F410167

General Info

Members Datasets Scaffolds Average Seq Length
330 145 325 266

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100093853|Ga0307415_1000938532
Length 302
Sequence MTSLLQTYVSAPTPEREREIAALGPWFHNLHLPDGAQTAPGHPLGDFPAFKWREIAPHLPQDLRGWRALDIGCNAGFYTFELARRGAHVTGIDVEPLFLAQAEWAAVEFGLADRVEFHRRQVYDLAHDDASYDLVLFMGVFYHLRYPMLGLDVVAERVRRLMVFQTLTMPGSEVYAGASQDRGVMDRDDFLQPGWPKVAFIEREFAGDPTNWWAPNHACVEAMLRSSGLKVTGRPGHEIYLCEPDPQAAAWPRGRGRMELLAATGRPWLDAARAWEAEHAGAARRGEARADGVAEPRHAGGE

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2919404418 Luteibacter sp. 3190 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
126 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
127 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
128 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
129 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
130 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
135 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
136 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
137 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.52
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000834 3300003320 Bacteria 40472
2 rootH1_10061299 3300003323 Bacteria 3415
3 Ga0070676_10054732 3300005328 Bacteria 2353
4 Ga0070683_100000787 3300005329 Bacteria 23394
5 Ga0070690_100208725 3300005330 Bacteria 1362
6 Ga0070670_100015712 3300005331 Bacteria 6499
7 Ga0070680_100000072 3300005336 Bacteria 53846
8 Ga0070680_100002366 3300005336 Bacteria 13931
9 Ga0070680_100018537 3300005336 Bacteria 5501
10 Ga0070680_100033816 3300005336 Bacteria 4122
11 Ga0070660_100064505 3300005339 Bacteria 2849
12 Ga0070661_100205169 3300005344 Bacteria 1507
13 Ga0070675_100000070 3300005354 Bacteria 59599
14 Ga0070674_100395253 3300005356 Unclassified 1128
15 Ga0070688_100000028 3300005365 Bacteria 67085
16 Ga0070688_100000517 3300005365 Bacteria 19506
17 Ga0070714_100011835 3300005435 Bacteria 6933
18 Ga0070681_10001939 3300005458 Bacteria 18673
19 Ga0070681_10051125 3300005458 Bacteria 4122
20 Ga0070681_10055002 3300005458 Bacteria 3965
21 Ga0070685_10000010 3300005466 Bacteria 146946
22 Ga0070685_10000027 3300005466 Bacteria 91882
23 Ga0070685_10353853 3300005466 Bacteria 1005
24 Ga0070679_100000193 3300005530 Bacteria 49569
25 Ga0070679_100050978 3300005530 Bacteria 4122
26 Ga0070679_100056029 3300005530 Bacteria 3927
27 Ga0070679_100073885 3300005530 Bacteria 3400
28 Ga0070684_100037784 3300005535 Bacteria 4144
29 Ga0070684_100055777 3300005535 Bacteria 3446
30 Ga0068853_100012274 3300005539 Bacteria 6966
31 Ga0070665_100000134 3300005548 Bacteria 139586
32 Ga0070665_100000770 3300005548 Bacteria 42271
33 Ga0070665_100310710 3300005548 Bacteria 1580
34 Ga0068855_100002742 3300005563 Bacteria 21688
35 Ga0068855_100029985 3300005563 Bacteria 6505
36 Ga0068855_100049337 3300005563 Bacteria 4964
37 Ga0068855_100055000 3300005563 Bacteria 4676
38 Ga0068855_100321587 3300005563 Bacteria 1710
39 Ga0068854_100013096 3300005578 Bacteria 5436
40 Ga0068856_100001373 3300005614 Bacteria 25601
41 Ga0068856_100092943 3300005614 Bacteria 3002
42 Ga0068856_100161039 3300005614 Bacteria 2254
43 Ga0068856_100376290 3300005614 Unclassified 1439
44 Ga0068852_100000022 3300005616 Bacteria 125196
45 Ga0068852_100218659 3300005616 Bacteria 1811
46 Ga0070717_10000008 3300006028 Bacteria 299056
47 Ga0070712_100049709 3300006175 Bacteria 2913
48 Ga0075427_10002274 3300006194 Bacteria 2561
49 Ga0075428_100009586 3300006844 Bacteria 10754
50 Ga0075430_100227940 3300006846 Bacteria 1545
51 Ga0075431_100290996 3300006847 Unclassified 1652
52 Ga0068865_100000040 3300006881 Bacteria 72979
53 Ga0105240_10034481 3300009093 Bacteria 6527
54 Ga0105240_10047290 3300009093 Bacteria 5445
55 Ga0105240_10707966 3300009093 Unclassified 1099
56 Ga0111539_10140418 3300009094 Bacteria 2828
57 Ga0114129_10015645 3300009147 Bacteria 10789
58 Ga0105241_10594171 3300009174 Bacteria 999
59 Ga0105248_10000037 3300009177 Bacteria 180751
60 Ga0105237_10032594 3300009545 Bacteria 5275
61 Ga0105237_10133635 3300009545 Bacteria 2476
62 Ga0105237_10185317 3300009545 Bacteria 2081
63 Ga0105238_10335297 3300009551 Bacteria 1500
64 Ga0157373_10184927 3300013100 Bacteria 1468
65 Ga0157371_10002779 3300013102 Bacteria 16418
66 Ga0157370_10080917 3300013104 Bacteria 3058
67 Ga0157369_10000051 3300013105 Bacteria 165672
68 Ga0157369_10119431 3300013105 Bacteria 2798
69 Ga0157378_10003336 3300013297 Bacteria 14284
70 Ga0157372_10009584 3300013307 Bacteria 10294
71 Ga0157372_10120237 3300013307 Bacteria 3016
72 Ga0157372_10195735 3300013307 Unclassified 2342
73 Ga0157372_10257492 3300013307 Bacteria 2026
74 Ga0157372_10347404 3300013307 Bacteria 1728
75 Ga0157372_10427682 3300013307 Bacteria 1543
76 Ga0157372_11070254 3300013307 Bacteria 933
77 Ga0213875_10000022 3300021388 Bacteria 215075
78 Ga0209676_1001855 3300025292 Bacteria 17419
79 Ga0209025_1071106 3300025294 Bacteria 1235
80 Ga0207645_10022106 3300025907 Bacteria 4142
81 Ga0207707_10000481 3300025912 Bacteria 41355
82 Ga0207707_10005642 3300025912 Bacteria 10953
83 Ga0207707_10258388 3300025912 Bacteria 1512
84 Ga0207695_10020139 3300025913 Bacteria 7651
85 Ga0207695_10137702 3300025913 Bacteria 2393
86 Ga0207671_10019404 3300025914 Bacteria 5198
87 Ga0207671_10223908 3300025914 Bacteria 1474
88 Ga0207693_10057294 3300025915 Bacteria 3054
89 Ga0207660_10000679 3300025917 Bacteria 22750
90 Ga0207660_10001424 3300025917 Bacteria 16048
91 Ga0207660_10006106 3300025917 Bacteria 7822
92 Ga0207660_10246396 3300025917 Bacteria 1409
93 Ga0207657_10042267 3300025919 Bacteria 4023
94 Ga0207652_10001248 3300025921 Bacteria 22669
95 Ga0207652_10003955 3300025921 Bacteria 12117
96 Ga0207652_10050006 3300025921 Bacteria 3581
97 Ga0207694_10081956 3300025924 Bacteria 2535
98 Ga0207650_10010388 3300025925 Bacteria 6384
99 Ga0207659_10000018 3300025926 Bacteria 156920
100 Ga0207664_10107349 3300025929 Bacteria 2316
101 Ga0207704_10000079 3300025938 Bacteria 58183
102 Ga0207711_10000011 3300025941 Bacteria 518817
103 Ga0207661_10000516 3300025944 Bacteria 24975
104 Ga0207661_10017606 3300025944 Bacteria 5293
105 Ga0207667_10103868 3300025949 Bacteria 2930
106 Ga0207667_10209385 3300025949 Bacteria 1999
107 Ga0207702_10028722 3300026078 Bacteria 4624
108 Ga0207702_10036242 3300026078 Bacteria 4125
109 Ga0207702_10179104 3300026078 Bacteria 1950
110 Ga0207698_10000015 3300026142 Bacteria 207368
111 Ga0207698_10139738 3300026142 Bacteria 2084
112 Ga0268266_10000637 3300028379 Bacteria 47708
113 Ga0268266_10003144 3300028379 Bacteria 16769
114 Ga0268266_10746478 3300028379 Bacteria 944
115 Ga0316178_1030790 3300030735 Bacteria 1628
116 Ga0307408_100000003 3300031548 Bacteria 618438
117 Ga0307408_100013177 3300031548 Bacteria 5488
118 Ga0307408_100014389 3300031548 Bacteria 5255
119 Ga0307408_100051435 3300031548 Bacteria 2967
120 Ga0307408_100096997 3300031548 Bacteria 2238
121 Ga0307408_100158370 3300031548 Bacteria 1796
122 Ga0307408_100405707 3300031548 Bacteria 1171
123 Ga0316576_10273739 3300031727 Bacteria 1265
124 Ga0316578_10125347 3300031728 Bacteria 1544
125 Ga0307405_10009479 3300031731 Bacteria 4993
126 Ga0307405_10014181 3300031731 Bacteria 4277
127 Ga0307405_10044771 3300031731 Bacteria 2708
128 Ga0307405_10125456 3300031731 Bacteria 1764
129 Ga0307405_10161132 3300031731 Unclassified 1589
130 Ga0307405_10477449 3300031731 Bacteria 994
131 Ga0307413_10001452 3300031824 Bacteria 9001
132 Ga0307413_10001720 3300031824 Bacteria 8556
133 Ga0307413_10002667 3300031824 Bacteria 7311
134 Ga0307413_10007928 3300031824 Bacteria 4972
135 Ga0307413_10074559 3300031824 Bacteria 2149
136 Ga0307413_10075215 3300031824 Bacteria 2143
137 Ga0307413_10199806 3300031824 Bacteria 1443
138 Ga0307413_10243471 3300031824 Bacteria 1329
139 Ga0307413_10278672 3300031824 Bacteria 1256
140 Ga0307410_10000011 3300031852 Bacteria 80087
141 Ga0307410_10002004 3300031852 Bacteria 9602
142 Ga0307410_10003242 3300031852 Bacteria 8123
143 Ga0307410_10004154 3300031852 Bacteria 7423
144 Ga0307410_10006236 3300031852 Bacteria 6417
145 Ga0307410_10012382 3300031852 Bacteria 4930
146 Ga0307410_10050292 3300031852 Bacteria 2802
147 Ga0307410_10054596 3300031852 Bacteria 2709
148 Ga0307410_10161532 3300031852 Bacteria 1679
149 Ga0307410_10324631 3300031852 Bacteria 1222
150 Ga0307406_10001974 3300031901 Bacteria 11201
151 Ga0307406_10006732 3300031901 Bacteria 6355
152 Ga0307406_10040112 3300031901 Bacteria 2909
153 Ga0307406_10062763 3300031901 Bacteria 2404
154 Ga0307406_10098148 3300031901 Bacteria 1988
155 Ga0307407_10024579 3300031903 Bacteria 3162
156 Ga0307407_10037947 3300031903 Bacteria 2665
157 Ga0307407_10066547 3300031903 Bacteria 2125
158 Ga0307407_10177454 3300031903 Bacteria 1409
159 Ga0307412_10011505 3300031911 Bacteria 5129
160 Ga0307412_10028708 3300031911 Bacteria 3484
161 Ga0307412_10030924 3300031911 Bacteria 3376
162 Ga0307412_10188379 3300031911 Bacteria 1558
163 Ga0307412_10238409 3300031911 Bacteria 1405
164 Ga0307412_10326590 3300031911 Unclassified 1223
165 Ga0307412_10347727 3300031911 Bacteria 1189
166 Ga0307409_100000045 3300031995 Bacteria 44221
167 Ga0307409_100000202 3300031995 Bacteria 23457
168 Ga0307409_100000247 3300031995 Bacteria 21734
169 Ga0307409_100000776 3300031995 Bacteria 14462
170 Ga0307409_100020531 3300031995 Bacteria 4505
171 Ga0307409_100025362 3300031995 Bacteria 4157
172 Ga0307409_100055874 3300031995 Bacteria 3051
173 Ga0307409_100056223 3300031995 Bacteria 3042
174 Ga0307409_100059277 3300031995 Bacteria 2978
175 Ga0307409_100235464 3300031995 Bacteria 1663
176 Ga0307409_100464378 3300031995 Bacteria 1225
177 Ga0307416_100000027 3300032002 Bacteria 172418
178 Ga0307416_100001545 3300032002 Bacteria 12583
179 Ga0307416_100008244 3300032002 Bacteria 6702
180 Ga0307416_100012347 3300032002 Bacteria 5750
181 Ga0307416_100020109 3300032002 Bacteria 4755
182 Ga0307416_100023115 3300032002 Bacteria 4504
183 Ga0307416_100027000 3300032002 Bacteria 4243
184 Ga0307416_100031220 3300032002 Bacteria 4007
185 Ga0307416_100039217 3300032002 Bacteria 3664
186 Ga0307416_100040993 3300032002 Bacteria 3603
187 Ga0307416_100087624 3300032002 Bacteria 2658
188 Ga0307416_100109210 3300032002 Bacteria 2432
189 Ga0307416_100163483 3300032002 Bacteria 2061
190 Ga0307414_10001655 3300032004 Bacteria 11591
191 Ga0307414_10037359 3300032004 Bacteria 3251
192 Ga0307414_10059482 3300032004 Bacteria 2698
193 Ga0307414_10081767 3300032004 Bacteria 2366
194 Ga0307414_10139756 3300032004 Bacteria 1894
195 Ga0307414_10152553 3300032004 Bacteria 1824
196 Ga0307414_10273980 3300032004 Bacteria 1415
197 Ga0307411_10005393 3300032005 Bacteria 6276
198 Ga0307411_10009788 3300032005 Bacteria 5066
199 Ga0307411_10013163 3300032005 Bacteria 4551
200 Ga0307411_10017255 3300032005 Bacteria 4107
201 Ga0307411_10054602 3300032005 Bacteria 2624
202 Ga0307411_10072506 3300032005 Bacteria 2338
203 Ga0307411_10116639 3300032005 Bacteria 1922
204 Ga0307411_10127131 3300032005 Bacteria 1855
205 Ga0307411_10129388 3300032005 Bacteria 1842
206 Ga0307411_10633437 3300032005 Unclassified 923
207 Ga0307415_100000248 3300032126 Bacteria 23334
208 Ga0307415_100002082 3300032126 Bacteria 9892
209 Ga0307415_100014331 3300032126 Bacteria 4658
210 Ga0307415_100023097 3300032126 Bacteria 3853
211 Ga0307415_100031874 3300032126 Unclassified 3402
212 Ga0307415_100033222 3300032126 Bacteria 3348
213 Ga0307415_100093853 3300032126 Bacteria 2180
214 Ga0307415_100099648 3300032126 Bacteria 2127
215 Ga0307415_100113705 3300032126 Bacteria 2014
216 Ga0307415_100172324 3300032126 Unclassified 1689
217 Ga0307415_100177696 3300032126 Bacteria 1667
218 Ga0307415_100235098 3300032126 Bacteria 1478
219 Ga0307415_100298668 3300032126 Unclassified 1333
220 Ga0307415_100508579 3300032126 Unclassified 1055
221 Ga0316584_0077358 3300036712 Bacteria 2493
222 Ga0395899_0046292 3300037312 Bacteria 3240
223 Ga0395899_0073825 3300037312 Bacteria 2493
224 Ga0395900_0078691 3300037418 Bacteria 3387
225 Ga0395898_0009011 3300037466 Bacteria 10504
226 Ga0395898_0120743 3300037466 Bacteria 2511
227 Ga0395905_0000010 3300037471 Bacteria 460729
228 Ga0395905_0000592 3300037471 Bacteria 48656
229 Ga0395905_0243720 3300037471 Bacteria 1679
230 Ga0436364_0530951 3300037853 Bacteria 215117
231 Ga0395901_0056421 3300038443 Bacteria 4085
232 Ga0395901_0283343 3300038443 Bacteria 1721
233 Ga0436365_0346827 3300039437 Bacteria 1172
234 Ga0436365_1447825 3300039437 Bacteria 2367
235 Ga0451577_0007103 3300042876 Bacteria 11040
236 Ga0451577_0308413 3300042876 Bacteria 1434
237 Ga0466972_0002002 3300044658 Bacteria 9978
238 Ga0466972_0035205 3300044658 Bacteria 2451
239 Ga0453683_0000655 3300044673 Bacteria 37122
240 Ga0466966_0067396 3300044684 Bacteria 2248
241 Ga0466966_0092654 3300044684 Bacteria 1874
242 Ga0466966_0096380 3300044684 Bacteria 1832
243 Ga0466961_0002715 3300044693 Bacteria 11002
244 Ga0466961_0047007 3300044693 Bacteria 2760
245 Ga0466961_0060182 3300044693 Bacteria 2415
246 Ga0466961_0129211 3300044693 Bacteria 1584
247 Ga0466961_0267682 3300044693 Bacteria 1047
248 Ga0466963_0043053 3300044694 Bacteria 2967
249 Ga0466963_0146822 3300044694 Bacteria 1637
250 Ga0466963_0176189 3300044694 Bacteria 1492
251 Ga0466964_0000303 3300044706 Bacteria 14520
252 Ga0453684_0002117 3300044712 Bacteria 50043
253 Ga0453684_0013175 3300044712 Bacteria 13479
254 Ga0453684_0029823 3300044712 Bacteria 7729
255 Ga0453684_0128176 3300044712 Bacteria 3050
256 Ga0453684_0213464 3300044712 Bacteria 2241
257 Ga0453684_0843489 3300044712 Unclassified 985
258 Ga0466971_0013612 3300044719 Bacteria 3575
259 Ga0466970_0001080 3300044765 Bacteria 13202
260 Ga0466957_0084989 3300044842 Bacteria 1976
261 Ga0466957_0309445 3300044842 Bacteria 1063
262 Ga0466960_0097435 3300044901 Bacteria 1509
263 Ga0466960_0122235 3300044901 Bacteria 1365
264 Ga0466959_0055045 3300045049 Bacteria 2905
265 Ga0466959_0094641 3300045049 Bacteria 2143
266 Ga0466959_0097060 3300045049 Bacteria 2112
267 Ga0466959_0167488 3300045049 Bacteria 1542
268 Ga0466959_0249509 3300045049 Bacteria 1224
269 Ga0466959_0338784 3300045049 Bacteria 1026
270 Ga0451576_0000804 3300045051 Bacteria 61506
271 Ga0451576_0001005 3300045051 Bacteria 52161
272 Ga0451576_0011057 3300045051 Bacteria 10303
273 Ga0451576_0458019 3300045051 Unclassified 1339
274 Ga0466958_0154101 3300045836 Bacteria 1450
275 Ga0466958_0244749 3300045836 Unclassified 1146
276 Ga0466958_0305306 3300045836 Bacteria 1022
277 Ga0466967_0060122 3300045976 Bacteria 3366
278 Ga0466967_0138475 3300045976 Bacteria 2265
279 Ga0466967_0146431 3300045976 Bacteria 2203
280 Ga0466967_0276788 3300045976 Bacteria 1609
281 Ga0466967_0521017 3300045976 Bacteria 1168
282 Ga0495606_0000017 3300046507 Bacteria 284549
283 Ga0495668_0200344 3300046616 Bacteria 1093
284 Ga0496100_0291690 3300048903 Bacteria 1219
285 Ga0496102_0139388 3300048905 Bacteria 2274
286 Ga0496106_0530467 3300048909 Bacteria 945
287 Ga0496109_0177655 3300048912 Bacteria 1999
288 Ga0496114_0121714 3300048917 Bacteria 2244
289 Ga0501291_033227 3300049514 Unclassified 879
290 Ga0501040_0001078 3300049576 Bacteria 17266
291 Ga0501042_0001067 3300049578 Bacteria 15685
292 Ga0501047_0192395 3300049581 Bacteria 1903
293 Ga0501047_0243775 3300049581 Bacteria 1647
294 Ga0501047_0431392 3300049581 Bacteria 1149
295 Ga0501067_0010337 3300049583 Bacteria 5164
296 Ga0501067_0229189 3300049583 Bacteria 1034
297 Ga0501070_0012644 3300049586 Bacteria 7118
298 Ga0501070_0212213 3300049586 Bacteria 1589
299 Ga0501074_0039346 3300049590 Bacteria 3425
300 Ga0501075_0000570 3300049591 Bacteria 22456
301 Ga0501077_0000348 3300049593 Bacteria 27335
302 Ga0501198_012334 3300049649 Bacteria 1285
303 Ga0501201_008791 3300049651 Bacteria 977
304 Ga0501216_013087 3300049660 Bacteria 1371
305 Ga0501242_013894 3300049674 Bacteria 993
306 Ga0501243_000028 3300049675 Bacteria 12806
307 Ga0501247_005747 3300049677 Bacteria 1389
308 Ga0501225_0002647 3300049705 Bacteria 5501
309 Ga0501225_0047251 3300049705 Bacteria 1194
310 Ga0501234_019593 3300049707 Unclassified 1074
311 Ga0501080_0006242 3300049742 Bacteria 10693
312 Ga0501263_005565 3300049760 Bacteria 1426
313 Ga0501263_026477 3300049760 Bacteria 803
314 Ga0501268_001509 3300049765 Unclassified 2915
315 Ga0501268_022780 3300049765 Bacteria 1083
316 Ga0501272_001609 3300049769 Bacteria 2162
317 Ga0501273_006478 3300049770 Bacteria 1355
318 Ga0501035_0003237 3300049822 Bacteria 15599
319 Ga0501044_0071873 3300049823 Bacteria 3518
320 nmdc:mga05p37_8468_c1 3300050507 Bacteria 12160
321 nmdc:mga06r32_165293_c1 3300050510 Bacteria 2196
322 Ga0590075_018664 3300059424 Bacteria 1717
323 Ga0590075_040170 3300059424 Bacteria 1195
324 Ga0590077_008852 3300059426 Bacteria 2060
325 Ga0501082_0001713 3300060353 Bacteria 19338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10335297 Ga0105238_103352971 230
2 3300013307 Ga0157372_10427682 Ga0157372_104276822 230
3 3300044684 Ga0466966_0092654 Ga0466966_0092654_433_1152 237
4 3300045049 Ga0466959_0167488 Ga0466959_0167488_668_1387 237
5 3300045976 Ga0466967_0060122 Ga0466967_0060122_2050_2769 237
6 3300049514 Ga0501291_033227 Ga0501291_033227_11_748 238
7 3300037312 Ga0395899_0046292 Ga0395899_0046292_2198_3022 240
8 3300037466 Ga0395898_0009011 Ga0395898_0009011_7247_8071 240
9 3300045836 Ga0466958_0305306 Ga0466958_0305306_15_752 243
10 3300048903 Ga0496100_0291690 Ga0496100_0291690_55_822 243
11 3300048912 Ga0496109_0177655 Ga0496109_0177655_459_1226 243
12 3300049581 Ga0501047_0243775 Ga0501047_0243775_26_850 243
13 3300031731 Ga0307405_10125456 Ga0307405_101254562 245
14 3300031824 Ga0307413_10243471 Ga0307413_102434712 245
15 3300031911 Ga0307412_10238409 Ga0307412_102384092 245
16 3300032126 Ga0307415_100099648 Ga0307415_1000996484 245
17 iso_pu_bacteria 2910245624 2910248549 245
18 3300044712 Ga0453684_0002117 Ga0453684_0002117_38250_39023 246
19 3300044712 Ga0453684_0843489 Ga0453684_0843489_20_793 246
20 3300032004 Ga0307414_10001655 Ga0307414_100016558 248
21 3300046507 Ga0495606_0000017 Ga0495606_0000017_144308_145069 248
22 3300049760 Ga0501263_005565 Ga0501263_005565_228_1007 248
23 iso_pu_bacteria 8003014200 8003014740 248
24 3300005614 Ga0068856_100001373 Ga0068856_10000137315 249
25 3300031548 Ga0307408_100096997 Ga0307408_1000969972 249
26 3300031852 Ga0307410_10324631 Ga0307410_103246312 249
27 3300032004 Ga0307414_10081767 Ga0307414_100817673 249
28 3300032005 Ga0307411_10116639 Ga0307411_101166392 249
29 3300037471 Ga0395905_0000592 Ga0395905_0000592_23460_24233 249
30 3300042876 Ga0451577_0007103 Ga0451577_0007103_5964_6740 249
31 3300044712 Ga0453684_0029823 Ga0453684_0029823_5823_6599 249
32 3300045051 Ga0451576_0011057 Ga0451576_0011057_7183_7959 249
33 3300046616 Ga0495668_0200344 Ga0495668_0200344_100_903 249
34 3300049765 Ga0501268_022780 Ga0501268_022780_248_1030 249
35 3300005329 Ga0070683_100000787 Ga0070683_10000078713 250
36 3300005331 Ga0070670_100015712 Ga0070670_1000157124 250
37 3300005336 Ga0070680_100018537 Ga0070680_1000185373 250
38 3300005354 Ga0070675_100000070 Ga0070675_10000007015 250
39 3300005365 Ga0070688_100000517 Ga0070688_1000005179 250
40 3300005458 Ga0070681_10055002 Ga0070681_100550022 250
41 3300005466 Ga0070685_10000010 Ga0070685_100000109 250
42 3300005535 Ga0070684_100037784 Ga0070684_1000377842 250
43 3300005535 Ga0070684_100055777 Ga0070684_1000557771 250
44 3300005548 Ga0070665_100000770 Ga0070665_10000077015 250
45 3300005616 Ga0068852_100000022 Ga0068852_10000002210 250
46 3300006175 Ga0070712_100049709 Ga0070712_1000497091 250
47 3300009093 Ga0105240_10034481 Ga0105240_100344816 250
48 3300009177 Ga0105248_10000037 Ga0105248_1000003769 250
49 3300009545 Ga0105237_10133635 Ga0105237_101336352 250
50 3300013102 Ga0157371_10002779 Ga0157371_100027797 250
51 3300013105 Ga0157369_10000051 Ga0157369_1000005151 250
52 3300013297 Ga0157378_10003336 Ga0157378_100033368 250
53 3300025912 Ga0207707_10258388 Ga0207707_102583882 250
54 3300025913 Ga0207695_10137702 Ga0207695_101377022 250
55 3300025915 Ga0207693_10057294 Ga0207693_100572941 250
56 3300025925 Ga0207650_10010388 Ga0207650_100103889 250
57 3300025926 Ga0207659_10000018 Ga0207659_1000001849 250
58 3300025941 Ga0207711_10000011 Ga0207711_10000011474 250
59 3300025944 Ga0207661_10000516 Ga0207661_1000051613 250
60 3300025944 Ga0207661_10017606 Ga0207661_100176064 250
61 3300026142 Ga0207698_10000015 Ga0207698_100000158 250
62 3300028379 Ga0268266_10003144 Ga0268266_100031449 250
63 3300031995 Ga0307409_100055874 Ga0307409_1000558743 250
64 3300044694 Ga0466963_0146822 Ga0466963_0146822_235_1008 250
65 3300044842 Ga0466957_0084989 Ga0466957_0084989_565_1362 250
66 3300044842 Ga0466957_0309445 Ga0466957_0309445_230_997 250
67 3300049583 Ga0501067_0229189 Ga0501067_0229189_57_830 250
68 3300005365 Ga0070688_100000028 Ga0070688_10000002872 251
69 3300005466 Ga0070685_10000027 Ga0070685_1000002721 251
70 3300006881 Ga0068865_100000040 Ga0068865_1000000405 251
71 3300025938 Ga0207704_10000079 Ga0207704_1000007960 251
72 3300031824 Ga0307413_10001452 Ga0307413_100014529 251
73 3300031911 Ga0307412_10347727 Ga0307412_103477272 251
74 3300032005 Ga0307411_10129388 Ga0307411_101293882 251
75 3300025292 Ga0209676_1001855 Ga0209676_10018557 252
76 3300025294 Ga0209025_1071106 Ga0209025_10711062 252
77 3300031727 Ga0316576_10273739 Ga0316576_102737391 252
78 3300031728 Ga0316578_10125347 Ga0316578_101253472 252
79 3300032002 Ga0307416_100031220 Ga0307416_1000312203 252
80 3300032126 Ga0307415_100113705 Ga0307415_1001137052 252
81 3300032126 Ga0307415_100177696 Ga0307415_1001776962 252
82 3300036712 Ga0316584_0077358 Ga0316584_0077358_520_1305 252
83 3300044673 Ga0453683_0000655 Ga0453683_0000655_33374_34168 252
84 3300049581 Ga0501047_0192395 Ga0501047_0192395_619_1401 252
85 3300049581 Ga0501047_0431392 Ga0501047_0431392_338_1108 252
86 3300049760 Ga0501263_026477 Ga0501263_026477_20_787 252
87 3300005466 Ga0070685_10353853 Ga0070685_103538531 253
88 3300013100 Ga0157373_10184927 Ga0157373_101849272 253
89 3300013307 Ga0157372_10120237 Ga0157372_101202372 253
90 3300013307 Ga0157372_10347404 Ga0157372_103474042 253
91 3300042876 Ga0451577_0308413 Ga0451577_0308413_124_903 253
92 3300044694 Ga0466963_0043053 Ga0466963_0043053_1796_2566 253
93 3300044712 Ga0453684_0213464 Ga0453684_0213464_1288_2067 253
94 3300045049 Ga0466959_0338784 Ga0466959_0338784_24_794 253
95 3300049823 Ga0501044_0071873 Ga0501044_0071873_397_1200 253
96 iso_pu_bacteria 2894414249 2894415322 253
97 3300005328 Ga0070676_10054732 Ga0070676_100547322 254
98 3300005330 Ga0070690_100208725 Ga0070690_1002087251 254
99 3300005616 Ga0068852_100218659 Ga0068852_1002186592 254
100 3300009545 Ga0105237_10185317 Ga0105237_101853173 254
101 3300025907 Ga0207645_10022106 Ga0207645_100221065 254
102 3300025914 Ga0207671_10223908 Ga0207671_102239081 254
103 3300026142 Ga0207698_10139738 Ga0207698_101397382 254
104 3300031548 Ga0307408_100158370 Ga0307408_1001583702 254
105 3300031995 Ga0307409_100464378 Ga0307409_1004643782 254
106 3300032002 Ga0307416_100163483 Ga0307416_1001634832 254
107 3300044658 Ga0466972_0035205 Ga0466972_0035205_1062_1907 254
108 3300044706 Ga0466964_0000303 Ga0466964_0000303_2810_3574 254
109 3300045976 Ga0466967_0276788 Ga0466967_0276788_813_1577 254
110 3300049591 Ga0501075_0000570 Ga0501075_0000570_15064_15846 254
111 3300049593 Ga0501077_0000348 Ga0501077_0000348_18151_18933 254
112 3300049742 Ga0501080_0006242 Ga0501080_0006242_9897_10679 254
113 3300060353 Ga0501082_0001713 Ga0501082_0001713_9831_10613 254
114 3300005563 Ga0068855_100029985 Ga0068855_1000299852 255
115 3300025949 Ga0207667_10209385 Ga0207667_102093851 255
116 3300044694 Ga0466963_0176189 Ga0466963_0176189_14_817 255
117 3300044712 Ga0453684_0013175 Ga0453684_0013175_6242_7057 255
118 3300045051 Ga0451576_0458019 Ga0451576_0458019_447_1262 255
119 3300048909 Ga0496106_0530467 Ga0496106_0530467_30_836 255
120 3300049586 Ga0501070_0212213 Ga0501070_0212213_317_1111 255
121 3300059424 Ga0590075_018664 Ga0590075_018664_172_957 255
122 3300005548 Ga0070665_100000134 Ga0070665_10000013470 256
123 3300005563 Ga0068855_100321587 Ga0068855_1003215872 256
124 3300013105 Ga0157369_10119431 Ga0157369_101194313 256
125 3300013307 Ga0157372_10195735 Ga0157372_101957351 256
126 3300028379 Ga0268266_10000637 Ga0268266_1000063736 256
127 3300031824 Ga0307413_10278672 Ga0307413_102786722 256
128 3300031852 Ga0307410_10050292 Ga0307410_100502922 256
129 3300031995 Ga0307409_100056223 Ga0307409_1000562232 256
130 3300032002 Ga0307416_100040993 Ga0307416_1000409933 256
131 3300032005 Ga0307411_10005393 Ga0307411_100053935 256
132 3300032126 Ga0307415_100298668 Ga0307415_1002986682 256
133 3300044693 Ga0466961_0060182 Ga0466961_0060182_328_1101 256
134 3300045049 Ga0466959_0094641 Ga0466959_0094641_252_1025 256
135 3300005339 Ga0070660_100064505 Ga0070660_1000645052 257
136 3300005344 Ga0070661_100205169 Ga0070661_1002051692 257
137 3300005435 Ga0070714_100011835 Ga0070714_1000118351 257
138 3300005530 Ga0070679_100073885 Ga0070679_1000738853 257
139 3300005539 Ga0068853_100012274 Ga0068853_1000122742 257
140 3300005563 Ga0068855_100049337 Ga0068855_1000493373 257
141 3300005578 Ga0068854_100013096 Ga0068854_1000130962 257
142 3300005614 Ga0068856_100161039 Ga0068856_1001610392 257
143 3300006194 Ga0075427_10002274 Ga0075427_100022742 257
144 3300006844 Ga0075428_100009586 Ga0075428_10000958611 257
145 3300006846 Ga0075430_100227940 Ga0075430_1002279401 257
146 3300006847 Ga0075431_100290996 Ga0075431_1002909962 257
147 3300009147 Ga0114129_10015645 Ga0114129_100156451 257
148 3300009174 Ga0105241_10594171 Ga0105241_105941712 257
149 3300013104 Ga0157370_10080917 Ga0157370_100809172 257
150 3300013307 Ga0157372_10257492 Ga0157372_102574922 257
151 3300025917 Ga0207660_10246396 Ga0207660_102463962 257
152 3300025919 Ga0207657_10042267 Ga0207657_100422674 257
153 3300025924 Ga0207694_10081956 Ga0207694_100819562 257
154 3300025929 Ga0207664_10107349 Ga0207664_101073492 257
155 3300025949 Ga0207667_10103868 Ga0207667_101038683 257
156 3300030735 Ga0316178_1030790 Ga0316178_10307902 257
157 3300044658 Ga0466972_0002002 Ga0466972_0002002_7537_8322 257
158 3300044684 Ga0466966_0096380 Ga0466966_0096380_614_1486 257
159 3300044693 Ga0466961_0002715 Ga0466961_0002715_1608_2480 257
160 3300044693 Ga0466961_0047007 Ga0466961_0047007_1470_2246 257
161 3300044693 Ga0466961_0129211 Ga0466961_0129211_511_1290 257
162 3300044719 Ga0466971_0013612 Ga0466971_0013612_97_873 257
163 3300044765 Ga0466970_0001080 Ga0466970_0001080_3424_4209 257
164 3300045049 Ga0466959_0055045 Ga0466959_0055045_1865_2650 257
165 3300045049 Ga0466959_0097060 Ga0466959_0097060_634_1506 257
166 3300045836 Ga0466958_0244749 Ga0466958_0244749_125_901 257
167 3300045976 Ga0466967_0138475 Ga0466967_0138475_36_824 257
168 3300048917 Ga0496114_0121714 Ga0496114_0121714_564_1349 257
169 3300049705 Ga0501225_0002647 Ga0501225_0002647_1631_2428 257
170 3300050507 nmdc:mga05p37_8468_c1 nmdc:mga05p37_8468_c1_244_1068 257
171 3300050510 nmdc:mga06r32_165293_c1 nmdc:mga06r32_165293_c1_478_1302 257
172 iso_pu_bacteria 2786546940 2788432849 257
173 iso_pu_bacteria 2919404418 2919405345 257
174 3300005336 Ga0070680_100033816 Ga0070680_1000338163 258
175 3300005458 Ga0070681_10051125 Ga0070681_100511253 258
176 3300005530 Ga0070679_100050978 Ga0070679_1000509784 258
177 3300005548 Ga0070665_100310710 Ga0070665_1003107102 258
178 3300005563 Ga0068855_100002742 Ga0068855_10000274216 258
179 3300006028 Ga0070717_10000008 Ga0070717_100000083 258
180 3300009093 Ga0105240_10047290 Ga0105240_100472902 258
181 3300009545 Ga0105237_10032594 Ga0105237_100325943 258
182 3300025912 Ga0207707_10000481 Ga0207707_1000048122 258
183 3300025913 Ga0207695_10020139 Ga0207695_100201395 258
184 3300025914 Ga0207671_10019404 Ga0207671_100194044 258
185 3300025917 Ga0207660_10000679 Ga0207660_1000067917 258
186 3300025921 Ga0207652_10001248 Ga0207652_1000124818 258
187 3300026078 Ga0207702_10028722 Ga0207702_100287225 258
188 3300028379 Ga0268266_10746478 Ga0268266_107464782 258
189 3300037312 Ga0395899_0073825 Ga0395899_0073825_1610_2392 258
190 3300037418 Ga0395900_0078691 Ga0395900_0078691_120_902 258
191 3300037466 Ga0395898_0120743 Ga0395898_0120743_1162_1944 258
192 3300038443 Ga0395901_0056421 Ga0395901_0056421_2485_3267 258
193 3300038443 Ga0395901_0283343 Ga0395901_0283343_573_1355 258
194 3300044693 Ga0466961_0267682 Ga0466961_0267682_197_1033 258
195 3300045051 Ga0451576_0000804 Ga0451576_0000804_1389_2255 258
196 3300045051 Ga0451576_0001005 Ga0451576_0001005_42092_42958 258
197 3300048905 Ga0496102_0139388 Ga0496102_0139388_1284_2090 258
198 3300049586 Ga0501070_0012644 Ga0501070_0012644_1773_2555 258
199 3300049590 Ga0501074_0039346 Ga0501074_0039346_2281_3063 258
200 3300049822 Ga0501035_0003237 Ga0501035_0003237_6157_6939 258
201 3300005356 Ga0070674_100395253 Ga0070674_1003952532 259
202 3300005530 Ga0070679_100056029 Ga0070679_1000560293 259
203 3300009094 Ga0111539_10140418 Ga0111539_101404182 259
204 3300025921 Ga0207652_10050006 Ga0207652_100500062 259
205 3300031548 Ga0307408_100013177 Ga0307408_1000131772 259
206 3300031548 Ga0307408_100014389 Ga0307408_1000143894 259
207 3300031548 Ga0307408_100405707 Ga0307408_1004057071 259
208 3300031731 Ga0307405_10044771 Ga0307405_100447712 259
209 3300031731 Ga0307405_10161132 Ga0307405_101611322 259
210 3300031731 Ga0307405_10477449 Ga0307405_104774492 259
211 3300031824 Ga0307413_10002667 Ga0307413_100026673 259
212 3300031824 Ga0307413_10007928 Ga0307413_100079284 259
213 3300031824 Ga0307413_10074559 Ga0307413_100745592 259
214 3300031824 Ga0307413_10075215 Ga0307413_100752152 259
215 3300031852 Ga0307410_10002004 Ga0307410_100020042 259
216 3300031852 Ga0307410_10003242 Ga0307410_100032421 259
217 3300031852 Ga0307410_10004154 Ga0307410_100041542 259
218 3300031852 Ga0307410_10006236 Ga0307410_100062363 259
219 3300031852 Ga0307410_10161532 Ga0307410_101615322 259
220 3300031901 Ga0307406_10006732 Ga0307406_100067321 259
221 3300031901 Ga0307406_10040112 Ga0307406_100401123 259
222 3300031901 Ga0307406_10062763 Ga0307406_100627633 259
223 3300031903 Ga0307407_10024579 Ga0307407_100245792 259
224 3300031903 Ga0307407_10066547 Ga0307407_100665472 259
225 3300031903 Ga0307407_10177454 Ga0307407_101774542 259
226 3300031911 Ga0307412_10188379 Ga0307412_101883792 259
227 3300031911 Ga0307412_10326590 Ga0307412_103265902 259
228 3300031995 Ga0307409_100000202 Ga0307409_1000002026 259
229 3300031995 Ga0307409_100000247 Ga0307409_10000024717 259
230 3300031995 Ga0307409_100000776 Ga0307409_10000077615 259
231 3300031995 Ga0307409_100025362 Ga0307409_1000253624 259
232 3300031995 Ga0307409_100235464 Ga0307409_1002354642 259
233 3300032002 Ga0307416_100001545 Ga0307416_1000015458 259
234 3300032002 Ga0307416_100008244 Ga0307416_1000082445 259
235 3300032002 Ga0307416_100012347 Ga0307416_1000123476 259
236 3300032002 Ga0307416_100020109 Ga0307416_1000201094 259
237 3300032002 Ga0307416_100087624 Ga0307416_1000876242 259
238 3300032002 Ga0307416_100109210 Ga0307416_1001092103 259
239 3300032004 Ga0307414_10037359 Ga0307414_100373593 259
240 3300032004 Ga0307414_10059482 Ga0307414_100594823 259
241 3300032004 Ga0307414_10139756 Ga0307414_101397561 259
242 3300032004 Ga0307414_10273980 Ga0307414_102739802 259
243 3300032005 Ga0307411_10009788 Ga0307411_100097881 259
244 3300032005 Ga0307411_10017255 Ga0307411_100172553 259
245 3300032005 Ga0307411_10127131 Ga0307411_101271312 259
246 3300032005 Ga0307411_10633437 Ga0307411_106334371 259
247 3300032126 Ga0307415_100000248 Ga0307415_1000002482 259
248 3300032126 Ga0307415_100002082 Ga0307415_1000020824 259
249 3300032126 Ga0307415_100031874 Ga0307415_1000318744 259
250 3300032126 Ga0307415_100033222 Ga0307415_1000332222 259
251 3300032126 Ga0307415_100235098 Ga0307415_1002350982 259
252 3300032126 Ga0307415_100508579 Ga0307415_1005085792 259
253 3300044901 Ga0466960_0097435 Ga0466960_0097435_115_918 259
254 3300049649 Ga0501198_012334 Ga0501198_012334_428_1228 259
255 3300049651 Ga0501201_008791 Ga0501201_008791_38_844 259
256 3300049660 Ga0501216_013087 Ga0501216_013087_44_850 259
257 3300049674 Ga0501242_013894 Ga0501242_013894_111_917 259
258 3300049677 Ga0501247_005747 Ga0501247_005747_106_912 259
259 3300049705 Ga0501225_0047251 Ga0501225_0047251_334_1143 259
260 3300049707 Ga0501234_019593 Ga0501234_019593_131_937 259
261 3300049765 Ga0501268_001509 Ga0501268_001509_1476_2282 259
262 3300049769 Ga0501272_001609 Ga0501272_001609_1031_1837 259
263 3300049770 Ga0501273_006478 Ga0501273_006478_419_1225 259
264 3300059426 Ga0590077_008852 Ga0590077_008852_607_1416 259
265 3300031548 Ga0307408_100000003 Ga0307408_100000003328 260
266 3300031852 Ga0307410_10000011 Ga0307410_1000001162 260
267 3300031911 Ga0307412_10030924 Ga0307412_100309242 260
268 3300031995 Ga0307409_100000045 Ga0307409_1000000452 260
269 3300032002 Ga0307416_100000027 Ga0307416_100000027135 260
270 3300032126 Ga0307415_100172324 Ga0307415_1001723242 260
271 3300037471 Ga0395905_0000010 Ga0395905_0000010_322277_323083 260
272 3300049576 Ga0501040_0001078 Ga0501040_0001078_15218_16054 260
273 3300049578 Ga0501042_0001067 Ga0501042_0001067_10106_10942 260
274 3300049583 Ga0501067_0010337 Ga0501067_0010337_3284_4069 260
275 3300049675 Ga0501243_000028 Ga0501243_000028_467_1300 260
276 3300005336 Ga0070680_100000072 Ga0070680_10000007227 261
277 3300005336 Ga0070680_100002366 Ga0070680_1000023667 261
278 3300005458 Ga0070681_10001939 Ga0070681_1000193913 261
279 3300005530 Ga0070679_100000193 Ga0070679_1000001939 261
280 3300005563 Ga0068855_100055000 Ga0068855_1000550004 261
281 3300005614 Ga0068856_100092943 Ga0068856_1000929432 261
282 3300005614 Ga0068856_100376290 Ga0068856_1003762902 261
283 3300013307 Ga0157372_10009584 Ga0157372_100095845 261
284 3300013307 Ga0157372_11070254 Ga0157372_110702542 261
285 3300021388 Ga0213875_10000022 Ga0213875_1000002230 261
286 3300025912 Ga0207707_10005642 Ga0207707_100056422 261
287 3300025917 Ga0207660_10001424 Ga0207660_1000142411 261
288 3300025917 Ga0207660_10006106 Ga0207660_100061064 261
289 3300025921 Ga0207652_10003955 Ga0207652_100039554 261
290 3300026078 Ga0207702_10036242 Ga0207702_100362424 261
291 3300031548 Ga0307408_100051435 Ga0307408_1000514352 261
292 3300031731 Ga0307405_10009479 Ga0307405_100094792 261
293 3300031731 Ga0307405_10014181 Ga0307405_100141814 261
294 3300031824 Ga0307413_10001720 Ga0307413_100017203 261
295 3300031852 Ga0307410_10012382 Ga0307410_100123822 261
296 3300031901 Ga0307406_10001974 Ga0307406_1000197410 261
297 3300031901 Ga0307406_10098148 Ga0307406_100981482 261
298 3300031903 Ga0307407_10037947 Ga0307407_100379473 261
299 3300031911 Ga0307412_10011505 Ga0307412_100115054 261
300 3300031911 Ga0307412_10028708 Ga0307412_100287082 261
301 3300031995 Ga0307409_100020531 Ga0307409_1000205313 261
302 3300032002 Ga0307416_100023115 Ga0307416_1000231153 261
303 3300032002 Ga0307416_100039217 Ga0307416_1000392173 261
304 3300032005 Ga0307411_10013163 Ga0307411_100131632 261
305 3300032005 Ga0307411_10072506 Ga0307411_100725063 261
306 3300032126 Ga0307415_100014331 Ga0307415_1000143314 261
307 3300032126 Ga0307415_100023097 Ga0307415_1000230972 261
308 3300032126 Ga0307415_100093853 Ga0307415_1000938532 261
309 3300037471 Ga0395905_0243720 Ga0395905_0243720_510_1334 261
310 3300037853 Ga0436364_0530951 Ga0436364_0530951_168004_168900 261
311 3300039437 Ga0436365_1447825 Ga0436365_1447825_861_1694 261
312 3300044684 Ga0466966_0067396 Ga0466966_0067396_1206_2039 261
313 3300044712 Ga0453684_0128176 Ga0453684_0128176_1741_2580 261
314 3300045049 Ga0466959_0249509 Ga0466959_0249509_153_980 261
315 3300045836 Ga0466958_0154101 Ga0466958_0154101_411_1238 261
316 3300045976 Ga0466967_0521017 Ga0466967_0521017_173_1036 261
317 3300026078 Ga0207702_10179104 Ga0207702_101791041 262
318 3300031824 Ga0307413_10199806 Ga0307413_101998062 262
319 3300031852 Ga0307410_10054596 Ga0307410_100545962 262
320 3300031995 Ga0307409_100059277 Ga0307409_1000592772 262
321 3300032002 Ga0307416_100027000 Ga0307416_1000270004 262
322 3300032005 Ga0307411_10054602 Ga0307411_100546022 262
323 3300044901 Ga0466960_0122235 Ga0466960_0122235_361_1203 262
324 3300059424 Ga0590075_040170 Ga0590075_040170_310_1122 262
325 3300032004 Ga0307414_10152553 Ga0307414_101525531 264
326 3300039437 Ga0436365_0346827 Ga0436365_0346827_134_961 265
327 3300003320 rootH2_10000834 rootH2_100008344 268
328 3300003323 rootH1_10061299 rootH1_100612992 268
329 3300009093 Ga0105240_10707966 Ga0105240_107079662 268
330 3300045976 Ga0466967_0146431 Ga0466967_0146431_1019_1825 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

69

161

0.93

PF13649

Methyltransf_25

Methyltransferase domain

68

162

0.91

PF13847

Methyltransf_31

Methyltransferase domain

63

176

0.87

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

47

199

0.86

PF08242

Methyltransf_12

Methyltransferase domain

69

162

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8505 61 170
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8319 61 170
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8189 53 167
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8124 54 141
2gs9-assembly1.cif.gz_B crystal structure of tt1324 from thermus thermophilis hb8 0.8075 41 169
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8838 60 126 3.40.50.150
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8726 67 160 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8539 52 148 3.40.50.150
af_A0A1D8PSY8_4_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.85 56 159 3.40.50.150
af_A0A144A060_258_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8491 67 142 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H5I9Z1-F1-model_v4 tRNA (Mo5U34)-methyltransferase 0.9719 20 265 GO:0008168
GO:0032259
AF-A0A1G2Y3U6-F1-model_v4 Methyltransferase, TIGR04290 family 0.9691 20 256 GO:0008168
GO:0032259
AF-A0A4Q2YU95-F1-model_v4 TIGR04290 family methyltransferase 0.9606 69 245 GO:0008168
GO:0032259
AF-A0A7W5Z0H6-F1-model_v4 deleted 0.96 20 245
AF-A0A2W6A0V1-F1-model_v4 TIGR04290 family methyltransferase 0.9516 20 243 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.1 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map