_10188138 3300014969 Bacteria 1891
186 Ga0163161_10021457 3300017792 Unclassified 4538
187 Ga0213876_10000137 3300021384 Bacteria 79910
188 Ga0207656_10029602 3300025321 Bacteria 2257
189 Ga0207710_10096796 3300025900 Bacteria 1388
190 Ga0207680_10069473 3300025903 Unclassified 2177
191 Ga0207684_10004145 3300025910 Bacteria 13786
192 Ga0207684_10057205 3300025910 Bacteria 3308
193 Ga0207684_10373580 3300025910 Bacteria 1226
194 Ga0207654_10045795 3300025911 Bacteria 2491
195 Ga0207654_10117755 3300025911 Bacteria 1663
196 Ga0207654_10586814 3300025911 Bacteria 794
197 Ga0207707_10000033 3300025912 Bacteria 158362
198 Ga0207707_10518898 3300025912 Bacteria 1015
199 Ga0207671_10004666 3300025914 Bacteria 12970
200 Ga0207660_10000364 3300025917 Bacteria 29558
201 Ga0207662_10312797 3300025918 Bacteria 1047
202 Ga0207652_10000032 3300025921 Bacteria 143319
203 Ga0207646_10145025 3300025922 Bacteria 2139
204 Ga0207646_10844840 3300025922 Bacteria 814
205 Ga0207681_10076886 3300025923 Bacteria 2345
206 Ga0207681_10224145 3300025923 Unclassified 1456
207 Ga0207650_10101083 3300025925 Bacteria 2219
208 Ga0207644_10132929 3300025931 Bacteria 1907
209 Ga0207706_10084287 3300025933 Bacteria 2794
210 Ga0207706_10799088 3300025933 Unclassified 801
211 Ga0207704_10576199 3300025938 Unclassified 918
212 Ga0207665_10042996 3300025939 Bacteria 3020
213 Ga0207711_10161698 3300025941 Bacteria 2027
214 Ga0207711_10509184 3300025941 Unclassified 1122
215 Ga0207689_10021620 3300025942 Bacteria 5410
216 Ga0207689_10077449 3300025942 Unclassified 2733
217 Ga0207689_10302435 3300025942 Bacteria 1326
218 Ga0207679_10414859 3300025945 Bacteria 1187
219 Ga0207679_10433007 3300025945 Unclassified 1163
220 Ga0207667_10673585 3300025949 Bacteria 1038
221 Ga0207651_10196519 3300025960 Bacteria 1613
222 Ga0207712_10053408 3300025961 Unclassified 2835
223 Ga0207712_10304726 3300025961 Bacteria 1309
224 Ga0207658_10390909 3300025986 Bacteria 1220
225 Ga0207677_10007186 3300026023 Bacteria 6136
226 Ga0207677_10058534 3300026023 Unclassified 2654
227 Ga0207703_10029819 3300026035 Bacteria 4307
228 Ga0207703_10084143 3300026035 Bacteria 2659
229 Ga0207703_11001106 3300026035 Unclassified 802
230 Ga0207639_10091335 3300026041 Bacteria 2437
231 Ga0207708_10047144 3300026075 Bacteria 3282
232 Ga0207641_10361094 3300026088 Bacteria 1387
233 Ga0207641_10478253 3300026088 Bacteria 1207
234 Ga0207676_10113504 3300026095 Bacteria 2272
235 Ga0207676_10619307 3300026095 Bacteria 1041
236 Ga0207676_11057071 3300026095 Bacteria 801
237 Ga0207674_10920171 3300026116 Bacteria 843
238 Ga0207675_100005590 3300026118 Bacteria 12033
239 Ga0207675_100040192 3300026118 Bacteria 4366
240 Ga0207675_100321101 3300026118 Bacteria 1512
241 Ga0207698_10022355 3300026142 Bacteria 4392
242 Ga0207698_10230229 3300026142 Bacteria 1682
243 Ga0207698_10928492 3300026142 Unclassified 878
244 Ga0207428_10080746 3300027907 Bacteria 2540
245 Ga0207428_10460794 3300027907 Unclassified 926
246 Ga0207428_10498783 3300027907 Unclassified 884
247 Ga0268265_10016596 3300028380 Bacteria 5063
248 Ga0268265_10633406 3300028380 Bacteria 1026
249 Ga0268264_10027892 3300028381 Bacteria 4616
250 Ga0268264_10199850 3300028381 Unclassified 1828
251 Ga0307515_10200455 3300028794 Bacteria 1873
252 Ga0307408_100037624 3300031548 Bacteria 3409
253 Ga0307405_10003341 3300031731 Bacteria 7349
254 Ga0307405_10410041 3300031731 Bacteria 1063
255 Ga0307413_10141442 3300031824 Bacteria 1663
256 Ga0307410_10058797 3300031852 Bacteria 2622
257 Ga0307406_11113571 3300031901 Bacteria 682
258 Ga0307406_11146102 3300031901 Bacteria 673
259 Ga0307407_10091910 3300031903 Bacteria 1862
260 Ga0307412_10002204 3300031911 Bacteria 10817
261 Ga0307412_10473900 3300031911 Bacteria 1036
262 Ga0307416_100067076 3300032002 Bacteria 2957
263 Ga0307416_100531137 3300032002 Bacteria 1246
264 Ga0307414_10012176 3300032004 Bacteria 5074
265 Ga0307414_10788491 3300032004 Bacteria 866
266 Ga0307411_10009970 3300032005 Bacteria 5033
267 Ga0307415_100008785 3300032126 Bacteria 5623
268 Ga0307415_100052746 3300032126 Bacteria 2767
269 Ga0395900_0176618 3300037418 Bacteria 2172
270 Ga0395900_0353379 3300037418 Bacteria 1443
271 Ga0395898_0325749 3300037466 Bacteria 1465
272 Ga0395901_0527615 3300038443 Bacteria 1199
273 Ga0395901_0855519 3300038443 Bacteria 894
274 Ga0450889_018416 3300042144 Unclassified 763
275 Ga0495658_0081494 3300046683 Bacteria 1900
276 Ga0496102_0202657 3300048905 Bacteria 1870
277 Ga0496104_0300295 3300048907 Bacteria 1518
278 Ga0496104_0367189 3300048907 Bacteria 1352
279 Ga0496107_0231537 3300048910 Bacteria 1375
280 Ga0496108_0176276 3300048911 Bacteria 1851
281 Ga0496110_0347210 3300048913 Bacteria 1352
282 Ga0496112_0225836 3300048915 Bacteria 1828
283 Ga0496112_1190747 3300048915 Unclassified 679
284 Ga0496113_0149734 3300048916 Bacteria 1840
285 Ga0496113_0224602 3300048916 Bacteria 1497
286 Ga0501298_101222 3300049521 Bacteria 657
287 Ga0501299_001321 3300049522 Bacteria 3154
288 Ga0501038_0013221 3300049574 Bacteria 7528
289 Ga0501077_0301426 3300049593 Bacteria 1021
290 Ga0501198_009419 3300049649 Bacteria 1433
291 Ga0501199_019697 3300049650 Bacteria 777
292 Ga0501202_006033 3300049652 Bacteria 2157
293 Ga0501207_003136 3300049654 Bacteria 2178
294 Ga0501217_002950 3300049661 Bacteria 3403
295 Ga0501227_003460 3300049665 Bacteria 3422
296 Ga0501230_003211 3300049667 Bacteria 2152
297 Ga0501233_006271 3300049668 Bacteria 2230
298 Ga0501235_090527 3300049669 Bacteria 738
299 Ga0501236_007922 3300049670 Bacteria 1338
300 Ga0501243_003620 3300049675 Bacteria 2301
301 Ga0501246_026709 3300049676 Bacteria 628
302 Ga0501253_033857 3300049683 Bacteria 991
303 Ga0501221_040035 3300049704 Bacteria 1018
304 Ga0501225_0016368 3300049705 Bacteria 2061
305 Ga0501234_008758 3300049707 Bacteria 1577
306 Ga0501234_025694 3300049707 Bacteria 945
307 Ga0501245_031654 3300049708 Bacteria 877
308 Ga0501272_011636 3300049769 Bacteria 993
309 Ga0501279_008196 3300049775 Bacteria 1394
310 Ga0501283_064896 3300049779 Bacteria 664
311 nmdc:mga05p37_141051_c1 3300050507 Bacteria 2953
312 nmdc:mga05p37_62827_c1 3300050507 Unclassified 4570
313 nmdc:mga05p37_66703_c1 3300050507 Unclassified 4426
314 nmdc:mga05p37_75445_c1 3300050507 Unclassified 4150
315 nmdc:mga05p37_843119_c1 3300050507 Bacteria 996
316 nmdc:mga08y16_18816_c1 3300050511 Bacteria 7277
317 nmdc:mga08y16_210498_c1 3300050511 Unclassified 2014
318 nmdc:mga08y16_49523_c1 3300050511 Bacteria 4397
319 nmdc:mga08y16_670058_c1 3300050511 Unclassified 1040
320 nmdc:mga0n895_380713_c1 3300050512 Unclassified 1428
321 nmdc:mga0rr50_156676_c1 3300050513 Bacteria 1845
322 nmdc:mga0rr50_581175_c1 3300050513 Unclassified 954
323 nmdc:mga0rr50_598017_c1 3300050513 Unclassified 940
324 nmdc:mga08x19_64167_c1 3300050514 Bacteria 2384
325 nmdc:mga0a205_14160_c1 3300050515 Bacteria 7441
326 nmdc:mga0a205_150957_c1 3300050515 Bacteria 2223
327 nmdc:mga0a205_198658_c1 3300050515 Bacteria 1896
328 nmdc:mga0a205_411937_c1 3300050515 Bacteria 1214
329 nmdc:mga0a205_608040_c1 3300050515 Unclassified 946
330 nmdc:mga0a205_898534_c1 3300050515 Unclassified 733
331 Ga0500616_0009863 3300053153 Bacteria 5756
332 Ga0068864_101009453
333 MBSR1b_contig_5337256
334 MBSR1b_contig_948035
335 CNAas_1002409
336 rootL2_10083878
337 Ga0065712_10180276
338 Ga0065715_10047568
339 Ga0065715_10172643
340 Ga0065715_10192113
341 Ga0065707_10088586
342 Ga0070690_100033871
343 Ga0070690_100340112
344 Ga0070670_100125350
345 Ga0068869_100009811
346 Ga0068869_100062663
347 Ga0068869_100064996
348 Ga0068869_100355306
349 Ga0068869_100464641
350 Ga0070666_10084621
351 Ga0070680_100001034
352 Ga0068868_100803010
353 Ga0070687_100012235
354 Ga0070669_100051769
355 Ga0070669_100424012
356 Ga0070675_100067019
357 Ga0070671_100138132
358 Ga0070671_100338816
359 Ga0070673_100034442
360 Ga0070673_100230677
361 Ga0070673_100259980
362 Ga0070667_100148418
363 Ga0070703_10002889
364 Ga0070701_10070448
365 Ga0070700_100021786
366 Ga0070694_100111935
367 Ga0070694_100142052
368 Ga0070694_100280297
369 Ga0070708_100069518
370 Ga0070708_100228445
371 Ga0070708_100272462
372 Ga0070708_100467621
373 Ga0070708_100910403
374 Ga0070662_100160135
375 Ga0070681_10000103
376 Ga0070681_10948890
377 Ga0068867_100488448
378 Ga0070706_100003593
379 Ga0070706_100029188
380 Ga0070706_100339450
381 Ga0070706_100890478
382 Ga0070707_100120784
383 Ga0070698_100035506
384 Ga0070698_100100641
385 Ga0070699_100005202
386 Ga0070699_100010950
387 Ga0070699_100019935
388 Ga0070699_100097892
389 Ga0070699_100298232
390 Ga0070679_100000492
391 Ga0070697_100001663
392 Ga0070697_100070837
393 Ga0070697_100094764
394 Ga0070697_100183193
395 Ga0068853_100438395
396 Ga0068853_100491840
397 Ga0068853_100510850
398 Ga0070686_100002485
399 Ga0070695_100068923
400 Ga0070696_100094853
401 Ga0070696_100120300
402 Ga0070696_100127906
403 Ga0070693_100000878
404 Ga0070693_100016751
405 Ga0070693_100131993
406 Ga0070704_100057907
407 Ga0070704_100076720
408 Ga0070704_100088922
409 Ga0070704_100179904
410 Ga0068855_100493097
411 Ga0068855_101005351
412 Ga0068855_101022688
413 Ga0070664_100483709
414 Ga0068857_100580747
415 Ga0068856_100001146
416 Ga0070702_100013435
417 Ga0070702_100045045
418 Ga0070702_100549582
419 Ga0068852_100082242
420 Ga0068859_100241352
421 Ga0068859_100529934
422 Ga0068859_101444524
423 Ga0068864_100002379
424 Ga0068861_100002995
425 Ga0068861_100009256
426 Ga0068861_100684615
427 Ga0068851_10002032
428 Ga0068863_100476603
429 Ga0068863_100545841
430 Ga0068863_100814453
431 Ga0068858_100015801
432 Ga0068858_100020383
433 Ga0068858_100103838
434 Ga0068858_100128373
435 Ga0068860_100019122
436 Ga0068860_100232634
437 Ga0068862_100007480
438 Ga0081539_10002144
439 Ga0070716_100028287
440 Ga0097621_100002148
441 Ga0097621_100125419
442 Ga0075428_100324995
443 Ga0075428_100554724
444 Ga0075430_100016493
445 Ga0075431_100046506
446 Ga0075433_10046821
447 Ga0075433_10136233
448 Ga0075433_10222720
449 Ga0075433_10248588
450 Ga0075434_100152346
451 Ga0075434_100278149
452 Ga0075429_100050573
453 Ga0075436_100132654
454 Ga0097620_100241344
455 Ga0097620_100529923
456 Ga0097620_101444648
457 Ga0075435_100110105
458 Ga0075435_100771574
459 Ga0105240_11631138
460 Ga0111539_10021254
461 Ga0111539_10104016
462 Ga0111539_10179180
463 Ga0105247_10041711
464 Ga0114129_10016614
465 Ga0114129_10019683
466 Ga0114129_10030695
467 Ga0114129_10031920
468 Ga0114129_10284903
469 Ga0114129_10819279
470 Ga0114129_10858060
471 Ga0105243_10518903
472 Ga0105241_10089170
473 Ga0105241_10138043
474 Ga0105241_10304291
475 Ga0105241_10473001
476 Ga0105241_10801142
477 Ga0105242_10399074
478 Ga0105248_10005745
479 Ga0105248_10115346
480 Ga0105248_10144446
481 Ga0105248_10890024
482 Ga0105237_10006325
483 Ga0105237_10116725
484 Ga0105249_10022747
485 Ga0105249_10401128
486 Ga0105239_10153522
487 Ga0105246_10872608
488 Ga0157374_10069663
489 Ga0157374_10104763
490 Ga0157378_10001621
491 Ga0157378_10028324
492 Ga0157378_10062813
493 Ga0157378_10104820
494 Ga0157378_10174466
495 Ga0157378_11003600
496 Ga0163162_10001376
497 Ga0163162_10045786
498 Ga0163162_10197667
499 Ga0163162_10227552
500 Ga0163162_10851689
501 Ga0157372_10029226
502 Ga0157375_10076890
503 Ga0157375_10169117
504 Ga0157375_10240109
505 Ga0157375_10420443
506 Ga0157375_11507553
507 Ga0163163_10000801
508 Ga0163163_10001930
509 Ga0157380_10001184
510 Ga0157380_10062510
511 Ga0157380_10719133
512 Ga0157380_10758972
513 Ga0157379_10087959
514 Ga0157379_10165859
515 Ga0157379_10671351
516 Ga0157376_10188138
517 Ga0163161_10021457
518 Ga0213876_10000137
519 Ga0207656_10029602
520 Ga0207710_10096796
521 Ga0207680_10069473
522 Ga0207684_10004145
523 Ga0207684_10057205
524 Ga0207684_10373580
525 Ga0207654_10045795
526 Ga0207654_10117755
527 Ga0207654_10586814
528 Ga0207707_10000033
529 Ga0207707_10518898
530 Ga0207671_10004666
531 Ga0207660_10000364
532 Ga0207662_10312797
533 Ga0207652_10000032
534 Ga0207646_10145025
535 Ga0207646_10844840
536 Ga0207681_10076886
537 Ga0207681_10224145
538 Ga0207650_10101083
539 Ga0207644_10132929
540 Ga0207706_10084287
541 Ga0207706_10799088
542 Ga0207704_10576199
543 Ga0207665_10042996
544 Ga0207711_10161698
545 Ga0207711_10509184
546 Ga0207689_10021620
547 Ga0207689_10077449
548 Ga0207689_10302435
549 Ga0207679_10414859
550 Ga0207679_10433007
551 Ga0207667_10673585
552 Ga0207651_10196519
553 Ga0207712_10053408
554 Ga0207712_10304726
555 Ga0207658_10390909
556 Ga0207677_10007186
557 Ga0207677_10058534
558 Ga0207703_10029819
559 Ga0207703_10084143
560 Ga0207703_11001106
561 Ga0207639_10091335
562 Ga0207708_10047144
563 Ga0207641_10361094
564 Ga0207641_10478253
565 Ga0207676_10113504
566 Ga0207676_10619307
567 Ga0207676_11057071
568 Ga0207674_10920171
569 Ga0207675_100005590
570 Ga0207675_100040192
571 Ga0207675_100321101
572 Ga0207698_10022355
573 Ga0207698_10230229
574 Ga0207698_10928492
575 Ga0207428_10080746
576 Ga0207428_10460794
577 Ga0207428_10498783
578 Ga0268265_10016596
579 Ga0268265_10633406
580 Ga0268264_10027892
581 Ga0268264_10199850
582 Ga0307515_10200455
583 Ga0307408_100037624
584 Ga0307405_10003341
585 Ga0307405_10410041
586 Ga0307413_10141442
587 Ga0307410_10058797
588 Ga0307406_11113571
589 Ga0307406_11146102
590 Ga0307407_10091910
591 Ga0307412_10002204
592 Ga0307412_10473900
593 Ga0307416_100067076
594 Ga0307416_100531137
595 Ga0307414_10012176
596 Ga0307414_10788491
597 Ga0307411_10009970
598 Ga0307415_100008785
599 Ga0307415_100052746
600 Ga0395900_0176618
601 Ga0395900_0353379
602 Ga0395898_0325749
603 Ga0395901_0527615
604 Ga0395901_0855519
605 Ga0450889_018416
606 Ga0495658_0081494
607 Ga0496102_0202657
608 Ga0496104_0300295
609 Ga0496104_0367189
610 Ga0496107_0231537
611 Ga0496108_0176276
612 Ga0496110_0347210
613 Ga0496112_0225836
614 Ga0496112_1190747
615 Ga0496113_0149734
616 Ga0496113_0224602
617 Ga0501298_101222
618 Ga0501299_001321
619 Ga0501038_0013221
620 Ga0501077_0301426
621 Ga0501198_009419
622 Ga0501199_019697
623 Ga0501202_006033
624 Ga0501207_003136
625 Ga0501217_002950
626 Ga0501227_003460
627 Ga0501230_003211
628 Ga0501233_006271
629 Ga0501235_090527
630 Ga0501236_007922
631 Ga0501243_003620
632 Ga0501246_026709
633 Ga0501253_033857
634 Ga0501221_040035
635 Ga0501225_0016368
636 Ga0501234_008758
637 Ga0501234_025694
638 Ga0501245_031654
639 Ga0501272_011636
640 Ga0501279_008196
641 Ga0501283_064896
642 nmdc:mga05p37_141051_c1
643 nmdc:mga05p37_62827_c1
644 nmdc:mga05p37_66703_c1
645 nmdc:mga05p37_75445_c1
646 nmdc:mga05p37_843119_c1
647 nmdc:mga08y16_18816_c1
648 nmdc:mga08y16_210498_c1
649 nmdc:mga08y16_49523_c1
650 nmdc:mga08y16_670058_c1
651 nmdc:mga0n895_380713_c1
652 nmdc:mga0rr50_156676_c1
653 nmdc:mga0rr50_581175_c1
654 nmdc:mga0rr50_598017_c1
655 nmdc:mga08x19_64167_c1
656 nmdc:mga0a205_14160_c1
657 nmdc:mga0a205_150957_c1
658 nmdc:mga0a205_198658_c1
659 nmdc:mga0a205_411937_c1
660 nmdc:mga0a205_608040_c1
661 nmdc:mga0a205_898534_c1
662 Ga0500616_0009863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13023

HD_3

HD domain

42

194

0.85

PF01966

HD

HD domain

65

170

0.72

PF12917

YfbR-like

5'-deoxynucleotidase YfbR-like

39

216

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xx7-assembly1.cif.gz_E conserved hypothetical protein from pyrococcus furiosus pfu-403030-001 0.7841 2 179
1xx7-assembly1.cif.gz_F conserved hypothetical protein from pyrococcus furiosus pfu-403030-001 0.7835 2 179
1xx7-assembly1.cif.gz_C conserved hypothetical protein from pyrococcus furiosus pfu-403030-001 0.778 2 179
1xx7-assembly1.cif.gz_D conserved hypothetical protein from pyrococcus furiosus pfu-403030-001 0.7703 2 179
1xx7-assembly1.cif.gz_E conserved hypothetical protein from pyrococcus furiosus pfu-403030-001 0.7528 2 179
ID Description Score Start End Superfamily
af_Q6ETL6_43_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7876 2 187 1.10.3210.10
1xx7F00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7835 2 179 1.10.3210.10
af_Q93ZV1_60_258_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7756 2 189 1.10.3210.10
af_Q9VMB3_169_364_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7735 2 190 1.10.3210.10
af_P87242_1_196_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7553 1 190 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A0U3A9P9-F1-model_v4 HD domain protein 0.9716 44 122
AF-A0A0U3AFA3-F1-model_v4 HD domain protein 0.9649 41 190 GO:0002953
GO:0005737
AF-A0A0U2Q461-F1-model_v4 HD domain protein 0.9438 66 190 GO:0002953
GO:0005737
AF-A0A0U3A9P9-F1-model_v4 HD domain protein 0.937 44 122
AF-A0A0U3AFA3-F1-model_v4 HD domain protein 0.9172 41 190 GO:0002953
GO:0005737

Map