F410276

General Info

Members Datasets Scaffolds Average Seq Length
330 189 660 253

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0015078|Ga0501036_0015078_3570_4457
Length 295
Sequence MKRSMPDRNPHDIKPLTPFRLHATLALFALCPSGASPQFNVEDVLRAFGTLLLAVQDPGLSVGSTEPASSTDIVSLVLHASPVAQAVLAVLLLFSAISWGVIVFKHLQLKRAATQTTAFLDVFRKSSRFSEVQAVCSTLAASPLVGLFQAGYAELNAQLRTPESKPDGGTPRPTLKSLEAVDRALLRASTVEVSKLEYRVAFLATTASISPYIGLFGTVWGIMASFQSIGAQGSTSLGVVAPGIAEALVATAAGLFAAIPAVYFYNDITSRVKKAANEMDDFSLEFLTIAERNFT

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
119 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
120 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0
Rhizoplane 3.03
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0015078 3300049572 Bacteria 6450
2 Ga0065715_10130813 3300005293 Bacteria 2019
3 Ga0065715_10153743 3300005293 Bacteria 1700
4 Ga0070676_10139520 3300005328 Bacteria 1541
5 Ga0070690_100178185 3300005330 Bacteria 1467
6 Ga0070677_10047922 3300005333 Bacteria 1715
7 Ga0068869_100210930 3300005334 Bacteria 1535
8 Ga0068868_100081142 3300005338 Bacteria 2600
9 Ga0070689_100175835 3300005340 Bacteria 1736
10 Ga0070661_100241588 3300005344 Bacteria 1391
11 Ga0070692_10112107 3300005345 Bacteria 1510
12 Ga0070668_100190156 3300005347 Bacteria 1681
13 Ga0070669_100053865 3300005353 Bacteria 2945
14 Ga0070675_100260612 3300005354 Bacteria 1519
15 Ga0070675_100263848 3300005354 Bacteria 1510
16 Ga0070675_100408249 3300005354 Bacteria 1213
17 Ga0070675_100516751 3300005354 Bacteria 1077
18 Ga0070675_100534487 3300005354 Unclassified 1059
19 Ga0070671_100152577 3300005355 Bacteria 1951
20 Ga0070673_100162777 3300005364 Bacteria 1898
21 Ga0070688_100117092 3300005365 Bacteria 1780
22 Ga0070688_100123901 3300005365 Bacteria 1735
23 Ga0070688_100315693 3300005365 Bacteria 1134
24 Ga0070659_100050941 3300005366 Bacteria 3255
25 Ga0070667_100103905 3300005367 Bacteria 2457
26 Ga0070667_100232913 3300005367 Bacteria 1643
27 Ga0070678_100223365 3300005456 Bacteria 1566
28 Ga0068867_100303756 3300005459 Bacteria 1316
29 Ga0070707_100522268 3300005468 Bacteria 1149
30 Ga0070699_100284359 3300005518 Bacteria 1482
31 Ga0070684_100027759 3300005535 Bacteria 4781
32 Ga0070684_100164917 3300005535 Bacteria 2011
33 Ga0068853_100156786 3300005539 Bacteria 2052
34 Ga0070686_100086734 3300005544 Bacteria 2085
35 Ga0070665_100134241 3300005548 Bacteria 2477
36 Ga0070664_100208929 3300005564 Bacteria 1744
37 Ga0068857_100193017 3300005577 Bacteria 1855
38 Ga0068854_100035166 3300005578 Bacteria 3505
39 Ga0068852_100231500 3300005616 Bacteria 1761
40 Ga0068859_100003252 3300005617 Bacteria 16539
41 Ga0068859_100146549 3300005617 Bacteria 2436
42 Ga0068859_100156281 3300005617 Bacteria 2358
43 Ga0068859_100669617 3300005617 Bacteria 1129
44 Ga0068864_100685290 3300005618 Bacteria 1000
45 Ga0068863_100164655 3300005841 Bacteria 2126
46 Ga0068858_100077308 3300005842 Bacteria 3092
47 Ga0068860_100045550 3300005843 Bacteria 4183
48 Ga0068862_100012459 3300005844 Bacteria 7037
49 Ga0068862_100077503 3300005844 Bacteria 2879
50 Ga0081455_10061181 3300005937 Bacteria 3170
51 Ga0075365_10003114 3300006038 Bacteria 8438
52 Ga0075364_10004773 3300006051 Bacteria 7837
53 Ga0075364_10011236 3300006051 Bacteria 5435
54 Ga0075364_10021066 3300006051 Bacteria 4106
55 Ga0075364_10068819 3300006051 Bacteria 2328
56 Ga0075362_10000523 3300006177 Bacteria 11156
57 Ga0075367_10006391 3300006178 Bacteria 5950
58 Ga0075367_10105966 3300006178 Bacteria 1722
59 Ga0075366_10005408 3300006195 Bacteria 6918
60 Ga0075366_10132306 3300006195 Bacteria 1505
61 Ga0097621_100066011 3300006237 Bacteria 2979
62 Ga0075370_10009209 3300006353 Bacteria 5116
63 Ga0068871_100284321 3300006358 Bacteria 1448
64 Ga0075428_100088673 3300006844 Bacteria 3374
65 Ga0075430_100144290 3300006846 Bacteria 1983
66 Ga0075431_100088731 3300006847 Bacteria 3192
67 Ga0075433_10204983 3300006852 Bacteria 1753
68 Ga0075433_10299274 3300006852 Bacteria 1424
69 Ga0075434_100114913 3300006871 Bacteria 2704
70 Ga0075434_100203495 3300006871 Bacteria 2000
71 Ga0075434_100417648 3300006871 Bacteria 1362
72 Ga0075429_100262031 3300006880 Bacteria 1513
73 Ga0097620_100003252 3300006931 Bacteria 16539
74 Ga0097620_100146561 3300006931 Bacteria 2436
75 Ga0097620_100156280 3300006931 Bacteria 2358
76 Ga0097620_100669533 3300006931 Bacteria 1129
77 Ga0105240_10034496 3300009093 Bacteria 6526
78 Ga0105240_10089890 3300009093 Bacteria 3755
79 Ga0111539_10064110 3300009094 Bacteria 4348
80 Ga0111539_10119239 3300009094 Bacteria 3092
81 Ga0111539_10358761 3300009094 Bacteria 1696
82 Ga0111539_10528607 3300009094 Bacteria 1374
83 Ga0105245_10253061 3300009098 Bacteria 1712
84 Ga0105247_10046282 3300009101 Bacteria 2670
85 Ga0105247_10050096 3300009101 Bacteria 2569
86 Ga0114129_10000540 3300009147 Bacteria 46396
87 Ga0114129_10009194 3300009147 Bacteria 14088
88 Ga0114129_10018673 3300009147 Bacteria 9873
89 Ga0114129_10020734 3300009147 Bacteria 9340
90 Ga0114129_10023591 3300009147 Bacteria 8719
91 Ga0105248_10143640 3300009177 Bacteria 2693
92 Ga0105248_10251950 3300009177 Bacteria 1987
93 Ga0105248_10256661 3300009177 Bacteria 1968
94 Ga0105248_10264237 3300009177 Bacteria 1937
95 Ga0105249_10248149 3300009553 Bacteria 1763
96 Ga0105249_10540344 3300009553 Bacteria 1215
97 Ga0105239_10491624 3300010375 Bacteria 1394
98 Ga0105239_10666684 3300010375 Bacteria 1188
99 Ga0157369_10104373 3300013105 Bacteria 3018
100 Ga0163162_10162237 3300013306 Bacteria 2357
101 Ga0163162_10755507 3300013306 Bacteria 1091
102 Ga0157372_10211341 3300013307 Bacteria 2248
103 Ga0157372_10479277 3300013307 Bacteria 1450
104 Ga0157375_10061741 3300013308 Bacteria 3722
105 Ga0157375_10296921 3300013308 Bacteria 1779
106 Ga0163163_10030840 3300014325 Bacteria 5170
107 Ga0157380_10050120 3300014326 Bacteria 3296
108 Ga0157380_10233162 3300014326 Bacteria 1654
109 Ga0157380_10557618 3300014326 Bacteria 1125
110 Ga0157379_10036238 3300014968 Bacteria 4399
111 Ga0157379_10104941 3300014968 Bacteria 2536
112 Ga0157376_10353496 3300014969 Bacteria 1407
113 Ga0163161_10101086 3300017792 Bacteria 2146
114 Ga0163161_10287042 3300017792 Bacteria 1292
115 Ga0207697_10115467 3300025315 Bacteria 1152
116 Ga0207682_10050499 3300025893 Bacteria 1719
117 Ga0207710_10046319 3300025900 Bacteria 1941
118 Ga0207680_10347186 3300025903 Bacteria 1042
119 Ga0207645_10110049 3300025907 Bacteria 1783
120 Ga0207645_10166520 3300025907 Bacteria 1443
121 Ga0207695_10059846 3300025913 Bacteria 3947
122 Ga0207695_10287574 3300025913 Bacteria 1537
123 Ga0207652_10273577 3300025921 Bacteria 1523
124 Ga0207646_10419395 3300025922 Bacteria 1208
125 Ga0207681_10006114 3300025923 Bacteria 7384
126 Ga0207644_10419311 3300025931 Bacteria 1096
127 Ga0207690_10111701 3300025932 Bacteria 1970
128 Ga0207690_10169139 3300025932 Bacteria 1636
129 Ga0207706_10403858 3300025933 Bacteria 1184
130 Ga0207686_10060545 3300025934 Bacteria 2397
131 Ga0207709_10059104 3300025935 Bacteria 2385
132 Ga0207670_10206366 3300025936 Bacteria 1496
133 Ga0207704_10172478 3300025938 Bacteria 1553
134 Ga0207704_10227107 3300025938 Bacteria 1385
135 Ga0207691_10026845 3300025940 Bacteria 5403
136 Ga0207711_10012385 3300025941 Bacteria 7089
137 Ga0207711_10157313 3300025941 Bacteria 2055
138 Ga0207711_10205342 3300025941 Bacteria 1799
139 Ga0207711_10209903 3300025941 Bacteria 1779
140 Ga0207711_10362906 3300025941 Bacteria 1342
141 Ga0207689_10095690 3300025942 Bacteria 2439
142 Ga0207689_10130492 3300025942 Bacteria 2068
143 Ga0207667_10101187 3300025949 Bacteria 2973
144 Ga0207651_10051812 3300025960 Bacteria 2795
145 Ga0207640_10059574 3300025981 Bacteria 2520
146 Ga0207658_10162161 3300025986 Bacteria 1833
147 Ga0207703_10078216 3300026035 Bacteria 2747
148 Ga0207703_10087906 3300026035 Bacteria 2607
149 Ga0207703_10168972 3300026035 Bacteria 1922
150 Ga0207708_10132881 3300026075 Bacteria 1947
151 Ga0207702_10178921 3300026078 Bacteria 1951
152 Ga0207641_10003603 3300026088 Bacteria 13671
153 Ga0207641_10119877 3300026088 Bacteria 2346
154 Ga0207648_10289040 3300026089 Bacteria 1467
155 Ga0207676_10263308 3300026095 Bacteria 1558
156 Ga0207675_100136960 3300026118 Bacteria 2324
157 Ga0207675_100599736 3300026118 Bacteria 1104
158 Ga0207683_10191643 3300026121 Bacteria 1856
159 Ga0207698_10099391 3300026142 Bacteria 2407
160 Ga0209813_10014927 3300027866 Bacteria 2098
161 Ga0209974_10102717 3300027876 Bacteria 1000
162 Ga0207428_10008447 3300027907 Bacteria 9296
163 Ga0207428_10316821 3300027907 Bacteria 1152
164 Ga0268266_10061586 3300028379 Bacteria 3237
165 Ga0268265_10004449 3300028380 Bacteria 9725
166 Ga0268265_10345406 3300028380 Bacteria 1357
167 Ga0268264_10016333 3300028381 Bacteria 6079
168 Ga0307408_100108394 3300031548 Bacteria 2129
169 Ga0307410_10225884 3300031852 Bacteria 1443
170 Ga0307412_10464385 3300031911 Bacteria 1046
171 Ga0307409_100579231 3300031995 Bacteria 1106
172 Ga0307416_100426911 3300032002 Bacteria 1371
173 Ga0307411_10160076 3300032005 Bacteria 1685
174 Ga0307415_100139001 3300032126 Bacteria 1852
175 Ga0307415_100170270 3300032126 Bacteria 1698
176 Ga0307415_100184551 3300032126 Bacteria 1640
177 Ga0373941_0112061 3300035115 Bacteria 963
178 Ga0373955_0270101 3300035172 Bacteria 1022
179 Ga0439431_0081727 3300041997 Bacteria 872
180 Ga0450923_025097 3300042125 Bacteria 1186
181 Ga0450895_002903 3300042132 Bacteria 1303
182 Ga0450896_000045 3300042133 Bacteria 7622
183 Ga0439446_0006391 3300042156 Bacteria 3071
184 Ga0439434_0008292 3300042435 Bacteria 3047
185 Ga0439464_0086265 3300042439 Bacteria 942
186 Ga0439460_0013687 3300042461 Bacteria 2126
187 Ga0439460_0082470 3300042461 Bacteria 1011
188 Ga0450918_014044 3300042531 Bacteria 1393
189 Ga0451576_0186856 3300045051 Bacteria 2164
190 Ga0495662_0196693 3300046476 Bacteria 994
191 Ga0495630_0374274 3300046517 Bacteria 1091
192 Ga0495621_0035968 3300046539 Bacteria 1717
193 Ga0495658_0014625 3300046683 Bacteria 4013
194 Ga0495674_0127279 3300047319 Bacteria 2148
195 Ga0496101_0184719 3300048904 Bacteria 1607
196 Ga0496104_0014944 3300048907 Bacteria 7021
197 Ga0496105_0130354 3300048908 Bacteria 2073
198 Ga0496108_0297586 3300048911 Bacteria 1405
199 Ga0496110_0081927 3300048913 Bacteria 2877
200 Ga0496111_0174610 3300048914 Bacteria 1597
201 Ga0496114_0054107 3300048917 Bacteria 3346
202 Ga0496114_0334642 3300048917 Bacteria 1339
203 Ga0496114_0641814 3300048917 Bacteria 934
204 Ga0496115_0025788 3300048918 Bacteria 4581
205 Ga0501032_0006651 3300049569 Bacteria 8485
206 Ga0501032_0014181 3300049569 Bacteria 5645
207 Ga0501033_0008239 3300049570 Bacteria 8068
208 Ga0501033_0008479 3300049570 Bacteria 7954
209 Ga0501033_0181296 3300049570 Bacteria 1509
210 Ga0501034_0014531 3300049571 Bacteria 8107
211 Ga0501034_0223305 3300049571 Bacteria 1835
212 Ga0501036_0002616 3300049572 Bacteria 14191
213 Ga0501036_0023852 3300049572 Bacteria 5155
214 Ga0501036_0198713 3300049572 Bacteria 1686
215 Ga0501036_0714729 3300049572 Bacteria 827
216 Ga0501037_0008036 3300049573 Bacteria 7729
217 Ga0501037_0015540 3300049573 Bacteria 5601
218 Ga0501037_0089485 3300049573 Bacteria 2227
219 Ga0501038_0286825 3300049574 Bacteria 1294
220 Ga0501038_0295307 3300049574 Bacteria 1272
221 Ga0501039_0014100 3300049575 Bacteria 6119
222 Ga0501039_0072954 3300049575 Bacteria 2667
223 Ga0501039_0079849 3300049575 Bacteria 2545
224 Ga0501042_0011726 3300049578 Bacteria 5922
225 Ga0501042_0127315 3300049578 Bacteria 1834
226 Ga0501043_0002507 3300049579 Bacteria 15526
227 Ga0501043_0020649 3300049579 Bacteria 5167
228 Ga0501043_0270570 3300049579 Bacteria 1304
229 Ga0501046_0002850 3300049580 Bacteria 16086
230 Ga0501046_0009278 3300049580 Bacteria 8518
231 Ga0501046_0021883 3300049580 Bacteria 5271
232 Ga0501046_0032508 3300049580 Bacteria 4224
233 Ga0501047_0007039 3300049581 Bacteria 10559
234 Ga0501047_0017620 3300049581 Bacteria 6844
235 Ga0501047_0051622 3300049581 Bacteria 3973
236 Ga0501047_0182591 3300049581 Bacteria 1964
237 Ga0501047_0269330 3300049581 Bacteria 1549
238 Ga0501047_0569020 3300049581 Bacteria 956
239 Ga0501047_0707671 3300049581 Bacteria 824
240 Ga0501067_0010421 3300049583 Bacteria 5145
241 Ga0501067_0097229 3300049583 Bacteria 1635
242 Ga0501067_0165647 3300049583 Bacteria 1231
243 Ga0501068_0003759 3300049584 Bacteria 8217
244 Ga0501068_0007606 3300049584 Bacteria 5997
245 Ga0501068_0077829 3300049584 Bacteria 2031
246 Ga0501069_0004064 3300049585 Bacteria 7553
247 Ga0501069_0006247 3300049585 Bacteria 6226
248 Ga0501069_0049849 3300049585 Bacteria 2328
249 Ga0501070_0176391 3300049586 Bacteria 1759
250 Ga0501072_0052076 3300049588 Bacteria 3223
251 Ga0501072_0239071 3300049588 Bacteria 1446
252 Ga0501072_0561911 3300049588 Bacteria 901
253 Ga0501073_0019790 3300049589 Bacteria 4857
254 Ga0501073_0042746 3300049589 Bacteria 3197
255 Ga0501073_0088475 3300049589 Bacteria 2153
256 Ga0501073_0215781 3300049589 Bacteria 1326
257 Ga0501073_0283714 3300049589 Bacteria 1142
258 Ga0501073_0431991 3300049589 Bacteria 910
259 Ga0501073_0517732 3300049589 Bacteria 824
260 Ga0501074_0025222 3300049590 Bacteria 4319
261 Ga0501074_0049414 3300049590 Bacteria 3036
262 Ga0501075_0282956 3300049591 Bacteria 1263
263 Ga0501076_0357651 3300049592 Bacteria 1199
264 Ga0501079_0073783 3300049741 Bacteria 2637
265 Ga0501080_0050157 3300049742 Bacteria 3885
266 Ga0501080_0385326 3300049742 Bacteria 1263
267 Ga0501080_0547749 3300049742 Bacteria 1030
268 Ga0501080_0705690 3300049742 Bacteria 890
269 Ga0501080_1011553 3300049742 Bacteria 720
270 Ga0501080_1020005 3300049742 Bacteria 717
271 Ga0501083_0002778 3300049744 Bacteria 12100
272 Ga0501083_0024673 3300049744 Bacteria 4164
273 Ga0501083_0035391 3300049744 Bacteria 3411
274 Ga0501083_0038543 3300049744 Bacteria 3248
275 Ga0501083_0086115 3300049744 Bacteria 2078
276 Ga0501035_0063319 3300049822 Bacteria 3289
277 Ga0501035_0110998 3300049822 Bacteria 2403
278 Ga0501044_0004277 3300049823 Bacteria 16018
279 Ga0501044_0082708 3300049823 Bacteria 3247
280 Ga0501045_0015730 3300049824 Bacteria 5368
281 Ga0501045_0300539 3300049824 Bacteria 1195
282 nmdc:mga03683_3248_c1 3300050489 Bacteria 5209
283 nmdc:mga00v17_2395_c1 3300050491 Bacteria 9600
284 nmdc:mga00v17_31190_c1 3300050491 Bacteria 3142
285 nmdc:mga00v17_70799_c1 3300050491 Bacteria 2161
286 nmdc:mga00v17_81045_c1 3300050491 Bacteria 2026
287 nmdc:mga0yw44_10475_c1 3300050492 Bacteria 4739
288 nmdc:mga0yw44_17915_c1 3300050492 Bacteria 3867
289 nmdc:mga0k408_8225_c1 3300050493 Bacteria 5592
290 nmdc:mga0k408_9253_c1 3300050493 Bacteria 5308
291 nmdc:mga0k408_9570_c1 3300050493 Bacteria 5228
292 nmdc:mga06z11_23585_c1 3300050494 Bacteria 2893
293 nmdc:mga06z11_59647_c1 3300050494 Bacteria 1984
294 nmdc:mga07m45_90869_c1 3300050496 Bacteria 1749
295 nmdc:mga05p37_11340_c1 3300050507 Bacteria 10602
296 nmdc:mga05p37_123186_c1 3300050507 Bacteria 3185
297 nmdc:mga05p37_147_c1 3300050507 Bacteria 66379
298 nmdc:mga05p37_17025_c1 3300050507 Bacteria 8766
299 nmdc:mga09592_226583_c1 3300050508 Bacteria 1619
300 nmdc:mga09592_94681_c1 3300050508 Bacteria 2554
301 nmdc:mga0qj67_135489_c1 3300050509 Bacteria 1995
302 nmdc:mga0qj67_158182_c1 3300050509 Bacteria 1839
303 nmdc:mga08y16_21829_c1 3300050511 Bacteria 6755
304 nmdc:mga08y16_228169_c1 3300050511 Bacteria 1926
305 nmdc:mga08y16_252054_c1 3300050511 Bacteria 1824
306 nmdc:mga08y16_576645_c1 3300050511 Bacteria 1136
307 nmdc:mga08y16_82610_c1 3300050511 Bacteria 3349
308 nmdc:mga0n895_180725_c1 3300050512 Bacteria 2141
309 nmdc:mga0n895_221205_c1 3300050512 Bacteria 1922
310 nmdc:mga0n895_89415_c1 3300050512 Bacteria 3080
311 nmdc:mga0rr50_106385_c1 3300050513 Bacteria 2213
312 nmdc:mga0a205_201897_c1 3300050515 Bacteria 1878
313 nmdc:mga0a205_338644_c1 3300050515 Bacteria 1373
314 nmdc:mga0a205_52297_c1 3300050515 Bacteria 3942
315 nmdc:mga0a205_824744_c1 3300050515 Bacteria 775
316 nmdc:mga0sz30_168545_c1 3300050516 Bacteria 971
317 Ga0495601_0139103 3300053077 Bacteria 1583
318 Ga0495619_0045279 3300053085 Bacteria 2891
319 Ga0500641_0000167 3300053096 Bacteria 24634
320 Ga0500555_000847 3300053103 Bacteria 10948
321 Ga0500568_0001200 3300053139 Bacteria 17293
322 Ga0500616_0000736 3300053153 Bacteria 37813
323 Ga0500645_002267 3300053730 Bacteria 8738
324 Ga0501084_0196957 3300054114 Bacteria 1700
325 Ga0501084_0217636 3300054114 Bacteria 1611
326 Ga0590075_032579 3300059424 Bacteria 1323
327 Ga0590077_017473 3300059426 Bacteria 1509
328 Ga0501082_0005957 3300060353 Bacteria 10576
329 Ga0501082_0011955 3300060353 Bacteria 7464
330 Ga0501082_0028746 3300060353 Bacteria 4788
331 Ga0501036_0015078
332 Ga0065715_10130813
333 Ga0065715_10153743
334 Ga0070676_10139520
335 Ga0070690_100178185
336 Ga0070677_10047922
337 Ga0068869_100210930
338 Ga0068868_100081142
339 Ga0070689_100175835
340 Ga0070661_100241588
341 Ga0070692_10112107
342 Ga0070668_100190156
343 Ga0070669_100053865
344 Ga0070675_100260612
345 Ga0070675_100263848
346 Ga0070675_100408249
347 Ga0070675_100516751
348 Ga0070675_100534487
349 Ga0070671_100152577
350 Ga0070673_100162777
351 Ga0070688_100117092
352 Ga0070688_100123901
353 Ga0070688_100315693
354 Ga0070659_100050941
355 Ga0070667_100103905
356 Ga0070667_100232913
357 Ga0070678_100223365
358 Ga0068867_100303756
359 Ga0070707_100522268
360 Ga0070699_100284359
361 Ga0070684_100027759
362 Ga0070684_100164917
363 Ga0068853_100156786
364 Ga0070686_100086734
365 Ga0070665_100134241
366 Ga0070664_100208929
367 Ga0068857_100193017
368 Ga0068854_100035166
369 Ga0068852_100231500
370 Ga0068859_100003252
371 Ga0068859_100146549
372 Ga0068859_100156281
373 Ga0068859_100669617
374 Ga0068864_100685290
375 Ga0068863_100164655
376 Ga0068858_100077308
377 Ga0068860_100045550
378 Ga0068862_100012459
379 Ga0068862_100077503
380 Ga0081455_10061181
381 Ga0075365_10003114
382 Ga0075364_10004773
383 Ga0075364_10011236
384 Ga0075364_10021066
385 Ga0075364_10068819
386 Ga0075362_10000523
387 Ga0075367_10006391
388 Ga0075367_10105966
389 Ga0075366_10005408
390 Ga0075366_10132306
391 Ga0097621_100066011
392 Ga0075370_10009209
393 Ga0068871_100284321
394 Ga0075428_100088673
395 Ga0075430_100144290
396 Ga0075431_100088731
397 Ga0075433_10204983
398 Ga0075433_10299274
399 Ga0075434_100114913
400 Ga0075434_100203495
401 Ga0075434_100417648
402 Ga0075429_100262031
403 Ga0097620_100003252
404 Ga0097620_100146561
405 Ga0097620_100156280
406 Ga0097620_100669533
407 Ga0105240_10034496
408 Ga0105240_10089890
409 Ga0111539_10064110
410 Ga0111539_10119239
411 Ga0111539_10358761
412 Ga0111539_10528607
413 Ga0105245_10253061
414 Ga0105247_10046282
415 Ga0105247_10050096
416 Ga0114129_10000540
417 Ga0114129_10009194
418 Ga0114129_10018673
419 Ga0114129_10020734
420 Ga0114129_10023591
421 Ga0105248_10143640
422 Ga0105248_10251950
423 Ga0105248_10256661
424 Ga0105248_10264237
425 Ga0105249_10248149
426 Ga0105249_10540344
427 Ga0105239_10491624
428 Ga0105239_10666684
429 Ga0157369_10104373
430 Ga0163162_10162237
431 Ga0163162_10755507
432 Ga0157372_10211341
433 Ga0157372_10479277
434 Ga0157375_10061741
435 Ga0157375_10296921
436 Ga0163163_10030840
437 Ga0157380_10050120
438 Ga0157380_10233162
439 Ga0157380_10557618
440 Ga0157379_10036238
441 Ga0157379_10104941
442 Ga0157376_10353496
443 Ga0163161_10101086
444 Ga0163161_10287042
445 Ga0207697_10115467
446 Ga0207682_10050499
447 Ga0207710_10046319
448 Ga0207680_10347186
449 Ga0207645_10110049
450 Ga0207645_10166520
451 Ga0207695_10059846
452 Ga0207695_10287574
453 Ga0207652_10273577
454 Ga0207646_10419395
455 Ga0207681_10006114
456 Ga0207644_10419311
457 Ga0207690_10111701
458 Ga0207690_10169139
459 Ga0207706_10403858
460 Ga0207686_10060545
461 Ga0207709_10059104
462 Ga0207670_10206366
463 Ga0207704_10172478
464 Ga0207704_10227107
465 Ga0207691_10026845
466 Ga0207711_10012385
467 Ga0207711_10157313
468 Ga0207711_10205342
469 Ga0207711_10209903
470 Ga0207711_10362906
471 Ga0207689_10095690
472 Ga0207689_10130492
473 Ga0207667_10101187
474 Ga0207651_10051812
475 Ga0207640_10059574
476 Ga0207658_10162161
477 Ga0207703_10078216
478 Ga0207703_10087906
479 Ga0207703_10168972
480 Ga0207708_10132881
481 Ga0207702_10178921
482 Ga0207641_10003603
483 Ga0207641_10119877
484 Ga0207648_10289040
485 Ga0207676_10263308
486 Ga0207675_100136960
487 Ga0207675_100599736
488 Ga0207683_10191643
489 Ga0207698_10099391
490 Ga0209813_10014927
491 Ga0209974_10102717
492 Ga0207428_10008447
493 Ga0207428_10316821
494 Ga0268266_10061586
495 Ga0268265_10004449
496 Ga0268265_10345406
497 Ga0268264_10016333
498 Ga0307408_100108394
499 Ga0307410_10225884
500 Ga0307412_10464385
501 Ga0307409_100579231
502 Ga0307416_100426911
503 Ga0307411_10160076
504 Ga0307415_100139001
505 Ga0307415_100170270
506 Ga0307415_100184551
507 Ga0373941_0112061
508 Ga0373955_0270101
509 Ga0439431_0081727
510 Ga0450923_025097
511 Ga0450895_002903
512 Ga0450896_000045
513 Ga0439446_0006391
514 Ga0439434_0008292
515 Ga0439464_0086265
516 Ga0439460_0013687
517 Ga0439460_0082470
518 Ga0450918_014044
519 Ga0451576_0186856
520 Ga0495662_0196693
521 Ga0495630_0374274
522 Ga0495621_0035968
523 Ga0495658_0014625
524 Ga0495674_0127279
525 Ga0496101_0184719
526 Ga0496104_0014944
527 Ga0496105_0130354
528 Ga0496108_0297586
529 Ga0496110_0081927
530 Ga0496111_0174610
531 Ga0496114_0054107
532 Ga0496114_0334642
533 Ga0496114_0641814
534 Ga0496115_0025788
535 Ga0501032_0006651
536 Ga0501032_0014181
537 Ga0501033_0008239
538 Ga0501033_0008479
539 Ga0501033_0181296
540 Ga0501034_0014531
541 Ga0501034_0223305
542 Ga0501036_0002616
543 Ga0501036_0023852
544 Ga0501036_0198713
545 Ga0501036_0714729
546 Ga0501037_0008036
547 Ga0501037_0015540
548 Ga0501037_0089485
549 Ga0501038_0286825
550 Ga0501038_0295307
551 Ga0501039_0014100
552 Ga0501039_0072954
553 Ga0501039_0079849
554 Ga0501042_0011726
555 Ga0501042_0127315
556 Ga0501043_0002507
557 Ga0501043_0020649
558 Ga0501043_0270570
559 Ga0501046_0002850
560 Ga0501046_0009278
561 Ga0501046_0021883
562 Ga0501046_0032508
563 Ga0501047_0007039
564 Ga0501047_0017620
565 Ga0501047_0051622
566 Ga0501047_0182591
567 Ga0501047_0269330
568 Ga0501047_0569020
569 Ga0501047_0707671
570 Ga0501067_0010421
571 Ga0501067_0097229
572 Ga0501067_0165647
573 Ga0501068_0003759
574 Ga0501068_0007606
575 Ga0501068_0077829
576 Ga0501069_0004064
577 Ga0501069_0006247
578 Ga0501069_0049849
579 Ga0501070_0176391
580 Ga0501072_0052076
581 Ga0501072_0239071
582 Ga0501072_0561911
583 Ga0501073_0019790
584 Ga0501073_0042746
585 Ga0501073_0088475
586 Ga0501073_0215781
587 Ga0501073_0283714
588 Ga0501073_0431991
589 Ga0501073_0517732
590 Ga0501074_0025222
591 Ga0501074_0049414
592 Ga0501075_0282956
593 Ga0501076_0357651
594 Ga0501079_0073783
595 Ga0501080_0050157
596 Ga0501080_0385326
597 Ga0501080_0547749
598 Ga0501080_0705690
599 Ga0501080_1011553
600 Ga0501080_1020005
601 Ga0501083_0002778
602 Ga0501083_0024673
603 Ga0501083_0035391
604 Ga0501083_0038543
605 Ga0501083_0086115
606 Ga0501035_0063319
607 Ga0501035_0110998
608 Ga0501044_0004277
609 Ga0501044_0082708
610 Ga0501045_0015730
611 Ga0501045_0300539
612 nmdc:mga03683_3248_c1
613 nmdc:mga00v17_2395_c1
614 nmdc:mga00v17_31190_c1
615 nmdc:mga00v17_70799_c1
616 nmdc:mga00v17_81045_c1
617 nmdc:mga0yw44_10475_c1
618 nmdc:mga0yw44_17915_c1
619 nmdc:mga0k408_8225_c1
620 nmdc:mga0k408_9253_c1
621 nmdc:mga0k408_9570_c1
622 nmdc:mga06z11_23585_c1
623 nmdc:mga06z11_59647_c1
624 nmdc:mga07m45_90869_c1
625 nmdc:mga05p37_11340_c1
626 nmdc:mga05p37_123186_c1
627 nmdc:mga05p37_147_c1
628 nmdc:mga05p37_17025_c1
629 nmdc:mga09592_226583_c1
630 nmdc:mga09592_94681_c1
631 nmdc:mga0qj67_135489_c1
632 nmdc:mga0qj67_158182_c1
633 nmdc:mga08y16_21829_c1
634 nmdc:mga08y16_228169_c1
635 nmdc:mga08y16_252054_c1
636 nmdc:mga08y16_576645_c1
637 nmdc:mga08y16_82610_c1
638 nmdc:mga0n895_180725_c1
639 nmdc:mga0n895_221205_c1
640 nmdc:mga0n895_89415_c1
641 nmdc:mga0rr50_106385_c1
642 nmdc:mga0a205_201897_c1
643 nmdc:mga0a205_338644_c1
644 nmdc:mga0a205_52297_c1
645 nmdc:mga0a205_824744_c1
646 nmdc:mga0sz30_168545_c1
647 Ga0495601_0139103
648 Ga0495619_0045279
649 Ga0500641_0000167
650 Ga0500555_000847
651 Ga0500568_0001200
652 Ga0500616_0000736
653 Ga0500645_002267
654 Ga0501084_0196957
655 Ga0501084_0217636
656 Ga0590075_032579
657 Ga0590077_017473
658 Ga0501082_0005957
659 Ga0501082_0011955
660 Ga0501082_0028746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

157

281

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8odt-assembly1.cif.gz_E structure of tolqr complex from e.coli 0.8811 44 267
6ye4-assembly1.cif.gz_C structure of exbb pentamer from serratia marcescens by single particle cryo electron microscopy 0.8644 45 269
5zfv-assembly1.cif.gz_E structure of the exbb/exbd pentameric complex (exbb5exbd1tm) 0.8622 46 269
5zfv-assembly1.cif.gz_A structure of the exbb/exbd pentameric complex (exbb5exbd1tm) 0.8593 46 267
6tyi-assembly1.cif.gz_D exbb-exbd complex in msp1e3d1 nanodisc 0.8588 46 267
ID Description Score Start End Superfamily
af_Q9XV49_1_95_1.20.5.170 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7076 161 257 1.20.5.170
af_P43556_1_207_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6812 154 267 1.20.1270.60
af_Q9XV49_1_95_1.20.5.170 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6632 161 257 1.20.5.170
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.6356 152 266 1.20.58.220
1w0kG00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.6303 161 263 1.10.287.80
ID Description Score Start End GO Terms
AF-A0A1F5VRD1-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.9659 45 270 GO:0005886
GO:0017038
AF-S0G6Y5-F1-model_v4 Cell division and transport-associated protein TolQ 0.9631 36 269 GO:0005886
GO:0017038
GO:0043213
GO:0051301
AF-A0A1F5VRD1-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.9573 45 270 GO:0005886
GO:0017038
AF-A0A7Y5R0A0-F1-model_v4 MotA/TolQ/ExbB proton channel family protein 0.946 152 267 GO:0005886
GO:0017038
AF-A0A3N5KVJ8-F1-model_v4 Flagellar motor protein MotA 0.9455 153 269 GO:0005886
GO:0017038

Map