F410413

General Info

Members Datasets Scaffolds Average Seq Length
331 101 662 80

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100795574|Ga0070708_1007955742
Length 79
Sequence MSITIATSLDLKGLSCPLPIIKTATAMKRLAPGEMLEAFATDPGSVPDFKAWAKATGNPLVQSDDSAGVFHFVLQKKES

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
19 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
28 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
29 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
30 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
31 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
34 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
35 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
41 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
42 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
43 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
55 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
56 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
57 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
58 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
59 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
60 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
61 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
62 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
63 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
98 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
99 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.21
Metatranscriptomes 27.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 28.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100795574 3300005445 Unclassified 889
2 Ga0070683_100308656 3300005329 Bacteria 1505
3 Ga0068869_100994652 3300005334 Bacteria 730
4 Ga0068869_101567545 3300005334 Unclassified 586
5 Ga0070687_100710821 3300005343 Bacteria 703
6 Ga0070671_101774680 3300005355 Bacteria 548
7 Ga0070673_100190780 3300005364 Bacteria 1760
8 Ga0070714_100274062 3300005435 Bacteria 1565
9 Ga0070694_100545666 3300005444 Bacteria 928
10 Ga0070708_100014992 3300005445 Bacteria 6391
11 Ga0070706_100212993 3300005467 Bacteria 1804
12 Ga0070707_102150604 3300005468 Bacteria 525
13 Ga0070684_100477814 3300005535 Bacteria 1153
14 Ga0070704_100623269 3300005549 Bacteria 950
15 Ga0068859_103119881 3300005617 Bacteria 505
16 Ga0070717_10000078 3300006028 Bacteria 80104
17 Ga0097620_103119820 3300006931 Bacteria 505
18 Ga0105245_10215866 3300009098 Bacteria 1848
19 Ga0105243_10136985 3300009148 Bacteria 2084
20 Ga0157378_10082199 3300013297 Bacteria 2912
21 Ga0207645_10440900 3300025907 Bacteria 878
22 Ga0207684_10211360 3300025910 Unclassified 1674
23 Ga0207662_10386817 3300025918 Bacteria 946
24 Ga0207687_10843360 3300025927 Bacteria 783
25 Ga0207689_10258350 3300025942 Bacteria 1441
26 Ga0207661_10162152 3300025944 Unclassified 1941
27 Ga0207651_10458490 3300025960 Bacteria 1095
28 Ga0207678_10476286 3300026067 Bacteria 1087
29 Ga0265323_10041670 3300028653 Bacteria 1665
30 Ga0265322_10002158 3300028654 Bacteria 6121
31 Ga0265330_10009520 3300031235 Unclassified 4615
32 Ga0265329_10003663 3300031242 Bacteria 6629
33 Ga0265339_10601636 3300031249 Unclassified 504
34 Ga0265316_10049866 3300031344 Unclassified 3295
35 Ga0316575_10002000 3300031665 Bacteria 6764
36 Ga0316575_10036621 3300031665 Bacteria 1930
37 Ga0316575_10132142 3300031665 Bacteria 1024
38 Ga0316575_10315570 3300031665 Bacteria 662
39 Ga0316575_10360467 3300031665 Unclassified 620
40 Ga0316575_10539779 3300031665 Unclassified 508
41 Ga0316579_10022905 3300031691 Bacteria 2798
42 Ga0316579_10061451 3300031691 Unclassified 1768
43 Ga0316579_10064649 3300031691 Bacteria 1725
44 Ga0316579_10112591 3300031691 Bacteria 1306
45 Ga0316579_10336589 3300031691 Unclassified 730
46 Ga0316579_10377409 3300031691 Bacteria 685
47 Ga0316579_10622443 3300031691 Bacteria 522
48 Ga0265342_10004034 3300031712 Bacteria 11724
49 Ga0316576_10000928 3300031727 Bacteria 14960
50 Ga0316576_10012087 3300031727 Bacteria 5692
51 Ga0316576_10027753 3300031727 Bacteria 3982
52 Ga0316576_10047538 3300031727 Bacteria 3109
53 Ga0316576_10063355 3300031727 Bacteria 2714
54 Ga0316576_10085679 3300031727 Bacteria 2342
55 Ga0316576_10132310 3300031727 Unclassified 1876
56 Ga0316576_10153809 3300031727 Bacteria 1733
57 Ga0316576_10199765 3300031727 Bacteria 1506
58 Ga0316576_10251433 3300031727 Bacteria 1327
59 Ga0316576_10338564 3300031727 Bacteria 1121
60 Ga0316576_10513106 3300031727 Unclassified 881
61 Ga0316578_10001729 3300031728 Bacteria 9123
62 Ga0316578_10002757 3300031728 Bacteria 7824
63 Ga0316578_10002987 3300031728 Bacteria 7611
64 Ga0316578_10017075 3300031728 Bacteria 3943
65 Ga0316578_10079931 3300031728 Bacteria 1945
66 Ga0316578_10087812 3300031728 Bacteria 1855
67 Ga0316578_10261827 3300031728 Bacteria 1037
68 Ga0316578_10309242 3300031728 Unclassified 944
69 Ga0316578_10352675 3300031728 Bacteria 875
70 Ga0316578_10374243 3300031728 Unclassified 846
71 Ga0316578_10382094 3300031728 Bacteria 836
72 Ga0316578_10565333 3300031728 Unclassified 667
73 Ga0316578_10724768 3300031728 Unclassified 578
74 Ga0316577_10017216 3300031733 Bacteria 3989
75 Ga0316577_10084680 3300031733 Bacteria 1774
76 Ga0316577_10098448 3300031733 Bacteria 1638
77 Ga0316577_10162826 3300031733 Bacteria 1258
78 Ga0316577_10177574 3300031733 Bacteria 1202
79 Ga0316577_10211796 3300031733 Unclassified 1095
80 Ga0316577_10540269 3300031733 Unclassified 663
81 Ga0316577_10591182 3300031733 Bacteria 631
82 Ga0316577_10723951 3300031733 Bacteria 565
83 Ga0307409_102187292 3300031995 Bacteria 583
84 Ga0316583_10000942 3300032133 Bacteria 9358
85 Ga0316583_10003384 3300032133 Bacteria 5615
86 Ga0316583_10063756 3300032133 Bacteria 1290
87 Ga0316583_10067397 3300032133 Bacteria 1252
88 Ga0316583_10098487 3300032133 Bacteria 1019
89 Ga0316583_10102962 3300032133 Bacteria 995
90 Ga0316583_10266057 3300032133 Bacteria 593
91 Ga0316585_10010379 3300032137 Bacteria 2732
92 Ga0316585_10035244 3300032137 Bacteria 1584
93 Ga0316585_10075539 3300032137 Bacteria 1095
94 Ga0316585_10095029 3300032137 Unclassified 976
95 Ga0316580_10032346 3300032139 Bacteria 1619
96 Ga0316580_10055556 3300032139 Bacteria 1217
97 Ga0316580_10080414 3300032139 Unclassified 997
98 Ga0316580_10132151 3300032139 Unclassified 765
99 Ga0316580_10184897 3300032139 Unclassified 641
100 Ga0316580_10191410 3300032139 Bacteria 630
101 Ga0316593_10004285 3300032168 Bacteria 3648
102 Ga0316593_10012475 3300032168 Bacteria 2494
103 Ga0316593_10015606 3300032168 Bacteria 2289
104 Ga0316593_10016672 3300032168 Bacteria 2230
105 Ga0316593_10018972 3300032168 Bacteria 2120
106 Ga0316593_10022809 3300032168 Bacteria 1970
107 Ga0316593_10029703 3300032168 Bacteria 1770
108 Ga0316593_10036955 3300032168 Bacteria 1612
109 Ga0316593_10039103 3300032168 Bacteria 1573
110 Ga0316593_10045852 3300032168 Bacteria 1466
111 Ga0316593_10048493 3300032168 Bacteria 1430
112 Ga0316593_10049020 3300032168 Bacteria 1423
113 Ga0316593_10053663 3300032168 Bacteria 1366
114 Ga0316593_10075859 3300032168 Unclassified 1168
115 Ga0316593_10077061 3300032168 Bacteria 1159
116 Ga0316593_10078027 3300032168 Unclassified 1153
117 Ga0316593_10078860 3300032168 Unclassified 1147
118 Ga0316593_10101196 3300032168 Bacteria 1022
119 Ga0316593_10111913 3300032168 Unclassified 975
120 Ga0316593_10146008 3300032168 Bacteria 859
121 Ga0316593_10165897 3300032168 Unclassified 808
122 Ga0316593_10167930 3300032168 Unclassified 803
123 Ga0316593_10179657 3300032168 Bacteria 778
124 Ga0316593_10205172 3300032168 Unclassified 729
125 Ga0316593_10222336 3300032168 Unclassified 702
126 Ga0316593_10243931 3300032168 Bacteria 671
127 Ga0316593_10275206 3300032168 Unclassified 633
128 Ga0316593_10288108 3300032168 Unclassified 620
129 Ga0316593_10307230 3300032168 Unclassified 601
130 Ga0316592_1002340 3300033524 Bacteria 3262
131 Ga0316592_1004537 3300033524 Bacteria 2585
132 Ga0316592_1011054 3300033524 Bacteria 1828
133 Ga0316592_1011976 3300033524 Bacteria 1772
134 Ga0316592_1012059 3300033524 Bacteria 1766
135 Ga0316592_1015566 3300033524 Bacteria 1584
136 Ga0316592_1015715 3300033524 Bacteria 1578
137 Ga0316592_1015892 3300033524 Bacteria 1570
138 Ga0316592_1023612 3300033524 Unclassified 1321
139 Ga0316592_1023778 3300033524 Unclassified 1316
140 Ga0316592_1024632 3300033524 Bacteria 1295
141 Ga0316592_1036689 3300033524 Bacteria 1078
142 Ga0316592_1039480 3300033524 Bacteria 1043
143 Ga0316592_1053286 3300033524 Bacteria 905
144 Ga0316592_1054179 3300033524 Bacteria 897
145 Ga0316592_1059990 3300033524 Unclassified 854
146 Ga0316592_1074746 3300033524 Unclassified 768
147 Ga0316592_1079853 3300033524 Bacteria 743
148 Ga0316592_1080819 3300033524 Unclassified 739
149 Ga0316592_1082889 3300033524 Bacteria 730
150 Ga0316592_1083204 3300033524 Bacteria 729
151 Ga0316592_1086249 3300033524 Bacteria 716
152 Ga0316592_1091719 3300033524 Bacteria 695
153 Ga0316592_1106053 3300033524 Unclassified 648
154 Ga0316592_1117105 3300033524 Bacteria 618
155 Ga0316592_1123990 3300033524 Unclassified 601
156 Ga0316592_1129098 3300033524 Bacteria 589
157 Ga0316592_1144105 3300033524 Unclassified 560
158 Ga0316592_1144193 3300033524 Bacteria 560
159 Ga0316592_1147797 3300033524 Bacteria 554
160 Ga0316592_1161071 3300033524 Bacteria 532
161 Ga0316592_1172414 3300033524 Bacteria 515
162 Ga0316586_1004388 3300033527 Bacteria 1924
163 Ga0316586_1017831 3300033527 Bacteria 1148
164 Ga0316586_1045511 3300033527 Unclassified 778
165 Ga0316586_1063771 3300033527 Unclassified 672
166 Ga0316586_1070789 3300033527 Unclassified 642
167 Ga0316586_1104631 3300033527 Bacteria 543
168 Ga0316586_1105420 3300033527 Bacteria 541
169 Ga0316588_1003259 3300033528 Bacteria 2937
170 Ga0316588_1032393 3300033528 Bacteria 1229
171 Ga0316588_1079235 3300033528 Bacteria 812
172 Ga0316588_1106315 3300033528 Bacteria 705
173 Ga0316588_1166630 3300033528 Bacteria 569
174 Ga0316588_1183492 3300033528 Unclassified 544
175 Ga0316588_1194261 3300033528 Unclassified 529
176 Ga0316587_1027051 3300033529 Bacteria 1002
177 Ga0316596_1009010 3300033541 Bacteria 2390
178 Ga0316596_1011010 3300033541 Bacteria 2201
179 Ga0316596_1012274 3300033541 Bacteria 2106
180 Ga0316596_1021451 3300033541 Unclassified 1647
181 Ga0316596_1024460 3300033541 Unclassified 1551
182 Ga0316596_1027362 3300033541 Bacteria 1471
183 Ga0316596_1044961 3300033541 Bacteria 1164
184 Ga0316596_1045607 3300033541 Bacteria 1157
185 Ga0316596_1045653 3300033541 Unclassified 1156
186 Ga0316596_1068399 3300033541 Unclassified 950
187 Ga0316596_1087539 3300033541 Bacteria 839
188 Ga0316596_1144880 3300033541 Bacteria 651
189 Ga0316596_1170047 3300033541 Bacteria 601
190 Ga0316596_1174047 3300033541 Unclassified 594
191 Ga0316596_1178548 3300033541 Bacteria 587
192 Ga0316596_1226840 3300033541 Unclassified 523
193 Ga0373959_0147869 3300034820 Bacteria 592
194 Ga0316574_0001759 3300035398 Bacteria 10506
195 Ga0316574_0002228 3300035398 Bacteria 9646
196 Ga0316574_0048371 3300035398 Bacteria 2641
197 Ga0316574_0067361 3300035398 Bacteria 2257
198 Ga0316574_0093326 3300035398 Bacteria 1922
199 Ga0316574_0172949 3300035398 Unclassified 1390
200 Ga0316574_0381400 3300035398 Unclassified 889
201 Ga0316574_0391684 3300035398 Bacteria 875
202 Ga0316574_0492976 3300035398 Bacteria 764
203 Ga0316574_0631204 3300035398 Bacteria 660
204 Ga0316574_0671324 3300035398 Unclassified 637
205 Ga0373933_0323142 3300035724 Unclassified 1001
206 Ga0316582_0000273 3300036647 Bacteria 17633
207 Ga0316582_0010411 3300036647 Bacteria 5093
208 Ga0316582_0015787 3300036647 Bacteria 4329
209 Ga0316582_0032273 3300036647 Bacteria 3207
210 Ga0316582_0084995 3300036647 Unclassified 2073
211 Ga0316582_0114438 3300036647 Bacteria 1799
212 Ga0316582_0142153 3300036647 Bacteria 1618
213 Ga0316582_0172173 3300036647 Bacteria 1470
214 Ga0316582_0188368 3300036647 Bacteria 1405
215 Ga0316582_0314348 3300036647 Bacteria 1076
216 Ga0316582_0336717 3300036647 Unclassified 1038
217 Ga0316582_0540853 3300036647 Bacteria 802
218 Ga0316582_0745018 3300036647 Unclassified 672
219 Ga0316582_0839206 3300036647 Unclassified 629
220 Ga0316582_0844890 3300036647 Bacteria 627
221 Ga0316582_1244247 3300036647 Unclassified 506
222 Ga0316584_0002650 3300036712 Bacteria 11417
223 Ga0316584_0004105 3300036712 Bacteria 9600
224 Ga0316584_0010519 3300036712 Bacteria 6471
225 Ga0316584_0092609 3300036712 Unclassified 2262
226 Ga0316584_0225602 3300036712 Bacteria 1375
227 Ga0316584_0247817 3300036712 Bacteria 1302
228 Ga0316584_0255355 3300036712 Bacteria 1279
229 Ga0316584_0259862 3300036712 Bacteria 1266
230 Ga0316584_0298490 3300036712 Bacteria 1167
231 Ga0316584_0345444 3300036712 Unclassified 1069
232 Ga0316584_0537067 3300036712 Unclassified 818
233 Ga0316584_0611124 3300036712 Bacteria 755
234 Ga0316584_0626605 3300036712 Bacteria 743
235 Ga0316584_0687873 3300036712 Bacteria 702
236 Ga0316584_0860911 3300036712 Unclassified 612
237 Ga0316584_0910684 3300036712 Unclassified 592
238 Ga0400484_30899 3300038725 Bacteria 2824
239 Ga0400490_02345 3300038726 Bacteria 3714
240 Ga0400490_47746 3300038726 Unclassified 1954
241 Ga0400491_02588 3300038727 Unclassified 1013
242 Ga0400485_00645 3300038735 Bacteria 13130
243 Ga0400486_20664 3300038742 Bacteria 12634
244 Ga0400483_015326 3300039062 Bacteria 10769
245 Ga0400483_128456 3300039062 Bacteria 1790
246 Ga0400483_184961 3300039062 Unclassified 2686
247 Ga0400483_284911 3300039062 Bacteria 1551
248 Ga0400489_13486 3300039093 Bacteria 11587
249 Ga0400489_39506 3300039093 Bacteria 8258
250 Ga0400489_92380 3300039093 Unclassified 1224
251 Ga0400487_39880 3300039110 Bacteria 12901
252 Ga0450910_011009 3300042147 Bacteria 1294
253 Ga0439435_0010981 3300042436 Bacteria 2164
254 Ga0451577_0026897 3300042876 Bacteria 5208
255 Ga0451577_0171846 3300042876 Bacteria 1953
256 Ga0451577_0782051 3300042876 Bacteria 862
257 Ga0453683_0045268 3300044673 Bacteria 2759
258 Ga0453683_0057908 3300044673 Bacteria 2423
259 Ga0453684_0002399 3300044712 Bacteria 45652
260 Ga0453684_0008129 3300044712 Bacteria 18941
261 Ga0453684_0027337 3300044712 Bacteria 8186
262 Ga0453684_0108549 3300044712 Unclassified 3377
263 Ga0453684_0148683 3300044712 Bacteria 2787
264 Ga0453684_0480172 3300044712 Bacteria 1379
265 Ga0453684_0965785 3300044712 Bacteria 908
266 Ga0453684_1515864 3300044712 Bacteria 691
267 Ga0451576_0000367 3300045051 Bacteria 107742
268 Ga0451576_0067740 3300045051 Bacteria 3716
269 Ga0451576_0071187 3300045051 Bacteria 3619
270 Ga0451576_0208009 3300045051 Bacteria 2043
271 Ga0496102_0973422 3300048905 Bacteria 769
272 Ga0496106_0077675 3300048909 Bacteria 2546
273 Ga0496107_0167919 3300048910 Bacteria 1627
274 Ga0496109_1771285 3300048912 Bacteria 551
275 Ga0501031_0454043 3300049568 Bacteria 828
276 Ga0501032_0716480 3300049569 Unclassified 634
277 Ga0501037_0842343 3300049573 Bacteria 604
278 Ga0501038_0131056 3300049574 Bacteria 2059
279 Ga0501039_0370044 3300049575 Unclassified 1126
280 Ga0501039_0728624 3300049575 Bacteria 775
281 Ga0501040_0099144 3300049576 Bacteria 2031
282 Ga0501040_0269063 3300049576 Bacteria 1217
283 Ga0501040_0436755 3300049576 Unclassified 942
284 Ga0501041_0105098 3300049577 Unclassified 1750
285 Ga0501042_0270521 3300049578 Bacteria 1227
286 Ga0501042_0405468 3300049578 Bacteria 988
287 Ga0501046_0165457 3300049580 Unclassified 1662
288 Ga0501046_0529422 3300049580 Bacteria 842
289 Ga0501048_0247931 3300049582 Bacteria 1264
290 Ga0501048_0465231 3300049582 Unclassified 906
291 Ga0501067_0428347 3300049583 Bacteria 738
292 Ga0501068_0216545 3300049584 Unclassified 1217
293 Ga0501070_1441890 3300049586 Bacteria 522
294 Ga0501071_0018211 3300049587 Bacteria 4859
295 Ga0501071_0131714 3300049587 Bacteria 1858
296 Ga0501071_0134703 3300049587 Bacteria 1837
297 Ga0501071_0277364 3300049587 Unclassified 1268
298 Ga0501071_0468902 3300049587 Bacteria 964
299 Ga0501072_0074297 3300049588 Bacteria 2688
300 Ga0501072_0279686 3300049588 Bacteria 1327
301 Ga0501074_0116907 3300049590 Unclassified 1908
302 Ga0501075_0505988 3300049591 Bacteria 922
303 Ga0501076_0100029 3300049592 Unclassified 2336
304 Ga0501076_0117930 3300049592 Unclassified 2148
305 Ga0501076_0392712 3300049592 Bacteria 1141
306 Ga0501076_0596453 3300049592 Bacteria 911
307 Ga0501079_0284024 3300049741 Unclassified 1294
308 Ga0501079_0944336 3300049741 Bacteria 679
309 Ga0501080_0320503 3300049742 Unclassified 1403
310 Ga0501080_0526871 3300049742 Unclassified 1054
311 Ga0501081_0124675 3300049743 Unclassified 1837
312 Ga0501081_0139699 3300049743 Bacteria 1736
313 Ga0501081_0556176 3300049743 Unclassified 857
314 Ga0501081_0567947 3300049743 Bacteria 848
315 Ga0501083_0479443 3300049744 Unclassified 810
316 Ga0501035_0670916 3300049822 Bacteria 839
317 Ga0501045_0146495 3300049824 Bacteria 1757
318 Ga0501045_1063047 3300049824 Unclassified 593
319 Ga0501045_1158255 3300049824 Bacteria 565
320 Ga0501084_0739848 3300054114 Bacteria 829
321 Ga0501084_1211766 3300054114 Bacteria 633
322 Ga0501084_1281863 3300054114 Bacteria 614
323 Ga0590071_001997 3300059421 Bacteria 5218
324 Ga0590074_017681 3300059423 Unclassified 1219
325 Ga0590075_025487 3300059424 Unclassified 1486
326 Ga0501082_1127316 3300060353 Unclassified 686
327 Ga0501082_1185850 3300060353 Unclassified 667
328 Ga0530510_0027651 3300061734 Unclassified 4064
329 Ga0530510_0060762 3300061734 Archaea 2735
330 Ga0530510_0127434 3300061734 Bacteria 1872
331 Ga0530510_0216595 3300061734 Bacteria 1423
332 Ga0070708_100795574
333 Ga0070683_100308656
334 Ga0068869_100994652
335 Ga0068869_101567545
336 Ga0070687_100710821
337 Ga0070671_101774680
338 Ga0070673_100190780
339 Ga0070714_100274062
340 Ga0070694_100545666
341 Ga0070708_100014992
342 Ga0070706_100212993
343 Ga0070707_102150604
344 Ga0070684_100477814
345 Ga0070704_100623269
346 Ga0068859_103119881
347 Ga0070717_10000078
348 Ga0097620_103119820
349 Ga0105245_10215866
350 Ga0105243_10136985
351 Ga0157378_10082199
352 Ga0207645_10440900
353 Ga0207684_10211360
354 Ga0207662_10386817
355 Ga0207687_10843360
356 Ga0207689_10258350
357 Ga0207661_10162152
358 Ga0207651_10458490
359 Ga0207678_10476286
360 Ga0265323_10041670
361 Ga0265322_10002158
362 Ga0265330_10009520
363 Ga0265329_10003663
364 Ga0265339_10601636
365 Ga0265316_10049866
366 Ga0316575_10002000
367 Ga0316575_10036621
368 Ga0316575_10132142
369 Ga0316575_10315570
370 Ga0316575_10360467
371 Ga0316575_10539779
372 Ga0316579_10022905
373 Ga0316579_10061451
374 Ga0316579_10064649
375 Ga0316579_10112591
376 Ga0316579_10336589
377 Ga0316579_10377409
378 Ga0316579_10622443
379 Ga0265342_10004034
380 Ga0316576_10000928
381 Ga0316576_10012087
382 Ga0316576_10027753
383 Ga0316576_10047538
384 Ga0316576_10063355
385 Ga0316576_10085679
386 Ga0316576_10132310
387 Ga0316576_10153809
388 Ga0316576_10199765
389 Ga0316576_10251433
390 Ga0316576_10338564
391 Ga0316576_10513106
392 Ga0316578_10001729
393 Ga0316578_10002757
394 Ga0316578_10002987
395 Ga0316578_10017075
396 Ga0316578_10079931
397 Ga0316578_10087812
398 Ga0316578_10261827
399 Ga0316578_10309242
400 Ga0316578_10352675
401 Ga0316578_10374243
402 Ga0316578_10382094
403 Ga0316578_10565333
404 Ga0316578_10724768
405 Ga0316577_10017216
406 Ga0316577_10084680
407 Ga0316577_10098448
408 Ga0316577_10162826
409 Ga0316577_10177574
410 Ga0316577_10211796
411 Ga0316577_10540269
412 Ga0316577_10591182
413 Ga0316577_10723951
414 Ga0307409_102187292
415 Ga0316583_10000942
416 Ga0316583_10003384
417 Ga0316583_10063756
418 Ga0316583_10067397
419 Ga0316583_10098487
420 Ga0316583_10102962
421 Ga0316583_10266057
422 Ga0316585_10010379
423 Ga0316585_10035244
424 Ga0316585_10075539
425 Ga0316585_10095029
426 Ga0316580_10032346
427 Ga0316580_10055556
428 Ga0316580_10080414
429 Ga0316580_10132151
430 Ga0316580_10184897
431 Ga0316580_10191410
432 Ga0316593_10004285
433 Ga0316593_10012475
434 Ga0316593_10015606
435 Ga0316593_10016672
436 Ga0316593_10018972
437 Ga0316593_10022809
438 Ga0316593_10029703
439 Ga0316593_10036955
440 Ga0316593_10039103
441 Ga0316593_10045852
442 Ga0316593_10048493
443 Ga0316593_10049020
444 Ga0316593_10053663
445 Ga0316593_10075859
446 Ga0316593_10077061
447 Ga0316593_10078027
448 Ga0316593_10078860
449 Ga0316593_10101196
450 Ga0316593_10111913
451 Ga0316593_10146008
452 Ga0316593_10165897
453 Ga0316593_10167930
454 Ga0316593_10179657
455 Ga0316593_10205172
456 Ga0316593_10222336
457 Ga0316593_10243931
458 Ga0316593_10275206
459 Ga0316593_10288108
460 Ga0316593_10307230
461 Ga0316592_1002340
462 Ga0316592_1004537
463 Ga0316592_1011054
464 Ga0316592_1011976
465 Ga0316592_1012059
466 Ga0316592_1015566
467 Ga0316592_1015715
468 Ga0316592_1015892
469 Ga0316592_1023612
470 Ga0316592_1023778
471 Ga0316592_1024632
472 Ga0316592_1036689
473 Ga0316592_1039480
474 Ga0316592_1053286
475 Ga0316592_1054179
476 Ga0316592_1059990
477 Ga0316592_1074746
478 Ga0316592_1079853
479 Ga0316592_1080819
480 Ga0316592_1082889
481 Ga0316592_1083204
482 Ga0316592_1086249
483 Ga0316592_1091719
484 Ga0316592_1106053
485 Ga0316592_1117105
486 Ga0316592_1123990
487 Ga0316592_1129098
488 Ga0316592_1144105
489 Ga0316592_1144193
490 Ga0316592_1147797
491 Ga0316592_1161071
492 Ga0316592_1172414
493 Ga0316586_1004388
494 Ga0316586_1017831
495 Ga0316586_1045511
496 Ga0316586_1063771
497 Ga0316586_1070789
498 Ga0316586_1104631
499 Ga0316586_1105420
500 Ga0316588_1003259
501 Ga0316588_1032393
502 Ga0316588_1079235
503 Ga0316588_1106315
504 Ga0316588_1166630
505 Ga0316588_1183492
506 Ga0316588_1194261
507 Ga0316587_1027051
508 Ga0316596_1009010
509 Ga0316596_1011010
510 Ga0316596_1012274
511 Ga0316596_1021451
512 Ga0316596_1024460
513 Ga0316596_1027362
514 Ga0316596_1044961
515 Ga0316596_1045607
516 Ga0316596_1045653
517 Ga0316596_1068399
518 Ga0316596_1087539
519 Ga0316596_1144880
520 Ga0316596_1170047
521 Ga0316596_1174047
522 Ga0316596_1178548
523 Ga0316596_1226840
524 Ga0373959_0147869
525 Ga0316574_0001759
526 Ga0316574_0002228
527 Ga0316574_0048371
528 Ga0316574_0067361
529 Ga0316574_0093326
530 Ga0316574_0172949
531 Ga0316574_0381400
532 Ga0316574_0391684
533 Ga0316574_0492976
534 Ga0316574_0631204
535 Ga0316574_0671324
536 Ga0373933_0323142
537 Ga0316582_0000273
538 Ga0316582_0010411
539 Ga0316582_0015787
540 Ga0316582_0032273
541 Ga0316582_0084995
542 Ga0316582_0114438
543 Ga0316582_0142153
544 Ga0316582_0172173
545 Ga0316582_0188368
546 Ga0316582_0314348
547 Ga0316582_0336717
548 Ga0316582_0540853
549 Ga0316582_0745018
550 Ga0316582_0839206
551 Ga0316582_0844890
552 Ga0316582_1244247
553 Ga0316584_0002650
554 Ga0316584_0004105
555 Ga0316584_0010519
556 Ga0316584_0092609
557 Ga0316584_0225602
558 Ga0316584_0247817
559 Ga0316584_0255355
560 Ga0316584_0259862
561 Ga0316584_0298490
562 Ga0316584_0345444
563 Ga0316584_0537067
564 Ga0316584_0611124
565 Ga0316584_0626605
566 Ga0316584_0687873
567 Ga0316584_0860911
568 Ga0316584_0910684
569 Ga0400484_30899
570 Ga0400490_02345
571 Ga0400490_47746
572 Ga0400491_02588
573 Ga0400485_00645
574 Ga0400486_20664
575 Ga0400483_015326
576 Ga0400483_128456
577 Ga0400483_184961
578 Ga0400483_284911
579 Ga0400489_13486
580 Ga0400489_39506
581 Ga0400489_92380
582 Ga0400487_39880
583 Ga0450910_011009
584 Ga0439435_0010981
585 Ga0451577_0026897
586 Ga0451577_0171846
587 Ga0451577_0782051
588 Ga0453683_0045268
589 Ga0453683_0057908
590 Ga0453684_0002399
591 Ga0453684_0008129
592 Ga0453684_0027337
593 Ga0453684_0108549
594 Ga0453684_0148683
595 Ga0453684_0480172
596 Ga0453684_0965785
597 Ga0453684_1515864
598 Ga0451576_0000367
599 Ga0451576_0067740
600 Ga0451576_0071187
601 Ga0451576_0208009
602 Ga0496102_0973422
603 Ga0496106_0077675
604 Ga0496107_0167919
605 Ga0496109_1771285
606 Ga0501031_0454043
607 Ga0501032_0716480
608 Ga0501037_0842343
609 Ga0501038_0131056
610 Ga0501039_0370044
611 Ga0501039_0728624
612 Ga0501040_0099144
613 Ga0501040_0269063
614 Ga0501040_0436755
615 Ga0501041_0105098
616 Ga0501042_0270521
617 Ga0501042_0405468
618 Ga0501046_0165457
619 Ga0501046_0529422
620 Ga0501048_0247931
621 Ga0501048_0465231
622 Ga0501067_0428347
623 Ga0501068_0216545
624 Ga0501070_1441890
625 Ga0501071_0018211
626 Ga0501071_0131714
627 Ga0501071_0134703
628 Ga0501071_0277364
629 Ga0501071_0468902
630 Ga0501072_0074297
631 Ga0501072_0279686
632 Ga0501074_0116907
633 Ga0501075_0505988
634 Ga0501076_0100029
635 Ga0501076_0117930
636 Ga0501076_0392712
637 Ga0501076_0596453
638 Ga0501079_0284024
639 Ga0501079_0944336
640 Ga0501080_0320503
641 Ga0501080_0526871
642 Ga0501081_0124675
643 Ga0501081_0139699
644 Ga0501081_0556176
645 Ga0501081_0567947
646 Ga0501083_0479443
647 Ga0501035_0670916
648 Ga0501045_0146495
649 Ga0501045_1063047
650 Ga0501045_1158255
651 Ga0501084_0739848
652 Ga0501084_1211766
653 Ga0501084_1281863
654 Ga0590071_001997
655 Ga0590074_017681
656 Ga0590075_025487
657 Ga0501082_1127316
658 Ga0501082_1185850
659 Ga0530510_0027651
660 Ga0530510_0060762
661 Ga0530510_0127434
662 Ga0530510_0216595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01206

TusA

Sulfurtransferase TusA

7

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.9373 5 77
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8909 5 77
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8897 8 76
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8754 1 77
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8552 1 77
ID Description Score Start End Superfamily
af_Q2G1R7_113_189_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9711 8 78 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9381 9 77 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9219 6 77 3.30.110.40
af_Q58170_72_142_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9171 8 76 3.30.110.40
2z7sA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9016 59 76 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1Y0EN83-F1-model_v4 UPF0033 domain-containing protein 1.001 5 78
AF-A0A846PD63-F1-model_v4 UPF0033 domain-containing protein 1 5 78
AF-A0A2V7Z1K4-F1-model_v4 Preprotein translocase subunit TatB 0.9999 6 78
AF-A0A7T9EKF4-F1-model_v4 deleted 0.9995 5 78
AF-A0A162LHQ3-F1-model_v4 UPF0033 domain-containing protein 0.9987 9 77

Map