F410376

General Info

Members Datasets Scaffolds Average Seq Length
331 170 662 249

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100111808|Ga0070670_1001118082
Length 286
Sequence LSCQETHELIHGYVDGELDLPKSIAIEEHLRNCHECTQTYKGIRSLRSAISDEALRFEAPENFADRLRSALRSESKSDLKSGFLRWRWILAGASLVGAVIAIWAIAPIFTRPSAGDVLAQEIVSSHVRSLMADHLTDVPSSDQHTVKPWFDGKLDFSPPVRDLSKQGFSLNGGRLDYIGNRPVAALIYQRRQHSINLFVWPSTGAGDVNEKVSVRQGYNLIRWTNGGMNYWVVSDLNLAELQQFVQLLKEQIQGRASLSSQIPGLSLSFVPLSTIEKTRDSETHKI

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
160 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
161 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 22.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100111808 3300005331 Bacteria 2354
2 Ga0065714_10064422 3300005288 Bacteria 270668
3 Ga0065712_10004337 3300005290 Bacteria 3557
4 Ga0065712_10067728 3300005290 Bacteria 178215
5 Ga0065712_10080012 3300005290 Bacteria 3154
6 Ga0065715_10090652 3300005293 Bacteria 6674
7 Ga0065715_10097582 3300005293 Bacteria 3669
8 Ga0065715_10102595 3300005293 Unclassified 3100
9 Ga0065707_10322058 3300005295 Unclassified 964
10 Ga0070676_10047185 3300005328 Unclassified 2515
11 Ga0070690_100008574 3300005330 Bacteria 5893
12 Ga0070677_10067582 3300005333 Unclassified 1493
13 Ga0068869_100067295 3300005334 Bacteria 2642
14 Ga0070680_100056285 3300005336 Bacteria 3215
15 Ga0068868_100004601 3300005338 Bacteria 9680
16 Ga0068868_100019103 3300005338 Bacteria 5132
17 Ga0068868_100056179 3300005338 Bacteria 3108
18 Ga0068868_100327685 3300005338 Unclassified 1306
19 Ga0070689_100020880 3300005340 Bacteria 4867
20 Ga0070689_100114521 3300005340 Bacteria 2148
21 Ga0070689_100352487 3300005340 Bacteria 1235
22 Ga0070691_10231894 3300005341 Unclassified 983
23 Ga0070661_100327991 3300005344 Bacteria 1197
24 Ga0070675_100029269 3300005354 Unclassified 4441
25 Ga0070675_100086175 3300005354 Unclassified 2625
26 Ga0070675_100344029 3300005354 Unclassified 1321
27 Ga0070671_100003038 3300005355 Bacteria 13059
28 Ga0070671_100103763 3300005355 Bacteria 2386
29 Ga0070671_100115723 3300005355 Unclassified 2254
30 Ga0070673_100016273 3300005364 Bacteria 5253
31 Ga0070673_100231041 3300005364 Bacteria 1604
32 Ga0070688_100011428 3300005365 Plasmid 4932
33 Ga0070667_100065516 3300005367 Bacteria 3085
34 Ga0070667_100081919 3300005367 Bacteria 2762
35 Ga0070667_100090616 3300005367 Unclassified 2628
36 Ga0070701_10018801 3300005438 Bacteria 3253
37 Ga0070701_10154877 3300005438 Unclassified 1323
38 Ga0070711_100456492 3300005439 Bacteria 1047
39 Ga0070705_100030586 3300005440 Bacteria 2974
40 Ga0070705_100118196 3300005440 Bacteria 1707
41 Ga0070705_100148471 3300005440 Unclassified 1552
42 Ga0070700_100000450 3300005441 Bacteria 20729
43 Ga0070700_100023028 3300005441 Bacteria 3641
44 Ga0070700_100095287 3300005441 Bacteria 1951
45 Ga0070694_100001991 3300005444 Bacteria 12139
46 Ga0070694_100010522 3300005444 Bacteria 5711
47 Ga0070694_100103067 3300005444 Unclassified 2021
48 Ga0070694_100155246 3300005444 Bacteria 1675
49 Ga0070694_100276353 3300005444 Bacteria 1279
50 Ga0070678_100073603 3300005456 Plasmid 2565
51 Ga0070662_100586792 3300005457 Unclassified 936
52 Ga0070681_10027008 3300005458 Bacteria 5772
53 Ga0068867_100073239 3300005459 Bacteria 2565
54 Ga0068867_100090788 3300005459 Bacteria 2318
55 Ga0070685_10024458 3300005466 Bacteria 3318
56 Ga0070706_100006857 3300005467 Bacteria 10754
57 Ga0070707_100016235 3300005468 Bacteria 6989
58 Ga0070707_100105958 3300005468 Unclassified 2726
59 Ga0070698_100416260 3300005471 Bacteria 1278
60 Ga0070699_100585113 3300005518 Unclassified 1017
61 Ga0070697_100002241 3300005536 Bacteria 14841
62 Ga0070697_100266331 3300005536 Bacteria 1468
63 Ga0070686_100327771 3300005544 Bacteria 1144
64 Ga0070695_100001043 3300005545 Bacteria 15140
65 Ga0070695_100028230 3300005545 Bacteria 3481
66 Ga0070695_100097548 3300005545 Unclassified 1974
67 Ga0070695_100108817 3300005545 Unclassified 1877
68 Ga0070695_100260970 3300005545 Bacteria 1265
69 Ga0070695_100373992 3300005545 Unclassified 1073
70 Ga0070695_100393280 3300005545 Bacteria 1049
71 Ga0070696_100052483 3300005546 Bacteria 2836
72 Ga0070696_100084777 3300005546 Bacteria 2248
73 Ga0070696_100169954 3300005546 Unclassified 1611
74 Ga0070693_100046903 3300005547 Bacteria 2456
75 Ga0070665_100037500 3300005548 Bacteria 4875
76 Ga0070665_100039599 3300005548 Bacteria 4738
77 Ga0070704_100007391 3300005549 Bacteria 6538
78 Ga0070704_100027053 3300005549 Bacteria 3798
79 Ga0070704_100121040 3300005549 Unclassified 2010
80 Ga0070704_100155956 3300005549 Bacteria 1801
81 Ga0070704_100287203 3300005549 Bacteria 1365
82 Ga0068857_100163298 3300005577 Bacteria 2022
83 Ga0068854_100301357 3300005578 Bacteria 1297
84 Ga0068854_100356182 3300005578 Unclassified 1199
85 Ga0070702_100004388 3300005615 Bacteria 6435
86 Ga0068859_100003945 3300005617 Bacteria 15149
87 Ga0068859_100032686 3300005617 Bacteria 5226
88 Ga0068859_100092866 3300005617 Bacteria 3069
89 Ga0068859_100106662 3300005617 Bacteria 2861
90 Ga0068859_100216421 3300005617 Bacteria 2003
91 Ga0068864_100013266 3300005618 Bacteria 6826
92 Ga0068864_100056536 3300005618 Bacteria 3390
93 Ga0068864_100111507 3300005618 Unclassified 2437
94 Ga0068864_100115936 3300005618 Bacteria 2390
95 Ga0068864_100300808 3300005618 Bacteria 1502
96 Ga0068866_10393552 3300005718 Bacteria 892
97 Ga0068861_100015851 3300005719 Bacteria 5321
98 Ga0068851_10035719 3300005834 Bacteria 2486
99 Ga0068870_10035528 3300005840 Bacteria 2558
100 Ga0068863_100009745 3300005841 Bacteria 9370
101 Ga0068863_100066083 3300005841 Bacteria 3421
102 Ga0068863_100109732 3300005841 Bacteria 2627
103 Ga0068858_100145154 3300005842 Bacteria 2228
104 Ga0068860_100023283 3300005843 Bacteria 5986
105 Ga0068860_100061119 3300005843 Bacteria 3579
106 Ga0068860_100097416 3300005843 Bacteria 2804
107 Ga0068860_100194096 3300005843 Bacteria 1966
108 Ga0068862_100035930 3300005844 Unclassified 4198
109 Ga0081455_10113600 3300005937 Bacteria 2148
110 Ga0070716_100012255 3300006173 Bacteria 4342
111 Ga0097621_100004108 3300006237 Bacteria 10095
112 Ga0097621_100061738 3300006237 Bacteria 3074
113 Ga0097621_100125159 3300006237 Bacteria 2183
114 Ga0068871_100005910 3300006358 Bacteria 8609
115 Ga0068871_100014455 3300006358 Bacteria 5889
116 Ga0075428_100093188 3300006844 Bacteria 3284
117 Ga0075430_100070125 3300006846 Bacteria 2940
118 Ga0075431_100012973 3300006847 Bacteria 8414
119 Ga0075433_10062903 3300006852 Bacteria 3251
120 Ga0075433_10071824 3300006852 Bacteria 3042
121 Ga0075433_10098387 3300006852 Bacteria 2590
122 Ga0075434_100046518 3300006871 Bacteria 4305
123 Ga0075434_100230379 3300006871 Bacteria 1872
124 Ga0068865_100073658 3300006881 Bacteria 2429
125 Ga0075436_100048759 3300006914 Unclassified 2922
126 Ga0075436_100135819 3300006914 Bacteria 1727
127 Ga0097620_100003945 3300006931 Bacteria 15149
128 Ga0097620_100032684 3300006931 Bacteria 5226
129 Ga0097620_100092868 3300006931 Bacteria 3069
130 Ga0097620_100106665 3300006931 Bacteria 2861
131 Ga0097620_100216418 3300006931 Bacteria 2003
132 Ga0075435_100035057 3300007076 Bacteria 3981
133 Ga0105240_10009659 3300009093 Bacteria 13640
134 Ga0105240_10111393 3300009093 Bacteria 3311
135 Ga0111539_10350939 3300009094 Bacteria 1717
136 Ga0111539_10522304 3300009094 Unclassified 1383
137 Ga0105245_10023332 3300009098 Bacteria 5430
138 Ga0105245_10026977 3300009098 Bacteria 5058
139 Ga0105247_10037253 3300009101 Bacteria 2968
140 Ga0114129_10006099 3300009147 Bacteria 17093
141 Ga0114129_10023678 3300009147 Bacteria 8704
142 Ga0114129_10030053 3300009147 Bacteria 7692
143 Ga0114129_10138547 3300009147 Bacteria 3338
144 Ga0114129_10228487 3300009147 Bacteria 2507
145 Ga0114129_10264725 3300009147 Bacteria 2302
146 Ga0114129_10333470 3300009147 Bacteria 2013
147 Ga0114129_10823281 3300009147 Bacteria 1182
148 Ga0105243_10021369 3300009148 Unclassified 4911
149 Ga0105243_10062240 3300009148 Unclassified 2987
150 Ga0105243_10108784 3300009148 Bacteria 2314
151 Ga0105243_10366928 3300009148 Bacteria 1327
152 Ga0105243_10559778 3300009148 Bacteria 1094
153 Ga0105241_10044937 3300009174 Bacteria 3349
154 Ga0105241_10147426 3300009174 Bacteria 1922
155 Ga0105241_10407513 3300009174 Bacteria 1194
156 Ga0105242_10002662 3300009176 Bacteria 13995
157 Ga0105242_10006632 3300009176 Bacteria 8927
158 Ga0105242_10100458 3300009176 Bacteria 2450
159 Ga0105248_10003678 3300009177 Bacteria 16987
160 Ga0105248_10014664 3300009177 Bacteria 8625
161 Ga0105248_10019142 3300009177 Bacteria 7573
162 Ga0105248_10076076 3300009177 Bacteria 3773
163 Ga0105248_10187694 3300009177 Bacteria 2329
164 Ga0105248_10556586 3300009177 Bacteria 1294
165 Ga0105248_10807226 3300009177 Bacteria 1059
166 Ga0105249_10023790 3300009553 Bacteria 5502
167 Ga0105249_10315171 3300009553 Unclassified 1574
168 Ga0105239_10130015 3300010375 Bacteria 2800
169 Ga0157373_10295500 3300013100 Bacteria 1149
170 Ga0157371_10196658 3300013102 Bacteria 1444
171 Ga0157374_10078796 3300013296 Bacteria 3121
172 Ga0157378_10001325 3300013297 Bacteria 22248
173 Ga0157378_10024876 3300013297 Bacteria 5273
174 Ga0157378_10047527 3300013297 Bacteria 3816
175 Ga0157378_10191780 3300013297 Bacteria 1928
176 Ga0157378_10261731 3300013297 Unclassified 1660
177 Ga0163162_10013112 3300013306 Bacteria 8092
178 Ga0163162_10024517 3300013306 Bacteria 5955
179 Ga0163162_10075247 3300013306 Bacteria 3437
180 Ga0163162_10079312 3300013306 Unclassified 3349
181 Ga0163162_10563350 3300013306 Bacteria 1267
182 Ga0157375_10096312 3300013308 Bacteria 3032
183 Ga0157375_10096451 3300013308 Bacteria 3030
184 Ga0163163_10028827 3300014325 Bacteria 5335
185 Ga0163163_10087749 3300014325 Unclassified 3121
186 Ga0163163_10255805 3300014325 Bacteria 1802
187 Ga0163163_10386395 3300014325 Bacteria 1457
188 Ga0157380_10033027 3300014326 Unclassified 3983
189 Ga0157380_10036426 3300014326 Bacteria 3806
190 Ga0157377_10042583 3300014745 Bacteria 2522
191 Ga0157377_10096967 3300014745 Unclassified 1750
192 Ga0157376_10037334 3300014969 Bacteria 3942
193 Ga0157376_10084256 3300014969 Bacteria 2737
194 Ga0157376_10121843 3300014969 Unclassified 2313
195 Ga0163161_10007004 3300017792 Bacteria 7797
196 Ga0213873_10046675 3300021358 Bacteria 1134
197 Ga0213876_10001634 3300021384 Bacteria 13678
198 Ga0207697_10024424 3300025315 Bacteria 2474
199 Ga0207656_10047067 3300025321 Unclassified 1853
200 Ga0207682_10157248 3300025893 Unclassified 1028
201 Ga0207642_10021449 3300025899 Unclassified 2544
202 Ga0207642_10090503 3300025899 Bacteria 1510
203 Ga0207680_10292133 3300025903 Unclassified 1134
204 Ga0207645_10049067 3300025907 Bacteria 2696
205 Ga0207645_10056362 3300025907 Unclassified 2509
206 Ga0207643_10010229 3300025908 Bacteria 5046
207 Ga0207643_10021023 3300025908 Bacteria 3583
208 Ga0207684_10014728 3300025910 Bacteria 6735
209 Ga0207684_10064939 3300025910 Unclassified 3099
210 Ga0207684_10430886 3300025910 Bacteria 1133
211 Ga0207654_10006200 3300025911 Bacteria 6009
212 Ga0207707_10069838 3300025912 Bacteria 3061
213 Ga0207695_10394869 3300025913 Unclassified 1268
214 Ga0207660_10025345 3300025917 Bacteria 4024
215 Ga0207660_10164149 3300025917 Unclassified 1716
216 Ga0207662_10029296 3300025918 Unclassified 3189
217 Ga0207649_10488232 3300025920 Unclassified 935
218 Ga0207646_10054598 3300025922 Bacteria 3573
219 Ga0207646_10062464 3300025922 Unclassified 3325
220 Ga0207681_10075979 3300025923 Bacteria 2358
221 Ga0207650_10222215 3300025925 Bacteria 1520
222 Ga0207659_10069610 3300025926 Bacteria 2563
223 Ga0207659_10155982 3300025926 Unclassified 1787
224 Ga0207644_10004532 3300025931 Bacteria 9027
225 Ga0207644_10027435 3300025931 Bacteria 3933
226 Ga0207706_10517524 3300025933 Bacteria 1029
227 Ga0207686_10012888 3300025934 Unclassified 4609
228 Ga0207686_10086155 3300025934 Bacteria 2062
229 Ga0207709_10075374 3300025935 Bacteria 2156
230 Ga0207709_10133937 3300025935 Bacteria 1693
231 Ga0207670_10000827 3300025936 Bacteria 16206
232 Ga0207704_10009670 3300025938 Bacteria 4665
233 Ga0207665_10022173 3300025939 Bacteria 4175
234 Ga0207691_10006555 3300025940 Viruses 11240
235 Ga0207691_10359320 3300025940 Unclassified 1245
236 Ga0207711_10002337 3300025941 Bacteria 16990
237 Ga0207711_10051876 3300025941 Bacteria 3514
238 Ga0207711_10063833 3300025941 Unclassified 3180
239 Ga0207689_10028139 3300025942 Unclassified 4701
240 Ga0207689_10055854 3300025942 Bacteria 3249
241 Ga0207689_10290467 3300025942 Bacteria 1354
242 Ga0207679_10119518 3300025945 Bacteria 2095
243 Ga0207679_10331112 3300025945 Unclassified 1321
244 Ga0207651_10115106 3300025960 Unclassified 2027
245 Ga0207651_10468728 3300025960 Bacteria 1083
246 Ga0207640_10037751 3300025981 Bacteria 3042
247 Ga0207640_10336875 3300025981 Unclassified 1207
248 Ga0207658_10048548 3300025986 Bacteria 3113
249 Ga0207658_10132909 3300025986 Unclassified 2002
250 Ga0207677_10018383 3300026023 Bacteria 4194
251 Ga0207677_10098977 3300026023 Unclassified 2140
252 Ga0207703_10624910 3300026035 Unclassified 1020
253 Ga0207708_10000080 3300026075 Bacteria 74889
254 Ga0207708_10072757 3300026075 Bacteria 2634
255 Ga0207708_10159164 3300026075 Bacteria 1783
256 Ga0207648_10054245 3300026089 Bacteria 3502
257 Ga0207648_10116870 3300026089 Bacteria 2344
258 Ga0207648_10377657 3300026089 Unclassified 1281
259 Ga0207676_10001383 3300026095 Bacteria 18053
260 Ga0207676_10101141 3300026095 Bacteria 2389
261 Ga0207676_10122625 3300026095 Bacteria 2195
262 Ga0207676_10253417 3300026095 Bacteria 1585
263 Ga0207676_10373134 3300026095 Bacteria 1326
264 Ga0207674_10107328 3300026116 Bacteria 2769
265 Ga0207674_10172082 3300026116 Bacteria 2119
266 Ga0207674_10307115 3300026116 Unclassified 1535
267 Ga0207675_100019930 3300026118 Bacteria 6260
268 Ga0207675_100061101 3300026118 Bacteria 3517
269 Ga0207675_100460489 3300026118 Unclassified 1261
270 Ga0207683_10079553 3300026121 Bacteria 2906
271 Ga0207428_10102840 3300027907 Bacteria 2206
272 Ga0268266_10022571 3300028379 Bacteria 5360
273 Ga0268265_10125276 3300028380 Bacteria 2125
274 Ga0268264_10077824 3300028381 Bacteria 2826
275 Ga0268264_10082506 3300028381 Bacteria 2751
276 Ga0268264_10108384 3300028381 Bacteria 2428
277 Ga0307413_10179752 3300031824 Bacteria 1507
278 Ga0307406_10012430 3300031901 Bacteria 4856
279 Ga0307409_100271935 3300031995 Bacteria 1561
280 Ga0307411_10434430 3300032005 Bacteria 1094
281 Ga0373924_0096687 3300035410 Unclassified 1268
282 Ga0373947_0546527 3300035725 Unclassified 788
283 Ga0373937_0056272 3300036401 Bacteria 3612
284 Ga0436364_0614625 3300037853 Bacteria 4297
285 Ga0395901_0237275 3300038443 Unclassified 1903
286 Ga0436365_0439554 3300039437 Bacteria 1463
287 Ga0436365_0693142 3300039437 Bacteria 69863
288 Ga0436365_1496893 3300039437 Bacteria 2896
289 Ga0436362_1227415 3300039453 Bacteria 1901
290 Ga0439458_0053312 3300042157 Bacteria 1001
291 Ga0453683_0134813 3300044673 Bacteria 1557
292 Ga0466967_0196421 3300045976 Bacteria 1909
293 Ga0495629_0338932 3300046459 Unclassified 1027
294 Ga0495639_0203515 3300046475 Unclassified 970
295 Ga0495664_0297396 3300046477 Bacteria 975
296 Ga0495640_0304395 3300046533 Bacteria 990
297 Ga0495640_0320219 3300046533 Unclassified 961
298 Ga0495645_0007930 3300046543 Bacteria 7390
299 Ga0495658_0144128 3300046683 Bacteria 1458
300 Ga0496106_0093672 3300048909 Bacteria 2322
301 Ga0496108_0768781 3300048911 Bacteria 832
302 Ga0496112_0038207 3300048915 Bacteria 4688
303 Ga0496112_0496059 3300048915 Unclassified 1157
304 Ga0501217_020062 3300049661 Bacteria 1566
305 Ga0501236_004436 3300049670 Bacteria 1664
306 Ga0501259_025149 3300049688 Bacteria 1089
307 Ga0501229_014710 3300049706 Bacteria 1009
308 nmdc:mga05p37_147888_c1 3300050507 Unclassified 2875
309 nmdc:mga05p37_363887_c1 3300050507 Bacteria 1699
310 nmdc:mga05p37_39649_c1 3300050507 Bacteria 5784
311 nmdc:mga05p37_457942_c1 3300050507 Bacteria 1475
312 nmdc:mga05p37_563480_c1 3300050507 Unclassified 1294
313 nmdc:mga05p37_796648_c1 3300050507 Bacteria 1034
314 nmdc:mga05p37_8387_c1 3300050507 Bacteria 12221
315 nmdc:mga09592_125981_c1 3300050508 Bacteria 2201
316 nmdc:mga09592_334912_c1 3300050508 Unclassified 1310
317 nmdc:mga0qj67_425951_c1 3300050509 Bacteria 1070
318 nmdc:mga06r32_96734_c1 3300050510 Bacteria 2892
319 nmdc:mga08y16_37143_c1 3300050511 Bacteria 5116
320 nmdc:mga08y16_456486_c1 3300050511 Unclassified 1303
321 nmdc:mga08y16_525796_c1 3300050511 Bacteria 1199
322 nmdc:mga0n895_147858_c1 3300050512 Bacteria 2379
323 nmdc:mga0n895_195638_c1 3300050512 Unclassified 2053
324 nmdc:mga0n895_319771_c1 3300050512 Bacteria 1572
325 nmdc:mga0n895_43108_c1 3300050512 Bacteria 4395
326 nmdc:mga0rr50_198402_c1 3300050513 Bacteria 1648
327 nmdc:mga08x19_121014_c1 3300050514 Bacteria 1755
328 nmdc:mga08x19_77728_c1 3300050514 Bacteria 2174
329 nmdc:mga0a205_137594_c1 3300050515 Bacteria 2343
330 nmdc:mga0a205_27080_c1 3300050515 Bacteria 5472
331 nmdc:mga0a205_40525_c1 3300050515 Bacteria 4484
332 Ga0070670_100111808
333 Ga0065714_10064422
334 Ga0065712_10004337
335 Ga0065712_10067728
336 Ga0065712_10080012
337 Ga0065715_10090652
338 Ga0065715_10097582
339 Ga0065715_10102595
340 Ga0065707_10322058
341 Ga0070676_10047185
342 Ga0070690_100008574
343 Ga0070677_10067582
344 Ga0068869_100067295
345 Ga0070680_100056285
346 Ga0068868_100004601
347 Ga0068868_100019103
348 Ga0068868_100056179
349 Ga0068868_100327685
350 Ga0070689_100020880
351 Ga0070689_100114521
352 Ga0070689_100352487
353 Ga0070691_10231894
354 Ga0070661_100327991
355 Ga0070675_100029269
356 Ga0070675_100086175
357 Ga0070675_100344029
358 Ga0070671_100003038
359 Ga0070671_100103763
360 Ga0070671_100115723
361 Ga0070673_100016273
362 Ga0070673_100231041
363 Ga0070688_100011428
364 Ga0070667_100065516
365 Ga0070667_100081919
366 Ga0070667_100090616
367 Ga0070701_10018801
368 Ga0070701_10154877
369 Ga0070711_100456492
370 Ga0070705_100030586
371 Ga0070705_100118196
372 Ga0070705_100148471
373 Ga0070700_100000450
374 Ga0070700_100023028
375 Ga0070700_100095287
376 Ga0070694_100001991
377 Ga0070694_100010522
378 Ga0070694_100103067
379 Ga0070694_100155246
380 Ga0070694_100276353
381 Ga0070678_100073603
382 Ga0070662_100586792
383 Ga0070681_10027008
384 Ga0068867_100073239
385 Ga0068867_100090788
386 Ga0070685_10024458
387 Ga0070706_100006857
388 Ga0070707_100016235
389 Ga0070707_100105958
390 Ga0070698_100416260
391 Ga0070699_100585113
392 Ga0070697_100002241
393 Ga0070697_100266331
394 Ga0070686_100327771
395 Ga0070695_100001043
396 Ga0070695_100028230
397 Ga0070695_100097548
398 Ga0070695_100108817
399 Ga0070695_100260970
400 Ga0070695_100373992
401 Ga0070695_100393280
402 Ga0070696_100052483
403 Ga0070696_100084777
404 Ga0070696_100169954
405 Ga0070693_100046903
406 Ga0070665_100037500
407 Ga0070665_100039599
408 Ga0070704_100007391
409 Ga0070704_100027053
410 Ga0070704_100121040
411 Ga0070704_100155956
412 Ga0070704_100287203
413 Ga0068857_100163298
414 Ga0068854_100301357
415 Ga0068854_100356182
416 Ga0070702_100004388
417 Ga0068859_100003945
418 Ga0068859_100032686
419 Ga0068859_100092866
420 Ga0068859_100106662
421 Ga0068859_100216421
422 Ga0068864_100013266
423 Ga0068864_100056536
424 Ga0068864_100111507
425 Ga0068864_100115936
426 Ga0068864_100300808
427 Ga0068866_10393552
428 Ga0068861_100015851
429 Ga0068851_10035719
430 Ga0068870_10035528
431 Ga0068863_100009745
432 Ga0068863_100066083
433 Ga0068863_100109732
434 Ga0068858_100145154
435 Ga0068860_100023283
436 Ga0068860_100061119
437 Ga0068860_100097416
438 Ga0068860_100194096
439 Ga0068862_100035930
440 Ga0081455_10113600
441 Ga0070716_100012255
442 Ga0097621_100004108
443 Ga0097621_100061738
444 Ga0097621_100125159
445 Ga0068871_100005910
446 Ga0068871_100014455
447 Ga0075428_100093188
448 Ga0075430_100070125
449 Ga0075431_100012973
450 Ga0075433_10062903
451 Ga0075433_10071824
452 Ga0075433_10098387
453 Ga0075434_100046518
454 Ga0075434_100230379
455 Ga0068865_100073658
456 Ga0075436_100048759
457 Ga0075436_100135819
458 Ga0097620_100003945
459 Ga0097620_100032684
460 Ga0097620_100092868
461 Ga0097620_100106665
462 Ga0097620_100216418
463 Ga0075435_100035057
464 Ga0105240_10009659
465 Ga0105240_10111393
466 Ga0111539_10350939
467 Ga0111539_10522304
468 Ga0105245_10023332
469 Ga0105245_10026977
470 Ga0105247_10037253
471 Ga0114129_10006099
472 Ga0114129_10023678
473 Ga0114129_10030053
474 Ga0114129_10138547
475 Ga0114129_10228487
476 Ga0114129_10264725
477 Ga0114129_10333470
478 Ga0114129_10823281
479 Ga0105243_10021369
480 Ga0105243_10062240
481 Ga0105243_10108784
482 Ga0105243_10366928
483 Ga0105243_10559778
484 Ga0105241_10044937
485 Ga0105241_10147426
486 Ga0105241_10407513
487 Ga0105242_10002662
488 Ga0105242_10006632
489 Ga0105242_10100458
490 Ga0105248_10003678
491 Ga0105248_10014664
492 Ga0105248_10019142
493 Ga0105248_10076076
494 Ga0105248_10187694
495 Ga0105248_10556586
496 Ga0105248_10807226
497 Ga0105249_10023790
498 Ga0105249_10315171
499 Ga0105239_10130015
500 Ga0157373_10295500
501 Ga0157371_10196658
502 Ga0157374_10078796
503 Ga0157378_10001325
504 Ga0157378_10024876
505 Ga0157378_10047527
506 Ga0157378_10191780
507 Ga0157378_10261731
508 Ga0163162_10013112
509 Ga0163162_10024517
510 Ga0163162_10075247
511 Ga0163162_10079312
512 Ga0163162_10563350
513 Ga0157375_10096312
514 Ga0157375_10096451
515 Ga0163163_10028827
516 Ga0163163_10087749
517 Ga0163163_10255805
518 Ga0163163_10386395
519 Ga0157380_10033027
520 Ga0157380_10036426
521 Ga0157377_10042583
522 Ga0157377_10096967
523 Ga0157376_10037334
524 Ga0157376_10084256
525 Ga0157376_10121843
526 Ga0163161_10007004
527 Ga0213873_10046675
528 Ga0213876_10001634
529 Ga0207697_10024424
530 Ga0207656_10047067
531 Ga0207682_10157248
532 Ga0207642_10021449
533 Ga0207642_10090503
534 Ga0207680_10292133
535 Ga0207645_10049067
536 Ga0207645_10056362
537 Ga0207643_10010229
538 Ga0207643_10021023
539 Ga0207684_10014728
540 Ga0207684_10064939
541 Ga0207684_10430886
542 Ga0207654_10006200
543 Ga0207707_10069838
544 Ga0207695_10394869
545 Ga0207660_10025345
546 Ga0207660_10164149
547 Ga0207662_10029296
548 Ga0207649_10488232
549 Ga0207646_10054598
550 Ga0207646_10062464
551 Ga0207681_10075979
552 Ga0207650_10222215
553 Ga0207659_10069610
554 Ga0207659_10155982
555 Ga0207644_10004532
556 Ga0207644_10027435
557 Ga0207706_10517524
558 Ga0207686_10012888
559 Ga0207686_10086155
560 Ga0207709_10075374
561 Ga0207709_10133937
562 Ga0207670_10000827
563 Ga0207704_10009670
564 Ga0207665_10022173
565 Ga0207691_10006555
566 Ga0207691_10359320
567 Ga0207711_10002337
568 Ga0207711_10051876
569 Ga0207711_10063833
570 Ga0207689_10028139
571 Ga0207689_10055854
572 Ga0207689_10290467
573 Ga0207679_10119518
574 Ga0207679_10331112
575 Ga0207651_10115106
576 Ga0207651_10468728
577 Ga0207640_10037751
578 Ga0207640_10336875
579 Ga0207658_10048548
580 Ga0207658_10132909
581 Ga0207677_10018383
582 Ga0207677_10098977
583 Ga0207703_10624910
584 Ga0207708_10000080
585 Ga0207708_10072757
586 Ga0207708_10159164
587 Ga0207648_10054245
588 Ga0207648_10116870
589 Ga0207648_10377657
590 Ga0207676_10001383
591 Ga0207676_10101141
592 Ga0207676_10122625
593 Ga0207676_10253417
594 Ga0207676_10373134
595 Ga0207674_10107328
596 Ga0207674_10172082
597 Ga0207674_10307115
598 Ga0207675_100019930
599 Ga0207675_100061101
600 Ga0207675_100460489
601 Ga0207683_10079553
602 Ga0207428_10102840
603 Ga0268266_10022571
604 Ga0268265_10125276
605 Ga0268264_10077824
606 Ga0268264_10082506
607 Ga0268264_10108384
608 Ga0307413_10179752
609 Ga0307406_10012430
610 Ga0307409_100271935
611 Ga0307411_10434430
612 Ga0373924_0096687
613 Ga0373947_0546527
614 Ga0373937_0056272
615 Ga0436364_0614625
616 Ga0395901_0237275
617 Ga0436365_0439554
618 Ga0436365_0693142
619 Ga0436365_1496893
620 Ga0436362_1227415
621 Ga0439458_0053312
622 Ga0453683_0134813
623 Ga0466967_0196421
624 Ga0495629_0338932
625 Ga0495639_0203515
626 Ga0495664_0297396
627 Ga0495640_0304395
628 Ga0495640_0320219
629 Ga0495645_0007930
630 Ga0495658_0144128
631 Ga0496106_0093672
632 Ga0496108_0768781
633 Ga0496112_0038207
634 Ga0496112_0496059
635 Ga0501217_020062
636 Ga0501236_004436
637 Ga0501259_025149
638 Ga0501229_014710
639 nmdc:mga05p37_147888_c1
640 nmdc:mga05p37_363887_c1
641 nmdc:mga05p37_39649_c1
642 nmdc:mga05p37_457942_c1
643 nmdc:mga05p37_563480_c1
644 nmdc:mga05p37_796648_c1
645 nmdc:mga05p37_8387_c1
646 nmdc:mga09592_125981_c1
647 nmdc:mga09592_334912_c1
648 nmdc:mga0qj67_425951_c1
649 nmdc:mga06r32_96734_c1
650 nmdc:mga08y16_37143_c1
651 nmdc:mga08y16_456486_c1
652 nmdc:mga08y16_525796_c1
653 nmdc:mga0n895_147858_c1
654 nmdc:mga0n895_195638_c1
655 nmdc:mga0n895_319771_c1
656 nmdc:mga0n895_43108_c1
657 nmdc:mga0rr50_198402_c1
658 nmdc:mga08x19_121014_c1
659 nmdc:mga08x19_77728_c1
660 nmdc:mga0a205_137594_c1
661 nmdc:mga0a205_27080_c1
662 nmdc:mga0a205_40525_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

3

37

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y3a-assembly2.cif.gz_G crystal structure of ragulator complex (p18 49-161) 0.7996 200 241
3l7h-assembly1.cif.gz_A insights into dynein assembly from a dynein intermediate chain light chain roadblock structure 0.7857 201 226
6r27-assembly2.cif.gz_D crystallographic superstructure of the photosensory core module (pas-gaf-phy) of the bacterial phytochrome agp1 (atbphp1) locked in a pr-like state 0.7672 201 230
5yk3-assembly2.cif.gz_B human ragulator complex 0.765 198 241
3m4w-assembly1.cif.gz_C structural basis for the negative regulation of bacterial stress response by rseb 0.763 160 242
ID Description Score Start End Superfamily
af_Q4D2K4_12_131_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8017 203 226 3.30.450.30
af_Q4D2K4_6_143_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8017 203 226 3.30.450.30
af_I1MCG5_8_142_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7942 197 238 3.30.450.60
af_Q54F59_1_120_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7927 197 242 3.30.450.30
af_I1KXB9_5_146_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7717 205 230 3.30.450.60
ID Description Score Start End GO Terms
AF-A0A538RRT3-F1-model_v4 Anti-sigma factor 0.9674 157 242
AF-A0A2W6A989-F1-model_v4 Anti-sigma factor 0.9594 154 240
AF-A0A2V6FUE9-F1-model_v4 Anti-sigma factor 0.9536 109 243
AF-A0A2V8TLS2-F1-model_v4 Anti-sigma factor 0.9533 117 243
AF-A0A2V8P596-F1-model_v4 Anti-sigma factor 0.949 102 243

Map