F410168

General Info

Members Datasets Scaffolds Average Seq Length
330 180 305 408

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10000217|Ga0307507_1000021721
Length 444
Sequence LLTRDLCMRGGFFVLIFLNNTHNSATLATQLYTIMTDATAAKATRNMIFLVLVASLGYFVDIYDLLIFSIVRVQSLKDIGVPGAELLAKGQFIINVQMFGLLLGGILWGIIGDKLGRIKVLFGSILLYSIANFANGLVTDVNTYAIIRFIAGIGLAGELGAGITLVSETLSKEKRGYGTMIVAVIGLFGAVAAVNVAKYGWQRAYFVGGGLGILLLLLRIGTFESGMFKNVEQSKVSKGNMLILFTSWTRFKKYLFCILIGAPLWYVVGILVTFSPEFGVALHSKGTLSAGTGVLYTYIGISVGDMFAGLLAQVTKSRKLTMAVFLLASVGSVVYYLRAFGLSSQQFVWICFFMGCSVGYWATFVTIAAEQFGTNIRSTVTTTVPNFVRGALIPITFAFNAFKINYGMITSGYIMMGILTIIALLSLSQLKETFGKDLDYVEIS

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2739367663 Pedobacter sp. YR510 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
10 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
11 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
12 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
13 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
14 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
15 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
18 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
19 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
20 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
21 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
126 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
127 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
168 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0.3
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 0.61
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000149 3300001990 Bacteria 21865
2 JGI24737J22298_10003922 3300001990 Bacteria 5213
3 JGI24735J21928_10000014 3300002067 Bacteria 186670
4 JGI24735J21928_10007271 3300002067 Bacteria 3613
5 JGI25162J39368_1001098 3300002737 Bacteria 16423
6 JGI25164J39214_1002602 3300002772 Bacteria 2659
7 JGI25165J46597_1000898 3300003214 Bacteria 20764
8 rootH1_10025788 3300003316 Bacteria 15296
9 rootH2_10017200 3300003320 Bacteria 3451
10 rootH2_10025162 3300003320 Bacteria 10672
11 rootH2_10059243 3300003320 Bacteria 9365
12 rootH2_10168193 3300003320 Bacteria 1573
13 rootH2_10303474 3300003320 Bacteria 1623
14 rootL2_10318965 3300003322 Unclassified 2565
15 rootH1_10012846 3300003323 Bacteria 47357
16 rootH1_10023987 3300003323 Bacteria 12102
17 rootH1_10042286 3300003323 Bacteria 33290
18 rootH1_10210078 3300003323 Bacteria 3783
19 rootH1_10263386 3300003323 Bacteria 2334
20 Ga0058863_10025409 3300004799 Bacteria 3270
21 Ga0065704_10001670 3300005289 Bacteria 6924
22 Ga0070658_10000011 3300005327 Bacteria 294396
23 Ga0070658_10032672 3300005327 Bacteria 4184
24 Ga0070676_10000615 3300005328 Bacteria 17358
25 Ga0070683_100242356 3300005329 Bacteria 1715
26 Ga0070670_100018940 3300005331 Bacteria 5903
27 Ga0068869_100034568 3300005334 Bacteria 3576
28 Ga0070680_100002502 3300005336 Bacteria 13614
29 Ga0068868_100060727 3300005338 Bacteria 2994
30 Ga0068868_100065812 3300005338 Unclassified 2880
31 Ga0070660_100007712 3300005339 Bacteria 7503
32 Ga0070660_100169523 3300005339 Bacteria 1763
33 Ga0070669_100015966 3300005353 Bacteria 5357
34 Ga0070675_100016377 3300005354 Bacteria 5885
35 Ga0070671_100001785 3300005355 Bacteria 16335
36 Ga0070671_100199584 3300005355 Bacteria 1696
37 Ga0070674_100025313 3300005356 Bacteria 3862
38 Ga0070674_100126071 3300005356 Bacteria 1902
39 Ga0070673_100008914 3300005364 Bacteria 6705
40 Ga0070673_100009985 3300005364 Bacteria 6402
41 Ga0070659_100000383 3300005366 Bacteria 33558
42 Ga0070659_100009256 3300005366 Bacteria 7231
43 Ga0070659_100207142 3300005366 Bacteria 1615
44 Ga0070714_100000121 3300005435 Bacteria 62487
45 Ga0070678_100000605 3300005456 Bacteria 17659
46 Ga0070678_100001439 3300005456 Bacteria 12682
47 Ga0070681_10005612 3300005458 Bacteria 12126
48 Ga0070681_10023791 3300005458 Bacteria 6166
49 Ga0068867_100030943 3300005459 Bacteria 3862
50 Ga0070679_100002080 3300005530 Bacteria 18017
51 Ga0070679_100265788 3300005530 Unclassified 1670
52 Ga0068853_100121367 3300005539 Bacteria 2332
53 Ga0070665_100000003 3300005548 Bacteria 811857
54 Ga0070665_100023914 3300005548 Bacteria 6154
55 Ga0068855_100000042 3300005563 Bacteria 149332
56 Ga0068855_100000652 3300005563 Bacteria 42351
57 Ga0068855_100075442 3300005563 Bacteria 3915
58 Ga0068855_100159315 3300005563 Bacteria 2563
59 Ga0068857_100019150 3300005577 Bacteria 6008
60 Ga0068854_100068828 3300005578 Bacteria 2582
61 Ga0068856_100001806 3300005614 Bacteria 22338
62 Ga0068856_100007300 3300005614 Bacteria 10786
63 Ga0068852_100003871 3300005616 Bacteria 10512
64 Ga0068852_100004264 3300005616 Bacteria 10099
65 Ga0068852_100068727 3300005616 Bacteria 3102
66 Ga0068861_100122965 3300005719 Bacteria 2096
67 Ga0068870_10042154 3300005840 Bacteria 2375
68 Ga0068860_100020993 3300005843 Bacteria 6328
69 Ga0068860_100027319 3300005843 Bacteria 5498
70 Ga0068860_100030725 3300005843 Bacteria 5165
71 Ga0075366_10003891 3300006195 Bacteria 7960
72 Ga0075366_10005187 3300006195 Bacteria 7050
73 Ga0075366_10080033 3300006195 Bacteria 1951
74 Ga0097621_100000020 3300006237 Bacteria 86226
75 Ga0075370_10115986 3300006353 Bacteria 1557
76 Ga0068865_100000208 3300006881 Bacteria 32611
77 Ga0068865_100003471 3300006881 Bacteria 9444
78 Ga0105240_10000068 3300009093 Bacteria 207756
79 Ga0105240_10004490 3300009093 Bacteria 21219
80 Ga0105240_10008915 3300009093 Bacteria 14261
81 Ga0105240_10052535 3300009093 Bacteria 5122
82 Ga0105240_10072132 3300009093 Bacteria 4269
83 Ga0105240_10123403 3300009093 Bacteria 3116
84 Ga0105245_10000039 3300009098 Bacteria 144455
85 Ga0114129_10004976 3300009147 Bacteria 18722
86 Ga0105243_10000008 3300009148 Bacteria 390270
87 Ga0105241_10050286 3300009174 Bacteria 3176
88 Ga0105241_10146750 3300009174 Bacteria 1926
89 Ga0105242_10054010 3300009176 Bacteria 3283
90 Ga0105237_10000274 3300009545 Bacteria 72354
91 Ga0105237_10000356 3300009545 Bacteria 64629
92 Ga0105237_10001524 3300009545 Bacteria 30382
93 Ga0105237_10018786 3300009545 Bacteria 7149
94 Ga0105237_10029647 3300009545 Bacteria 5559
95 Ga0105237_10043584 3300009545 Bacteria 4519
96 Ga0105237_10059768 3300009545 Bacteria 3813
97 Ga0105237_10072274 3300009545 Bacteria 3443
98 Ga0105237_10089313 3300009545 Bacteria 3071
99 Ga0105238_10127083 3300009551 Bacteria 2528
100 Ga0105249_10171171 3300009553 Bacteria 2106
101 Ga0105239_10000002 3300010375 Bacteria 610298
102 Ga0105239_10000010 3300010375 Bacteria 341545
103 Ga0105239_10000081 3300010375 Bacteria 133686
104 Ga0105239_10000259 3300010375 Bacteria 78760
105 Ga0105239_10008945 3300010375 Bacteria 11330
106 Ga0105239_10009537 3300010375 Bacteria 10924
107 Ga0105239_10064006 3300010375 Bacteria 4037
108 Ga0105239_10064326 3300010375 Bacteria 4027
109 Ga0157373_10000328 3300013100 Bacteria 38459
110 Ga0157373_10017756 3300013100 Bacteria 5180
111 Ga0157371_10001189 3300013102 Bacteria 27874
112 Ga0157371_10004714 3300013102 Bacteria 11787
113 Ga0157370_10003472 3300013104 Bacteria 18497
114 Ga0157370_10006363 3300013104 Bacteria 13036
115 Ga0157370_10049689 3300013104 Bacteria 4013
116 Ga0157370_10100295 3300013104 Bacteria 2713
117 Ga0157370_10262859 3300013104 Bacteria 1595
118 Ga0157369_10000039 3300013105 Bacteria 188947
119 Ga0157369_10024387 3300013105 Bacteria 6729
120 Ga0157374_10000723 3300013296 Bacteria 28842
121 Ga0157374_10001085 3300013296 Bacteria 23473
122 Ga0157374_10014348 3300013296 Bacteria 6934
123 Ga0157374_10032111 3300013296 Bacteria 4779
124 Ga0157374_10201826 3300013296 Bacteria 1947
125 Ga0157378_10022162 3300013297 Bacteria 5590
126 Ga0157378_10046031 3300013297 Bacteria 3879
127 Ga0157378_10081516 3300013297 Bacteria 2924
128 Ga0157378_10169076 3300013297 Bacteria 2049
129 Ga0163162_10000066 3300013306 Bacteria 100009
130 Ga0163162_10001561 3300013306 Bacteria 21390
131 Ga0163162_10014096 3300013306 Bacteria 7812
132 Ga0157372_10000001 3300013307 Bacteria 791349
133 Ga0157372_10000372 3300013307 Bacteria 49527
134 Ga0157372_10008550 3300013307 Bacteria 10871
135 Ga0157372_10012004 3300013307 Bacteria 9225
136 Ga0157372_10017132 3300013307 Bacteria 7778
137 Ga0157372_10173239 3300013307 Bacteria 2497
138 Ga0157375_10137633 3300013308 Bacteria 2567
139 Ga0157375_10323109 3300013308 Bacteria 1708
140 Ga0157375_10431687 3300013308 Bacteria 1483
141 Ga0157376_10014674 3300014969 Bacteria 5890
142 Ga0163161_10040522 3300017792 Bacteria 3346
143 Ga0207427_100163 3300025231 Bacteria 74501
144 Ga0209437_100085 3300025233 Bacteria 254790
145 Ga0209437_100101 3300025233 Bacteria 226668
146 Ga0209026_1000361 3300025250 Bacteria 42722
147 Ga0209026_1009133 3300025250 Bacteria 1984
148 Ga0209129_1011397 3300025258 Bacteria 2127
149 Ga0209233_1000124 3300025261 Bacteria 226743
150 Ga0207647_10001459 3300025904 Bacteria 18183
151 Ga0207647_10007654 3300025904 Bacteria 7784
152 Ga0207645_10000544 3300025907 Bacteria 31399
153 Ga0207645_10000571 3300025907 Bacteria 30525
154 Ga0207705_10000015 3300025909 Bacteria 382901
155 Ga0207705_10031784 3300025909 Bacteria 3770
156 Ga0207705_10183530 3300025909 Bacteria 1580
157 Ga0207707_10035960 3300025912 Bacteria 4330
158 Ga0207707_10103854 3300025912 Bacteria 2484
159 Ga0207695_10000131 3300025913 Bacteria 223762
160 Ga0207695_10002296 3300025913 Bacteria 28532
161 Ga0207695_10033899 3300025913 Bacteria 5559
162 Ga0207695_10040836 3300025913 Bacteria 4969
163 Ga0207671_10000993 3300025914 Bacteria 34894
164 Ga0207671_10008174 3300025914 Bacteria 8923
165 Ga0207671_10008258 3300025914 Bacteria 8857
166 Ga0207671_10012593 3300025914 Bacteria 6793
167 Ga0207671_10016716 3300025914 Bacteria 5693
168 Ga0207671_10025886 3300025914 Bacteria 4402
169 Ga0207671_10049165 3300025914 Bacteria 3121
170 Ga0207660_10009376 3300025917 Bacteria 6335
171 Ga0207657_10035452 3300025919 Bacteria 4474
172 Ga0207657_10073849 3300025919 Bacteria 2881
173 Ga0207652_10000090 3300025921 Bacteria 99245
174 Ga0207652_10001292 3300025921 Bacteria 22268
175 Ga0207652_10003351 3300025921 Bacteria 13240
176 Ga0207681_10070629 3300025923 Bacteria 2432
177 Ga0207694_10023039 3300025924 Bacteria 4726
178 Ga0207687_10000022 3300025927 Bacteria 223060
179 Ga0207664_10000112 3300025929 Bacteria 71450
180 Ga0207644_10051432 3300025931 Bacteria 2957
181 Ga0207690_10003441 3300025932 Bacteria 9445
182 Ga0207690_10007925 3300025932 Bacteria 6307
183 Ga0207706_10147325 3300025933 Bacteria 2071
184 Ga0207709_10000006 3300025935 Bacteria 800946
185 Ga0207704_10000209 3300025938 Bacteria 29657
186 Ga0207689_10000939 3300025942 Bacteria 28012
187 Ga0207667_10000037 3300025949 Bacteria 297252
188 Ga0207667_10000323 3300025949 Bacteria 66327
189 Ga0207667_10001001 3300025949 Bacteria 36044
190 Ga0207667_10009578 3300025949 Bacteria 11400
191 Ga0207667_10148786 3300025949 Bacteria 2410
192 Ga0207667_10201289 3300025949 Bacteria 2043
193 Ga0207651_10021531 3300025960 Bacteria 3921
194 Ga0207677_10059456 3300026023 Bacteria 2636
195 Ga0207639_10014946 3300026041 Bacteria 5469
196 Ga0207639_10030522 3300026041 Bacteria 3953
197 Ga0207702_10000820 3300026078 Bacteria 32858
198 Ga0207648_10002203 3300026089 Bacteria 21158
199 Ga0207648_10004149 3300026089 Bacteria 14992
200 Ga0207674_10001708 3300026116 Bacteria 28109
201 Ga0207674_10121173 3300026116 Bacteria 2583
202 Ga0207675_100086472 3300026118 Bacteria 2944
203 Ga0207683_10000535 3300026121 Bacteria 35178
204 Ga0207683_10002255 3300026121 Bacteria 16919
205 Ga0207698_10002540 3300026142 Bacteria 10837
206 Ga0207698_10002554 3300026142 Bacteria 10802
207 Ga0268266_10000052 3300028379 Bacteria 296230
208 Ga0268264_10035514 3300028381 Bacteria 4104
209 Ga0268264_10038113 3300028381 Bacteria 3965
210 Ga0307517_10005359 3300028786 Bacteria 19372
211 Ga0307515_10000432 3300028794 Bacteria 100348
212 Ga0307515_10134442 3300028794 Bacteria 2699
213 Ga0307515_10136445 3300028794 Bacteria 2664
214 Ga0316177_1194820 3300030731 Bacteria 10470
215 Ga0316176_1082773 3300030732 Bacteria 7323
216 Ga0316183_1111132 3300030742 Bacteria 56687
217 Ga0316181_1060144 3300030744 Bacteria 1381
218 Ga0316181_1162796 3300030744 Bacteria 20295
219 Ga0307513_10020220 3300031456 Bacteria 7899
220 Ga0307507_10000217 3300033179 Bacteria 109884
221 Ga0307510_10016554 3300033180 Bacteria 8704
222 Ga0395899_0000001 3300037312 Bacteria 1750322
223 Ga0395899_0000608 3300037312 Bacteria 37382
224 Ga0395899_0034235 3300037312 Bacteria 3814
225 Ga0395900_0000330 3300037418 Bacteria 69819
226 Ga0395900_0002720 3300037418 Bacteria 19323
227 Ga0395900_0027191 3300037418 Bacteria 5858
228 Ga0395900_0102675 3300037418 Bacteria 2937
229 Ga0395898_0001101 3300037466 Bacteria 41709
230 Ga0395898_0229831 3300037466 Bacteria 1769
231 Ga0395898_0280841 3300037466 Bacteria 1588
232 Ga0395905_0000301 3300037471 Bacteria 72121
233 Ga0395905_0010559 3300037471 Bacteria 8970
234 Ga0395901_0002979 3300038443 Bacteria 17081
235 Ga0395901_0007093 3300038443 Bacteria 11329
236 Ga0395901_0021819 3300038443 Bacteria 6564
237 Ga0395901_0137874 3300038443 Bacteria 2564
238 Ga0395901_0340966 3300038443 Bacteria 1548
239 Ga0395901_0393627 3300038443 Bacteria 1424
240 Ga0451577_0001423 3300042876 Bacteria 31912
241 Ga0451577_0008338 3300042876 Bacteria 10083
242 Ga0466961_0132030 3300044693 Bacteria 1565
243 Ga0453684_0000024 3300044712 Bacteria 819351
244 Ga0453684_0011767 3300044712 Bacteria 14586
245 Ga0466957_0000776 3300044842 Bacteria 16313
246 Ga0495592_0213931 3300046454 Unclassified 1293
247 Ga0495650_0000003 3300046471 Bacteria 900730
248 Ga0495585_0000085 3300046492 Bacteria 97836
249 Ga0495606_0000145 3300046507 Bacteria 122857
250 Ga0495606_0008880 3300046507 Bacteria 8610
251 Ga0495606_0014997 3300046507 Bacteria 6007
252 Ga0495606_0025458 3300046507 Bacteria 4237
253 Ga0495610_0003550 3300046512 Bacteria 12080
254 Ga0495616_0022008 3300046513 Bacteria 3445
255 Ga0495631_0005644 3300046518 Bacteria 6528
256 Ga0495631_0076847 3300046518 Bacteria 1441
257 Ga0495644_0039720 3300046523 Unclassified 1774
258 Ga0495648_0008324 3300046524 Bacteria 8176
259 Ga0495648_0094248 3300046524 Bacteria 1668
260 Ga0495609_0004504 3300046538 Bacteria 7600
261 Ga0495633_0000014 3300046558 Bacteria 261742
262 Ga0495633_0004452 3300046558 Bacteria 8909
263 Ga0495668_0000003 3300046616 Bacteria 695023
264 Ga0495668_0000108 3300046616 Bacteria 132593
265 Ga0495625_0000005 3300046660 Bacteria 596135
266 Ga0495625_0003490 3300046660 Bacteria 15592
267 Ga0495625_0005138 3300046660 Bacteria 12082
268 Ga0495625_0044923 3300046660 Bacteria 3196
269 Ga0495625_0062022 3300046660 Bacteria 2643
270 Ga0495661_0002958 3300046665 Bacteria 12832
271 Ga0495661_0005475 3300046665 Bacteria 9006
272 Ga0495649_0000003 3300046694 Bacteria 880817
273 Ga0495683_0055331 3300047323 Bacteria 1975
274 Ga0495687_034816 3300047443 Bacteria 2270
275 Ga0495686_0000788 3300047472 Bacteria 41315
276 Ga0495686_0001067 3300047472 Bacteria 32642
277 Ga0495686_0004353 3300047472 Bacteria 11693
278 Ga0495686_0024816 3300047472 Unclassified 3934
279 Ga0496114_0170726 3300048917 Bacteria 1895
280 Ga0496116_0005693 3300048919 Bacteria 11462
281 Ga0496117_0003387 3300048920 Bacteria 18574
282 Ga0496118_0115899 3300048921 Bacteria 1762
283 Ga0496122_0026876 3300048925 Bacteria 4942
284 Ga0496126_0190631 3300048929 Unclassified 1737
285 Ga0501034_0157257 3300049571 Bacteria 2246
286 Ga0501043_0262394 3300049579 Unclassified 1328
287 Ga0501208_000631 3300049655 Bacteria 2909
288 Ga0501238_004021 3300049671 Unclassified 1823
289 Ga0501241_008128 3300049758 Unclassified 1919
290 Ga0501269_001004 3300049766 Bacteria 4035
291 Ga0501035_0311715 3300049822 Unclassified 1324
292 Ga0501044_0163537 3300049823 Unclassified 2201
293 nmdc:mga0k408_1545_c1 3300050493 Bacteria 12427
294 nmdc:mga0k408_16_c1 3300050493 Bacteria 19854
295 nmdc:mga0k408_204686_c1 3300050493 Bacteria 1178
296 nmdc:mga0k408_52770_c1 3300050493 Bacteria 2356
297 nmdc:mga0k408_55306_c1 3300050493 Bacteria 1991
298 nmdc:mga07m45_76738_c1 3300050496 Bacteria 1905
299 Ga0500644_0002512 3300053088 Bacteria 4581
300 Ga0500608_006646 3300053122 Bacteria 4727
301 Ga0500618_000526 3300053125 Bacteria 24101
302 Ga0500642_0008072 3300053130 Bacteria 3579
303 Ga0500642_0045283 3300053130 Bacteria 1919
304 Ga0500616_0020359 3300053153 Bacteria 3727
305 Ga0500624_000656 3300053157 Bacteria 8993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_204686_c1 nmdc:mga0k408_204686_c1_58_1104 340
2 3300005719 Ga0068861_100122965 Ga0068861_1001229652 361
3 3300005331 Ga0070670_100018940 Ga0070670_1000189404 362
4 3300005334 Ga0068869_100034568 Ga0068869_1000345683 362
5 3300005353 Ga0070669_100015966 Ga0070669_1000159663 362
6 3300005354 Ga0070675_100016377 Ga0070675_1000163773 362
7 3300005355 Ga0070671_100199584 Ga0070671_1001995842 362
8 3300005356 Ga0070674_100025313 Ga0070674_1000253133 362
9 3300005364 Ga0070673_100009985 Ga0070673_1000099855 362
10 3300005456 Ga0070678_100000605 Ga0070678_1000006059 362
11 3300005548 Ga0070665_100023914 Ga0070665_1000239147 362
12 3300005578 Ga0068854_100068828 Ga0068854_1000688282 362
13 3300005840 Ga0068870_10042154 Ga0068870_100421543 362
14 3300005843 Ga0068860_100030725 Ga0068860_1000307251 362
15 3300006881 Ga0068865_100003471 Ga0068865_1000034714 362
16 3300009176 Ga0105242_10054010 Ga0105242_100540103 362
17 3300009553 Ga0105249_10171171 Ga0105249_101711712 362
18 3300013296 Ga0157374_10014348 Ga0157374_100143486 362
19 3300013297 Ga0157378_10022162 Ga0157378_100221623 362
20 3300025907 Ga0207645_10000571 Ga0207645_1000057114 362
21 3300025923 Ga0207681_10070629 Ga0207681_100706292 362
22 3300025942 Ga0207689_10000939 Ga0207689_100009396 362
23 3300025960 Ga0207651_10021531 Ga0207651_100215312 362
24 3300026089 Ga0207648_10002203 Ga0207648_100022037 362
25 3300026118 Ga0207675_100086472 Ga0207675_1000864722 362
26 3300026121 Ga0207683_10000535 Ga0207683_100005354 362
27 3300028381 Ga0268264_10038113 Ga0268264_100381133 362
28 3300046454 Ga0495592_0213931 Ga0495592_0213931_145_1251 362
29 3300049579 Ga0501043_0262394 Ga0501043_0262394_73_1308 364
30 3300049823 Ga0501044_0163537 Ga0501044_0163537_892_2127 364
31 3300044693 Ga0466961_0132030 Ga0466961_0132030_14_1201 379
32 3300048917 Ga0496114_0170726 Ga0496114_0170726_538_1764 380
33 3300005435 Ga0070714_100000121 Ga0070714_10000012115 382
34 3300013104 Ga0157370_10262859 Ga0157370_102628591 382
35 3300025929 Ga0207664_10000112 Ga0207664_1000011227 382
36 3300037418 Ga0395900_0000330 Ga0395900_0000330_35237_36472 386
37 3300046507 Ga0495606_0008880 Ga0495606_0008880_5620_6864 386
38 3300047472 Ga0495686_0024816 Ga0495686_0024816_413_1657 386
39 3300049758 Ga0501241_008128 Ga0501241_008128_123_1361 387
40 3300028794 Ga0307515_10134442 Ga0307515_101344422 389
41 3300002737 JGI25162J39368_1001098 JGI25162J39368_10010984 390
42 3300002772 JGI25164J39214_1002602 JGI25164J39214_10026023 390
43 3300003214 JGI25165J46597_1000898 JGI25165J46597_10008984 390
44 3300009098 Ga0105245_10000039 Ga0105245_1000003920 390
45 3300025231 Ga0207427_100163 Ga0207427_1001634 390
46 3300025233 Ga0209437_100101 Ga0209437_100101222 390
47 3300025261 Ga0209233_1000124 Ga0209233_100012416 390
48 3300025927 Ga0207687_10000022 Ga0207687_10000022142 390
49 3300028786 Ga0307517_10005359 Ga0307517_1000535915 390
50 3300037418 Ga0395900_0027191 Ga0395900_0027191_2059_3255 390
51 3300038443 Ga0395901_0340966 Ga0395901_0340966_10_1206 390
52 3300049571 Ga0501034_0157257 Ga0501034_0157257_75_1310 391
53 3300005563 Ga0068855_100000652 Ga0068855_10000065230 392
54 3300006195 Ga0075366_10003891 Ga0075366_100038916 392
55 3300025949 Ga0207667_10001001 Ga0207667_1000100120 392
56 iso_pu_bacteria 2738541278 2738727002 392
57 iso_pu_bacteria 2896344016 2896345910 392
58 3300053125 Ga0500618_000526 Ga0500618_000526_19614_20846 393
59 3300006353 Ga0075370_10115986 Ga0075370_101159861 394
60 3300050496 nmdc:mga07m45_76738_c1 nmdc:mga07m45_76738_c1_538_1776 394
61 iso_pu_bacteria 2890737413 2890739787 394
62 iso_pu_bacteria 2898713307 2898715023 394
63 3300037312 Ga0395899_0034235 Ga0395899_0034235_1188_2423 395
64 3300037471 Ga0395905_0010559 Ga0395905_0010559_258_1493 395
65 3300038443 Ga0395901_0002979 Ga0395901_0002979_9560_10795 395
66 iso_pu_bacteria 2896317667 2896319872 395
67 iso_pu_bacteria 2902048731 2902049273 395
68 iso_pu_bacteria 3003233435 3003236525 395
69 3300003320 rootH2_10168193 rootH2_101681932 396
70 3300003322 rootL2_10318965 rootL2_103189652 396
71 3300005338 Ga0068868_100065812 Ga0068868_1000658123 396
72 3300005366 Ga0070659_100207142 Ga0070659_1002071421 396
73 3300005563 Ga0068855_100075442 Ga0068855_1000754422 396
74 3300005577 Ga0068857_100019150 Ga0068857_1000191501 396
75 3300005616 Ga0068852_100003871 Ga0068852_1000038715 396
76 3300005843 Ga0068860_100020993 Ga0068860_1000209933 396
77 3300005843 Ga0068860_100027319 Ga0068860_1000273194 396
78 3300009093 Ga0105240_10004490 Ga0105240_1000449015 396
79 3300009093 Ga0105240_10052535 Ga0105240_100525353 396
80 3300009545 Ga0105237_10001524 Ga0105237_100015249 396
81 3300009545 Ga0105237_10029647 Ga0105237_100296475 396
82 3300009545 Ga0105237_10072274 Ga0105237_100722742 396
83 3300010375 Ga0105239_10009537 Ga0105239_100095373 396
84 3300013104 Ga0157370_10006363 Ga0157370_100063635 396
85 3300013306 Ga0163162_10014096 Ga0163162_100140966 396
86 3300013307 Ga0157372_10017132 Ga0157372_100171324 396
87 3300025904 Ga0207647_10007654 Ga0207647_100076544 396
88 3300025913 Ga0207695_10033899 Ga0207695_100338995 396
89 3300025914 Ga0207671_10016716 Ga0207671_100167162 396
90 3300025914 Ga0207671_10025886 Ga0207671_100258863 396
91 3300025924 Ga0207694_10023039 Ga0207694_100230393 396
92 3300025949 Ga0207667_10009578 Ga0207667_100095789 396
93 3300026116 Ga0207674_10001708 Ga0207674_100017086 396
94 3300026142 Ga0207698_10002554 Ga0207698_100025545 396
95 3300028381 Ga0268264_10035514 Ga0268264_100355143 396
96 3300031456 Ga0307513_10020220 Ga0307513_100202203 396
97 3300053088 Ga0500644_0002512 Ga0500644_0002512_1938_3158 396
98 iso_pu_bacteria 2739367663 2739645135 396
99 3300005616 Ga0068852_100068727 Ga0068852_1000687273 397
100 3300009147 Ga0114129_10004976 Ga0114129_100049769 397
101 3300042876 Ga0451577_0001423 Ga0451577_0001423_18447_19694 397
102 iso_pu_bacteria 2881955468 2881957443 397
103 3300003323 rootH1_10042286 rootH1_100422864 398
104 3300042876 Ga0451577_0008338 Ga0451577_0008338_2833_4059 398
105 3300044712 Ga0453684_0000024 Ga0453684_0000024_203651_204877 398
106 iso_pu_bacteria 2721755487 2722728641 398
107 iso_pu_bacteria 2842903701 2842909491 398
108 iso_pu_bacteria 2904780799 2904784339 398
109 iso_pu_bacteria 2919177583 2919179036 398
110 3300044842 Ga0466957_0000776 Ga0466957_0000776_3478_4728 399
111 3300003323 rootH1_10023987 rootH1_100239877 400
112 3300005329 Ga0070683_100242356 Ga0070683_1002423561 400
113 3300005336 Ga0070680_100002502 Ga0070680_10000250210 400
114 3300005339 Ga0070660_100169523 Ga0070660_1001695231 400
115 3300005458 Ga0070681_10005612 Ga0070681_1000561212 400
116 3300005530 Ga0070679_100002080 Ga0070679_1000020806 400
117 3300005530 Ga0070679_100265788 Ga0070679_1002657881 400
118 3300013102 Ga0157371_10004714 Ga0157371_100047144 400
119 3300013104 Ga0157370_10003472 Ga0157370_100034721 400
120 3300013307 Ga0157372_10173239 Ga0157372_101732392 400
121 3300017792 Ga0163161_10040522 Ga0163161_100405222 400
122 3300025909 Ga0207705_10031784 Ga0207705_100317841 400
123 3300025909 Ga0207705_10183530 Ga0207705_101835301 400
124 3300025912 Ga0207707_10103854 Ga0207707_101038543 400
125 3300025917 Ga0207660_10009376 Ga0207660_100093763 400
126 3300025921 Ga0207652_10000090 Ga0207652_1000009012 400
127 3300025921 Ga0207652_10001292 Ga0207652_100012924 400
128 3300025949 Ga0207667_10000323 Ga0207667_1000032312 400
129 3300037418 Ga0395900_0002720 Ga0395900_0002720_12573_13799 400
130 3300037418 Ga0395900_0102675 Ga0395900_0102675_523_1749 400
131 3300037466 Ga0395898_0001101 Ga0395898_0001101_34018_35244 400
132 3300037466 Ga0395898_0229831 Ga0395898_0229831_481_1707 400
133 3300037466 Ga0395898_0280841 Ga0395898_0280841_295_1521 400
134 3300038443 Ga0395901_0021819 Ga0395901_0021819_786_2012 400
135 3300038443 Ga0395901_0137874 Ga0395901_0137874_115_1341 400
136 3300046616 Ga0495668_0000108 Ga0495668_0000108_100286_101512 400
137 3300047472 Ga0495686_0000788 Ga0495686_0000788_12509_13735 400
138 3300053130 Ga0500642_0045283 Ga0500642_0045283_440_1666 400
139 3300053153 Ga0500616_0020359 Ga0500616_0020359_617_1843 400
140 iso_pu_bacteria 2599185184 2599477668 400
141 iso_pu_bacteria 2852623160 2852623659 400
142 iso_pu_bacteria 2884933994 2884937438 400
143 iso_pu_bacteria 2919437846 2919441111 400
144 iso_pu_bacteria 2928078545 2928079581 400
145 iso_pu_bacteria 2928147474 2928147937 400
146 iso_pu_bacteria 2932082852 2932086786 400
147 iso_pu_bacteria 2977232053 2977232625 400
148 3300003320 rootH2_10303474 rootH2_103034742 401
149 3300013100 Ga0157373_10000328 Ga0157373_1000032819 401
150 3300013307 Ga0157372_10012004 Ga0157372_100120049 401
151 3300049671 Ga0501238_004021 Ga0501238_004021_156_1385 401
152 3300049766 Ga0501269_001004 Ga0501269_001004_2362_3591 401
153 3300049822 Ga0501035_0311715 Ga0501035_0311715_26_1258 401
154 3300053130 Ga0500642_0008072 Ga0500642_0008072_1243_2472 401
155 3300003320 rootH2_10017200 rootH2_100172003 402
156 3300003320 rootH2_10059243 rootH2_100592437 402
157 3300003323 rootH1_10263386 rootH1_102633861 402
158 3300005339 Ga0070660_100007712 Ga0070660_1000077124 402
159 3300005366 Ga0070659_100000383 Ga0070659_10000038331 402
160 3300009093 Ga0105240_10000068 Ga0105240_100000688 402
161 3300009545 Ga0105237_10000274 Ga0105237_100002748 402
162 3300010375 Ga0105239_10008945 Ga0105239_100089458 402
163 3300010375 Ga0105239_10064326 Ga0105239_100643263 402
164 3300013296 Ga0157374_10201826 Ga0157374_102018263 402
165 3300025913 Ga0207695_10000131 Ga0207695_100001318 402
166 3300025914 Ga0207671_10000993 Ga0207671_100009938 402
167 3300025919 Ga0207657_10035452 Ga0207657_100354524 402
168 3300025932 Ga0207690_10003441 Ga0207690_100034414 402
169 3300026078 Ga0207702_10000820 Ga0207702_100008206 402
170 3300030731 Ga0316177_1194820 Ga0316177_11948206 402
171 3300030732 Ga0316176_1082773 Ga0316176_10827737 402
172 3300030742 Ga0316183_1111132 Ga0316183_111113221 402
173 3300030744 Ga0316181_1060144 Ga0316181_10601441 402
174 3300030744 Ga0316181_1162796 Ga0316181_11627967 402
175 3300037312 Ga0395899_0000001 Ga0395899_0000001_1728680_1729933 402
176 3300044712 Ga0453684_0011767 Ga0453684_0011767_2793_4043 402
177 3300049655 Ga0501208_000631 Ga0501208_000631_1433_2692 402
178 3300001990 JGI24737J22298_10003922 JGI24737J22298_100039222 403
179 3300002067 JGI24735J21928_10007271 JGI24735J21928_100072712 403
180 3300005366 Ga0070659_100009256 Ga0070659_1000092563 403
181 3300005614 Ga0068856_100001806 Ga0068856_1000018066 403
182 3300013104 Ga0157370_10100295 Ga0157370_101002952 403
183 3300013296 Ga0157374_10001085 Ga0157374_1000108510 403
184 3300025250 Ga0209026_1000361 Ga0209026_100036129 403
185 3300025250 Ga0209026_1009133 Ga0209026_10091332 403
186 3300025904 Ga0207647_10001459 Ga0207647_1000145915 403
187 3300025932 Ga0207690_10007925 Ga0207690_100079257 403
188 3300025949 Ga0207667_10201289 Ga0207667_102012893 403
189 3300003316 rootH1_10025788 rootH1_100257888 404
190 3300003320 rootH2_10025162 rootH2_100251623 404
191 3300003323 rootH1_10012846 rootH1_100128466 404
192 3300003323 rootH1_10210078 rootH1_102100783 404
193 3300004799 Ga0058863_10025409 Ga0058863_100254094 404
194 3300005327 Ga0070658_10000011 Ga0070658_10000011203 404
195 3300005327 Ga0070658_10032672 Ga0070658_100326724 404
196 3300005328 Ga0070676_10000615 Ga0070676_100006156 404
197 3300005338 Ga0068868_100060727 Ga0068868_1000607273 404
198 3300005355 Ga0070671_100001785 Ga0070671_10000178515 404
199 3300005356 Ga0070674_100126071 Ga0070674_1001260712 404
200 3300005364 Ga0070673_100008914 Ga0070673_1000089145 404
201 3300005456 Ga0070678_100001439 Ga0070678_10000143910 404
202 3300005458 Ga0070681_10023791 Ga0070681_100237916 404
203 3300005459 Ga0068867_100030943 Ga0068867_1000309435 404
204 3300005539 Ga0068853_100121367 Ga0068853_1001213671 404
205 3300005548 Ga0070665_100000003 Ga0070665_100000003488 404
206 3300005563 Ga0068855_100000042 Ga0068855_10000004291 404
207 3300005563 Ga0068855_100159315 Ga0068855_1001593152 404
208 3300005614 Ga0068856_100007300 Ga0068856_1000073008 404
209 3300005616 Ga0068852_100004264 Ga0068852_1000042644 404
210 3300006195 Ga0075366_10005187 Ga0075366_100051878 404
211 3300006237 Ga0097621_100000020 Ga0097621_10000002016 404
212 3300006881 Ga0068865_100000208 Ga0068865_10000020810 404
213 3300009093 Ga0105240_10008915 Ga0105240_100089152 404
214 3300009093 Ga0105240_10072132 Ga0105240_100721322 404
215 3300009093 Ga0105240_10123403 Ga0105240_101234033 404
216 3300009174 Ga0105241_10050286 Ga0105241_100502863 404
217 3300009174 Ga0105241_10146750 Ga0105241_101467502 404
218 3300009545 Ga0105237_10000356 Ga0105237_1000035633 404
219 3300009545 Ga0105237_10018786 Ga0105237_100187866 404
220 3300009545 Ga0105237_10043584 Ga0105237_100435843 404
221 3300009545 Ga0105237_10059768 Ga0105237_100597684 404
222 3300009545 Ga0105237_10089313 Ga0105237_100893133 404
223 3300009551 Ga0105238_10127083 Ga0105238_101270833 404
224 3300010375 Ga0105239_10000002 Ga0105239_10000002583 404
225 3300010375 Ga0105239_10000010 Ga0105239_10000010127 404
226 3300010375 Ga0105239_10000081 Ga0105239_1000008146 404
227 3300010375 Ga0105239_10000259 Ga0105239_1000025950 404
228 3300010375 Ga0105239_10064006 Ga0105239_100640062 404
229 3300013105 Ga0157369_10000039 Ga0157369_1000003942 404
230 3300013296 Ga0157374_10000723 Ga0157374_100007232 404
231 3300013296 Ga0157374_10032111 Ga0157374_100321114 404
232 3300013297 Ga0157378_10046031 Ga0157378_100460315 404
233 3300013297 Ga0157378_10081516 Ga0157378_100815162 404
234 3300013306 Ga0163162_10000066 Ga0163162_1000006642 404
235 3300013306 Ga0163162_10001561 Ga0163162_1000156116 404
236 3300013307 Ga0157372_10000001 Ga0157372_10000001320 404
237 3300013308 Ga0157375_10137633 Ga0157375_101376332 404
238 3300013308 Ga0157375_10323109 Ga0157375_103231091 404
239 3300013308 Ga0157375_10431687 Ga0157375_104316871 404
240 3300014969 Ga0157376_10014674 Ga0157376_100146742 404
241 3300025233 Ga0209437_100085 Ga0209437_10008530 404
242 3300025258 Ga0209129_1011397 Ga0209129_10113972 404
243 3300025907 Ga0207645_10000544 Ga0207645_100005446 404
244 3300025909 Ga0207705_10000015 Ga0207705_10000015200 404
245 3300025912 Ga0207707_10035960 Ga0207707_100359607 404
246 3300025913 Ga0207695_10002296 Ga0207695_1000229624 404
247 3300025913 Ga0207695_10040836 Ga0207695_100408364 404
248 3300025914 Ga0207671_10008174 Ga0207671_100081744 404
249 3300025914 Ga0207671_10008258 Ga0207671_100082583 404
250 3300025914 Ga0207671_10012593 Ga0207671_100125933 404
251 3300025914 Ga0207671_10049165 Ga0207671_100491653 404
252 3300025919 Ga0207657_10073849 Ga0207657_100738494 404
253 3300025921 Ga0207652_10003351 Ga0207652_100033513 404
254 3300025931 Ga0207644_10051432 Ga0207644_100514325 404
255 3300025933 Ga0207706_10147325 Ga0207706_101473252 404
256 3300025938 Ga0207704_10000209 Ga0207704_100002096 404
257 3300025949 Ga0207667_10000037 Ga0207667_10000037187 404
258 3300025949 Ga0207667_10148786 Ga0207667_101487862 404
259 3300026023 Ga0207677_10059456 Ga0207677_100594563 404
260 3300026041 Ga0207639_10014946 Ga0207639_100149465 404
261 3300026041 Ga0207639_10030522 Ga0207639_100305224 404
262 3300026089 Ga0207648_10004149 Ga0207648_1000414913 404
263 3300026121 Ga0207683_10002255 Ga0207683_100022558 404
264 3300026142 Ga0207698_10002540 Ga0207698_100025404 404
265 3300028379 Ga0268266_10000052 Ga0268266_1000005282 404
266 3300028786 Ga0307517_10005359 Ga0307517_1000535916 404
267 3300028794 Ga0307515_10000432 Ga0307515_1000043233 404
268 3300028794 Ga0307515_10136445 Ga0307515_101364452 404
269 3300033180 Ga0307510_10016554 Ga0307510_100165544 404
270 3300033180 Ga0307510_10016554 Ga0307510_100165545 404
271 3300037312 Ga0395899_0000608 Ga0395899_0000608_26502_27740 404
272 3300037471 Ga0395905_0000301 Ga0395905_0000301_67682_68920 404
273 3300038443 Ga0395901_0007093 Ga0395901_0007093_7473_8711 404
274 3300046471 Ga0495650_0000003 Ga0495650_0000003_160827_162059 404
275 3300046492 Ga0495585_0000085 Ga0495585_0000085_70832_72064 404
276 3300046507 Ga0495606_0000145 Ga0495606_0000145_121529_122761 404
277 3300046507 Ga0495606_0014997 Ga0495606_0014997_3399_4631 404
278 3300046507 Ga0495606_0025458 Ga0495606_0025458_2205_3437 404
279 3300046512 Ga0495610_0003550 Ga0495610_0003550_6585_7817 404
280 3300046513 Ga0495616_0022008 Ga0495616_0022008_1779_3011 404
281 3300046518 Ga0495631_0005644 Ga0495631_0005644_2662_3900 404
282 3300046518 Ga0495631_0076847 Ga0495631_0076847_77_1309 404
283 3300046523 Ga0495644_0039720 Ga0495644_0039720_225_1505 404
284 3300046524 Ga0495648_0008324 Ga0495648_0008324_3798_5030 404
285 3300046524 Ga0495648_0094248 Ga0495648_0094248_61_1299 404
286 3300046538 Ga0495609_0004504 Ga0495609_0004504_1381_2613 404
287 3300046558 Ga0495633_0000014 Ga0495633_0000014_254312_255544 404
288 3300046558 Ga0495633_0004452 Ga0495633_0004452_7627_8859 404
289 3300046616 Ga0495668_0000003 Ga0495668_0000003_594341_595573 404
290 3300046660 Ga0495625_0000005 Ga0495625_0000005_277849_279081 404
291 3300046660 Ga0495625_0003490 Ga0495625_0003490_6216_7448 404
292 3300046660 Ga0495625_0005138 Ga0495625_0005138_6908_8140 404
293 3300046660 Ga0495625_0044923 Ga0495625_0044923_120_1358 404
294 3300046660 Ga0495625_0062022 Ga0495625_0062022_1002_2240 404
295 3300046665 Ga0495661_0005475 Ga0495661_0005475_5048_6280 404
296 3300046694 Ga0495649_0000003 Ga0495649_0000003_277837_279069 404
297 3300047323 Ga0495683_0055331 Ga0495683_0055331_227_1495 404
298 3300047443 Ga0495687_034816 Ga0495687_034816_62_1294 404
299 3300048929 Ga0496126_0190631 Ga0496126_0190631_385_1623 404
300 3300050493 nmdc:mga0k408_1545_c1 nmdc:mga0k408_1545_c1_10143_11390 404
301 3300050493 nmdc:mga0k408_16_c1 nmdc:mga0k408_16_c1_6504_7736 404
302 3300053122 Ga0500608_006646 Ga0500608_006646_1442_2710 404
303 3300053122 Ga0500608_006646 Ga0500608_006646_2771_4009 404
304 3300053157 Ga0500624_000656 Ga0500624_000656_6683_7918 404
305 3300013100 Ga0157373_10017756 Ga0157373_100177564 406
306 3300013102 Ga0157371_10001189 Ga0157371_1000118920 406
307 3300013104 Ga0157370_10049689 Ga0157370_100496895 406
308 3300013105 Ga0157369_10024387 Ga0157369_100243874 406
309 3300013307 Ga0157372_10000372 Ga0157372_100003724 406
310 3300038443 Ga0395901_0393627 Ga0395901_0393627_139_1389 406
311 3300047472 Ga0495686_0004353 Ga0495686_0004353_4419_5675 406
312 3300048919 Ga0496116_0005693 Ga0496116_0005693_5155_6417 411
313 3300048920 Ga0496117_0003387 Ga0496117_0003387_14150_15412 411
314 3300048921 Ga0496118_0115899 Ga0496118_0115899_361_1623 411
315 3300048925 Ga0496122_0026876 Ga0496122_0026876_30_1292 411
316 3300006195 Ga0075366_10080033 Ga0075366_100800332 418
317 3300046518 Ga0495631_0005644 Ga0495631_0005644_1279_2601 418
318 3300050493 nmdc:mga0k408_55306_c1 nmdc:mga0k408_55306_c1_297_1613 418
319 3300005289 Ga0065704_10001670 Ga0065704_100016703 419
320 3300009148 Ga0105243_10000008 Ga0105243_10000008172 419
321 3300013297 Ga0157378_10169076 Ga0157378_101690762 419
322 3300025935 Ga0207709_10000006 Ga0207709_10000006306 419
323 3300046665 Ga0495661_0002958 Ga0495661_0002958_7460_8770 423
324 3300047472 Ga0495686_0001067 Ga0495686_0001067_24562_25857 424
325 3300001990 JGI24737J22298_10000149 JGI24737J22298_1000014917 431
326 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001422 431
327 3300013307 Ga0157372_10008550 Ga0157372_100085506 431
328 3300026116 Ga0207674_10121173 Ga0207674_101211731 431
329 3300033179 Ga0307507_10000217 Ga0307507_1000021721 431
330 3300050493 nmdc:mga0k408_52770_c1 nmdc:mga0k408_52770_c1_62_1375 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

47

393

0.83

PF00083

Sugar_tr

Sugar (and other) transporter

50

251

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zha-assembly1.cif.gz_A structure of human oct3 in complex with inhibitor decynium-22 0.7848 76 416
6m2l-assembly2.cif.gz_B crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 0.7805 38 428
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.7734 40 424
7zh0-assembly1.cif.gz_A structure of human oct3 in lipid nanodisc 0.7732 36 422
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.7722 42 414
ID Description Score Start End Superfamily
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9289 89 218 1.20.1250.20
af_Q9SD00_1_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9187 38 225 1.20.1250.20
af_Q8N4F4_121_298_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9137 78 228 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9083 39 216 1.20.1250.20
af_A0A0R0GUC5_71_252_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8928 40 213 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3G3GSL4-F1-model_v4 MFS transporter 0.9745 37 430 GO:0005886
GO:0046943
AF-A0A0X8X2W9-F1-model_v4 Putative niacin/nicotinamide transporter NaiP 0.9741 74 431 GO:0005886
GO:0046943
AF-A0A1L9B9E1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9718 38 430 GO:0005886
GO:0046943
AF-A0A431MLJ6-F1-model_v4 MFS transporter 0.9716 38 428 GO:0005886
GO:0046943
AF-A0A2Z4GAJ4-F1-model_v4 MFS transporter 0.9709 39 430 GO:0005886
GO:0046943

Feature Viewer

pLDDT pTM Quality
78.69 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map