F410162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 206 | 660 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10199721|Ga0307410_101997212 |
| Length | 347 |
| Sequence | MEHRLPGRGPGGVDEVHPGRFQGDPRVRAVDEPRRGVCGIWYSYAMTTFELVPKGPFSLAAGAAFLEGFSSAAYRAAEAGHLHLAFVPDGEEAAAGVCLRQPDGVVTGEVSGDADPEAVRDQVARILSLDVDGSGFPDVGRRDPVVGGLQRRWPGLRPVGFCSPYEAAAWALIGHRIQMVQAARIKARMAEALGEAVDIHGDTRHAFPGPARLAGLEGFRGLFARKAENLRALGEAAMEGRLDGAWLRGLPREQALKELKQLPGIGAFSAELVLLRGAADPDHLPLHEPRLCRGAAIAYDLDEPPDREWLEERAEAWRPYRTWVVLLLRVLLEAETGDTGGTRNVAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 45 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 46 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 73 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 74 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 77 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 78 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 79 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 80 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 81 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 82 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 83 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 84 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 85 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 86 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 87 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 89 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 90 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 92 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 93 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 97 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 98 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 99 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 100 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 109 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 110 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 111 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 112 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 113 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 114 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 115 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 116 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 117 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 158 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 191 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 193 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 194 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 195 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 196 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 197 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 198 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 199 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 200 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 201 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 202 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 203 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 204 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 205 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 206 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.76 |
| Metatranscriptomes | 0 |
| Isolates | 4.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 0.61 |
| Rhizosphere | 93.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307410_10199721 | 3300031852 | Bacteria | 1526 |
| 2 | JGI25406J46586_10024471 | 3300003203 | Bacteria | 2365 |
| 3 | Ga0070658_10116347 | 3300005327 | Bacteria | 2218 |
| 4 | Ga0070670_100250237 | 3300005331 | Bacteria | 1544 |
| 5 | Ga0068869_100169520 | 3300005334 | Bacteria | 1705 |
| 6 | Ga0070687_100207798 | 3300005343 | Bacteria | 1190 |
| 7 | Ga0070661_100218350 | 3300005344 | Bacteria | 1462 |
| 8 | Ga0070668_100038127 | 3300005347 | Bacteria | 3672 |
| 9 | Ga0070675_100165953 | 3300005354 | Bacteria | 1902 |
| 10 | Ga0070667_100106456 | 3300005367 | Bacteria | 2427 |
| 11 | Ga0070709_10059933 | 3300005434 | Bacteria | 2418 |
| 12 | Ga0070709_10088751 | 3300005434 | Bacteria | 2034 |
| 13 | Ga0070714_100296340 | 3300005435 | Bacteria | 1506 |
| 14 | Ga0070714_100322150 | 3300005435 | Bacteria | 1445 |
| 15 | Ga0070711_100078606 | 3300005439 | Bacteria | 2344 |
| 16 | Ga0070708_100156243 | 3300005445 | Unclassified | 2124 |
| 17 | Ga0070708_100542914 | 3300005445 | Bacteria | 1097 |
| 18 | Ga0070662_100177070 | 3300005457 | Bacteria | 1679 |
| 19 | Ga0070681_10097308 | 3300005458 | Bacteria | 2890 |
| 20 | Ga0070706_100082097 | 3300005467 | Bacteria | 2986 |
| 21 | Ga0070707_100002704 | 3300005468 | Bacteria | 16863 |
| 22 | Ga0070707_100389204 | 3300005468 | Unclassified | 1354 |
| 23 | Ga0070698_100027321 | 3300005471 | Bacteria | 5937 |
| 24 | Ga0070699_100006400 | 3300005518 | Bacteria | 10256 |
| 25 | Ga0070697_100394770 | 3300005536 | Bacteria | 1200 |
| 26 | Ga0070665_100272502 | 3300005548 | Bacteria | 1694 |
| 27 | Ga0068855_100087061 | 3300005563 | Bacteria | 3611 |
| 28 | Ga0068852_100192674 | 3300005616 | Bacteria | 1924 |
| 29 | Ga0068866_10111399 | 3300005718 | Bacteria | 1528 |
| 30 | Ga0081538_10000666 | 3300005981 | Bacteria | 37828 |
| 31 | Ga0081538_10009370 | 3300005981 | Bacteria | 8183 |
| 32 | Ga0081538_10010501 | 3300005981 | Bacteria | 7592 |
| 33 | Ga0081538_10012760 | 3300005981 | Bacteria | 6710 |
| 34 | Ga0081538_10019997 | 3300005981 | Bacteria | 4950 |
| 35 | Ga0081538_10021410 | 3300005981 | Bacteria | 4721 |
| 36 | Ga0081538_10043374 | 3300005981 | Bacteria | 2825 |
| 37 | Ga0081538_10051417 | 3300005981 | Bacteria | 2475 |
| 38 | Ga0081540_1000058 | 3300005983 | Bacteria | 120635 |
| 39 | Ga0081540_1016764 | 3300005983 | Bacteria | 4566 |
| 40 | Ga0081539_10001200 | 3300005985 | Bacteria | 46704 |
| 41 | Ga0081539_10009068 | 3300005985 | Bacteria | 8433 |
| 42 | Ga0081539_10023038 | 3300005985 | Bacteria | 4093 |
| 43 | Ga0070717_10109397 | 3300006028 | Unclassified | 2355 |
| 44 | Ga0070717_10336240 | 3300006028 | Bacteria | 1348 |
| 45 | Ga0070712_100104677 | 3300006175 | Bacteria | 2100 |
| 46 | Ga0070712_100182873 | 3300006175 | Bacteria | 1635 |
| 47 | Ga0097621_100079783 | 3300006237 | Bacteria | 2721 |
| 48 | Ga0068871_100208080 | 3300006358 | Bacteria | 1691 |
| 49 | Ga0075436_100314896 | 3300006914 | Bacteria | 1123 |
| 50 | Ga0105251_10051138 | 3300009011 | Bacteria | 1972 |
| 51 | Ga0114129_10973909 | 3300009147 | Bacteria | 1070 |
| 52 | Ga0105243_10116578 | 3300009148 | Bacteria | 2244 |
| 53 | Ga0105241_10119972 | 3300009174 | Bacteria | 2116 |
| 54 | Ga0105249_10025759 | 3300009553 | Bacteria | 5297 |
| 55 | Ga0105249_10225326 | 3300009553 | Bacteria | 1847 |
| 56 | Ga0105246_10170987 | 3300011119 | Bacteria | 1664 |
| 57 | Ga0157373_10320721 | 3300013100 | Bacteria | 1102 |
| 58 | Ga0157370_10350508 | 3300013104 | Bacteria | 1361 |
| 59 | Ga0163162_10439576 | 3300013306 | Bacteria | 1436 |
| 60 | Ga0157379_10158645 | 3300014968 | Bacteria | 2042 |
| 61 | Ga0213875_10000327 | 3300021388 | Bacteria | 45240 |
| 62 | Ga0213875_10039603 | 3300021388 | Bacteria | 2220 |
| 63 | Ga0213875_10069945 | 3300021388 | Bacteria | 1638 |
| 64 | Ga0228598_1008669 | 3300024227 | Bacteria | 2049 |
| 65 | Ga0207426_1004073 | 3300025302 | Bacteria | 7378 |
| 66 | Ga0207653_10005436 | 3300025885 | Bacteria | 3984 |
| 67 | Ga0207692_10018471 | 3300025898 | Bacteria | 3131 |
| 68 | Ga0207692_10091299 | 3300025898 | Bacteria | 1652 |
| 69 | Ga0207688_10043311 | 3300025901 | Bacteria | 2506 |
| 70 | Ga0207699_10008814 | 3300025906 | Bacteria | 4995 |
| 71 | Ga0207684_10036177 | 3300025910 | Bacteria | 4191 |
| 72 | Ga0207693_10049688 | 3300025915 | Bacteria | 3294 |
| 73 | Ga0207693_10064201 | 3300025915 | Bacteria | 2876 |
| 74 | Ga0207693_10097666 | 3300025915 | Bacteria | 2303 |
| 75 | Ga0207693_10202335 | 3300025915 | Bacteria | 1562 |
| 76 | Ga0207663_10156400 | 3300025916 | Bacteria | 1604 |
| 77 | Ga0207663_10169915 | 3300025916 | Bacteria | 1548 |
| 78 | Ga0207649_10100554 | 3300025920 | Bacteria | 1913 |
| 79 | Ga0207646_10004604 | 3300025922 | Bacteria | 14911 |
| 80 | Ga0207646_10057371 | 3300025922 | Bacteria | 3479 |
| 81 | Ga0207646_10339538 | 3300025922 | Unclassified | 1357 |
| 82 | Ga0207700_10141043 | 3300025928 | Bacteria | 1980 |
| 83 | Ga0207700_10306156 | 3300025928 | Bacteria | 1373 |
| 84 | Ga0207706_10029334 | 3300025933 | Bacteria | 4911 |
| 85 | Ga0207686_10082900 | 3300025934 | Bacteria | 2097 |
| 86 | Ga0207665_10018623 | 3300025939 | Bacteria | 4561 |
| 87 | Ga0207665_10040016 | 3300025939 | Bacteria | 3126 |
| 88 | Ga0207691_10063612 | 3300025940 | Bacteria | 3346 |
| 89 | Ga0207711_10167661 | 3300025941 | Bacteria | 1991 |
| 90 | Ga0207689_10047112 | 3300025942 | Bacteria | 3561 |
| 91 | Ga0207689_10211736 | 3300025942 | Bacteria | 1601 |
| 92 | Ga0207661_10177497 | 3300025944 | Bacteria | 1858 |
| 93 | Ga0207651_10058578 | 3300025960 | Bacteria | 2663 |
| 94 | Ga0207677_10063817 | 3300026023 | Bacteria | 2562 |
| 95 | Ga0207678_10005582 | 3300026067 | Bacteria | 11246 |
| 96 | Ga0207708_10022868 | 3300026075 | Bacteria | 4721 |
| 97 | Ga0207641_10408214 | 3300026088 | Bacteria | 1305 |
| 98 | Ga0207674_10012584 | 3300026116 | Bacteria | 9455 |
| 99 | Ga0207675_100005038 | 3300026118 | Bacteria | 12715 |
| 100 | Ga0207675_100071371 | 3300026118 | Bacteria | 3247 |
| 101 | Ga0207683_10001498 | 3300026121 | Bacteria | 21070 |
| 102 | Ga0307408_100031112 | 3300031548 | Bacteria | 3713 |
| 103 | Ga0307408_100129649 | 3300031548 | Bacteria | 1966 |
| 104 | Ga0307405_10001619 | 3300031731 | Bacteria | 9575 |
| 105 | Ga0307405_10002645 | 3300031731 | Bacteria | 7965 |
| 106 | Ga0307405_10041145 | 3300031731 | Bacteria | 2803 |
| 107 | Ga0307405_10099956 | 3300031731 | Bacteria | 1943 |
| 108 | Ga0307413_10017281 | 3300031824 | Bacteria | 3753 |
| 109 | Ga0307413_10358446 | 3300031824 | Bacteria | 1128 |
| 110 | Ga0307413_10393234 | 3300031824 | Bacteria | 1084 |
| 111 | Ga0307410_10002747 | 3300031852 | Bacteria | 8611 |
| 112 | Ga0307410_10016351 | 3300031852 | Bacteria | 4424 |
| 113 | Ga0307410_10030242 | 3300031852 | Bacteria | 3459 |
| 114 | Ga0307410_10054311 | 3300031852 | Bacteria | 2715 |
| 115 | Ga0307410_10054523 | 3300031852 | Bacteria | 2711 |
| 116 | Ga0307406_10001203 | 3300031901 | Bacteria | 14489 |
| 117 | Ga0307406_10041076 | 3300031901 | Bacteria | 2880 |
| 118 | Ga0307407_10210043 | 3300031903 | Bacteria | 1310 |
| 119 | Ga0307412_10075329 | 3300031911 | Bacteria | 2315 |
| 120 | Ga0307412_10111158 | 3300031911 | Bacteria | 1957 |
| 121 | Ga0307409_100000303 | 3300031995 | Bacteria | 20044 |
| 122 | Ga0307409_100028288 | 3300031995 | Bacteria | 3990 |
| 123 | Ga0307409_100375598 | 3300031995 | Bacteria | 1349 |
| 124 | Ga0307416_100003404 | 3300032002 | Bacteria | 9331 |
| 125 | Ga0307416_100014630 | 3300032002 | Bacteria | 5387 |
| 126 | Ga0307416_100052573 | 3300032002 | Bacteria | 3262 |
| 127 | Ga0307416_100060549 | 3300032002 | Bacteria | 3084 |
| 128 | Ga0307416_100064856 | 3300032002 | Bacteria | 2998 |
| 129 | Ga0307416_100116806 | 3300032002 | Bacteria | 2366 |
| 130 | Ga0307416_100141771 | 3300032002 | Bacteria | 2186 |
| 131 | Ga0307416_100179789 | 3300032002 | Bacteria | 1981 |
| 132 | Ga0307416_100199074 | 3300032002 | Bacteria | 1898 |
| 133 | Ga0307414_10152289 | 3300032004 | Bacteria | 1826 |
| 134 | Ga0307414_10228001 | 3300032004 | Bacteria | 1534 |
| 135 | Ga0307411_10028434 | 3300032005 | Bacteria | 3399 |
| 136 | Ga0307415_100000530 | 3300032126 | Bacteria | 16627 |
| 137 | Ga0307415_100003358 | 3300032126 | Bacteria | 8131 |
| 138 | Ga0307415_100011060 | 3300032126 | Bacteria | 5143 |
| 139 | Ga0307415_100035866 | 3300032126 | Bacteria | 3243 |
| 140 | Ga0307415_100213117 | 3300032126 | Bacteria | 1542 |
| 141 | Ga0307415_100262368 | 3300032126 | Bacteria | 1410 |
| 142 | Ga0373959_0032856 | 3300034820 | Bacteria | 1057 |
| 143 | Ga0373938_0040073 | 3300034957 | Bacteria | 1038 |
| 144 | Ga0373926_0001940 | 3300035083 | Bacteria | 6478 |
| 145 | Ga0373934_0020550 | 3300035086 | Bacteria | 2538 |
| 146 | Ga0373944_0015936 | 3300035089 | Bacteria | 2113 |
| 147 | Ga0373923_0010313 | 3300035111 | Bacteria | 3395 |
| 148 | Ga0373923_0014290 | 3300035111 | Bacteria | 2981 |
| 149 | Ga0373936_0000865 | 3300035113 | Bacteria | 10802 |
| 150 | Ga0373945_0001180 | 3300035116 | Bacteria | 7936 |
| 151 | Ga0373945_0006175 | 3300035116 | Bacteria | 3852 |
| 152 | Ga0373954_0024842 | 3300035118 | Bacteria | 2734 |
| 153 | Ga0373954_0194320 | 3300035118 | Bacteria | 996 |
| 154 | Ga0373957_0081958 | 3300035120 | Bacteria | 1275 |
| 155 | Ga0373943_0004999 | 3300035170 | Bacteria | 5983 |
| 156 | Ga0373946_0003535 | 3300035171 | Bacteria | 5547 |
| 157 | Ga0373961_0015422 | 3300035241 | Bacteria | 1954 |
| 158 | Ga0373924_0027908 | 3300035410 | Bacteria | 2247 |
| 159 | Ga0373931_0066955 | 3300035691 | Bacteria | 1950 |
| 160 | Ga0373927_0004371 | 3300035695 | Bacteria | 9912 |
| 161 | Ga0373933_0122779 | 3300035724 | Bacteria | 1627 |
| 162 | Ga0373947_0004210 | 3300035725 | Bacteria | 8441 |
| 163 | Ga0373937_0179002 | 3300036401 | Bacteria | 1991 |
| 164 | Ga0373925_0006471 | 3300037068 | Bacteria | 8614 |
| 165 | Ga0373925_0104756 | 3300037068 | Bacteria | 2179 |
| 166 | Ga0395900_0063740 | 3300037418 | Bacteria | 3788 |
| 167 | Ga0395900_0241370 | 3300037418 | Bacteria | 1812 |
| 168 | Ga0395900_0663975 | 3300037418 | Bacteria | 978 |
| 169 | Ga0395898_0058814 | 3300037466 | Bacteria | 3741 |
| 170 | Ga0395898_0181605 | 3300037466 | Bacteria | 2011 |
| 171 | Ga0395905_0023409 | 3300037471 | Bacteria | 5837 |
| 172 | Ga0395905_0251384 | 3300037471 | Bacteria | 1651 |
| 173 | Ga0436364_0355197 | 3300037853 | Bacteria | 87848 |
| 174 | Ga0436364_0508514 | 3300037853 | Bacteria | 4022 |
| 175 | Ga0436364_0970630 | 3300037853 | Bacteria | 9888 |
| 176 | Ga0436364_0991896 | 3300037853 | Bacteria | 3398 |
| 177 | Ga0395901_0010604 | 3300038443 | Bacteria | 9335 |
| 178 | Ga0395901_0037053 | 3300038443 | Bacteria | 5044 |
| 179 | Ga0395901_0050486 | 3300038443 | Bacteria | 4321 |
| 180 | Ga0395901_0349403 | 3300038443 | Bacteria | 1526 |
| 181 | Ga0436360_0436515 | 3300039438 | Bacteria | 1312 |
| 182 | Ga0439448_0002234 | 3300042005 | Bacteria | 5230 |
| 183 | Ga0439448_0011213 | 3300042005 | Bacteria | 2669 |
| 184 | Ga0439448_0064337 | 3300042005 | Bacteria | 1216 |
| 185 | Ga0439450_001319 | 3300042008 | Bacteria | 3603 |
| 186 | Ga0439450_032240 | 3300042008 | Bacteria | 1183 |
| 187 | Ga0439455_0000248 | 3300042012 | Bacteria | 6514 |
| 188 | Ga0439455_0008275 | 3300042012 | Bacteria | 2225 |
| 189 | Ga0439463_000620 | 3300042016 | Bacteria | 9827 |
| 190 | Ga0439444_0002142 | 3300042437 | Bacteria | 2666 |
| 191 | Ga0439464_0003254 | 3300042439 | Bacteria | 4089 |
| 192 | Ga0439464_0016872 | 3300042439 | Bacteria | 1977 |
| 193 | Ga0439460_0008027 | 3300042461 | Bacteria | 2659 |
| 194 | Ga0439440_0004405 | 3300042993 | Bacteria | 2765 |
| 195 | Ga0439440_0014000 | 3300042993 | Bacteria | 1727 |
| 196 | Ga0466963_0239209 | 3300044694 | Bacteria | 1273 |
| 197 | Ga0466967_0010688 | 3300045976 | Bacteria | 6901 |
| 198 | Ga0495603_0227918 | 3300046455 | Bacteria | 1074 |
| 199 | Ga0495629_0006217 | 3300046459 | Bacteria | 8863 |
| 200 | Ga0495641_0007823 | 3300046461 | Bacteria | 6618 |
| 201 | Ga0495641_0017983 | 3300046461 | Bacteria | 3661 |
| 202 | Ga0495651_0114811 | 3300046462 | Bacteria | 1986 |
| 203 | Ga0495653_0006268 | 3300046463 | Bacteria | 9759 |
| 204 | Ga0495653_0090723 | 3300046463 | Bacteria | 2235 |
| 205 | Ga0495582_0010646 | 3300046473 | Bacteria | 5058 |
| 206 | Ga0495639_0010827 | 3300046475 | Bacteria | 3928 |
| 207 | Ga0495662_0004210 | 3300046476 | Bacteria | 7241 |
| 208 | Ga0495662_0034750 | 3300046476 | Bacteria | 2433 |
| 209 | Ga0495664_0004800 | 3300046477 | Bacteria | 7393 |
| 210 | Ga0495585_0199448 | 3300046492 | Bacteria | 1020 |
| 211 | Ga0495594_0028480 | 3300046499 | Bacteria | 3015 |
| 212 | Ga0495608_0232872 | 3300046511 | Bacteria | 1152 |
| 213 | Ga0495616_0141031 | 3300046513 | Bacteria | 1097 |
| 214 | Ga0495618_0018574 | 3300046514 | Bacteria | 4269 |
| 215 | Ga0495630_0038153 | 3300046517 | Bacteria | 3593 |
| 216 | Ga0495652_0053621 | 3300046529 | Bacteria | 3436 |
| 217 | Ga0495665_0008956 | 3300046531 | Bacteria | 5431 |
| 218 | Ga0495586_0030361 | 3300046535 | Bacteria | 2892 |
| 219 | Ga0495587_0029692 | 3300046536 | Bacteria | 3318 |
| 220 | Ga0495587_0038121 | 3300046536 | Bacteria | 2883 |
| 221 | Ga0495645_0045275 | 3300046543 | Bacteria | 3210 |
| 222 | Ga0495645_0256222 | 3300046543 | Bacteria | 1160 |
| 223 | Ga0495667_0029293 | 3300046559 | Bacteria | 3705 |
| 224 | Ga0495634_0064484 | 3300046642 | Bacteria | 2428 |
| 225 | Ga0495634_0109373 | 3300046642 | Bacteria | 1778 |
| 226 | Ga0495634_0159714 | 3300046642 | Unclassified | 1422 |
| 227 | Ga0495635_0006275 | 3300046663 | Bacteria | 8280 |
| 228 | Ga0495588_0113267 | 3300046674 | Bacteria | 1429 |
| 229 | Ga0495657_0042652 | 3300046675 | Bacteria | 3096 |
| 230 | Ga0495599_0054830 | 3300046678 | Bacteria | 2497 |
| 231 | Ga0495599_0118986 | 3300046678 | Bacteria | 1642 |
| 232 | Ga0495623_0020873 | 3300046679 | Bacteria | 4233 |
| 233 | Ga0495658_0263772 | 3300046683 | Bacteria | 1085 |
| 234 | Ga0495613_0007062 | 3300046689 | Bacteria | 8360 |
| 235 | Ga0495624_0011277 | 3300046690 | Bacteria | 6144 |
| 236 | Ga0495581_0008332 | 3300047315 | Bacteria | 6009 |
| 237 | Ga0495581_0013019 | 3300047315 | Bacteria | 4821 |
| 238 | Ga0495674_0000397 | 3300047319 | Bacteria | 39073 |
| 239 | Ga0495674_0095952 | 3300047319 | Bacteria | 2527 |
| 240 | Ga0495674_0125905 | 3300047319 | Bacteria | 2162 |
| 241 | Ga0495676_0047754 | 3300047321 | Bacteria | 3457 |
| 242 | Ga0495676_0052074 | 3300047321 | Bacteria | 3270 |
| 243 | Ga0495680_0013723 | 3300047322 | Bacteria | 7051 |
| 244 | Ga0495680_0016080 | 3300047322 | Bacteria | 6433 |
| 245 | Ga0495684_0008077 | 3300047471 | Bacteria | 8140 |
| 246 | Ga0495684_0009725 | 3300047471 | Bacteria | 7418 |
| 247 | Ga0495684_0272329 | 3300047471 | Bacteria | 1224 |
| 248 | Ga0495593_0002669 | 3300047673 | Bacteria | 10729 |
| 249 | Ga0496104_0182909 | 3300048907 | Bacteria | 2006 |
| 250 | Ga0496110_0027757 | 3300048913 | Bacteria | 4855 |
| 251 | Ga0496117_0000071 | 3300048920 | Bacteria | 242170 |
| 252 | Ga0501031_0008162 | 3300049568 | Bacteria | 6814 |
| 253 | Ga0501031_0059637 | 3300049568 | Bacteria | 2486 |
| 254 | Ga0501032_0070024 | 3300049569 | Bacteria | 2340 |
| 255 | Ga0501032_0273308 | 3300049569 | Bacteria | 1095 |
| 256 | Ga0501033_0076140 | 3300049570 | Bacteria | 2463 |
| 257 | Ga0501036_0006473 | 3300049572 | Bacteria | 9515 |
| 258 | Ga0501036_0072531 | 3300049572 | Bacteria | 2910 |
| 259 | Ga0501037_0032309 | 3300049573 | Bacteria | 3865 |
| 260 | Ga0501037_0270303 | 3300049573 | Bacteria | 1186 |
| 261 | Ga0501038_0014156 | 3300049574 | Bacteria | 7268 |
| 262 | Ga0501038_0046720 | 3300049574 | Bacteria | 3753 |
| 263 | Ga0501039_0008440 | 3300049575 | Bacteria | 7851 |
| 264 | Ga0501039_0010945 | 3300049575 | Bacteria | 6912 |
| 265 | Ga0501039_0243219 | 3300049575 | Bacteria | 1415 |
| 266 | Ga0501040_0001804 | 3300049576 | Bacteria | 13748 |
| 267 | Ga0501040_0003907 | 3300049576 | Bacteria | 9671 |
| 268 | Ga0501041_0002927 | 3300049577 | Bacteria | 9796 |
| 269 | Ga0501042_0003176 | 3300049578 | Bacteria | 10247 |
| 270 | Ga0501042_0003447 | 3300049578 | Bacteria | 9928 |
| 271 | Ga0501042_0039650 | 3300049578 | Bacteria | 3348 |
| 272 | Ga0501043_0061628 | 3300049579 | Bacteria | 2946 |
| 273 | Ga0501043_0069485 | 3300049579 | Bacteria | 2766 |
| 274 | Ga0501043_0207827 | 3300049579 | Bacteria | 1517 |
| 275 | Ga0501046_0000684 | 3300049580 | Bacteria | 32896 |
| 276 | Ga0501046_0004161 | 3300049580 | Bacteria | 13173 |
| 277 | Ga0501047_0016079 | 3300049581 | Bacteria | 7136 |
| 278 | Ga0501048_0000207 | 3300049582 | Bacteria | 38591 |
| 279 | Ga0501048_0001188 | 3300049582 | Bacteria | 19703 |
| 280 | Ga0501068_0113871 | 3300049584 | Bacteria | 1683 |
| 281 | Ga0501071_0013596 | 3300049587 | Bacteria | 5551 |
| 282 | Ga0501071_0075251 | 3300049587 | Bacteria | 2465 |
| 283 | Ga0501072_0000086 | 3300049588 | Bacteria | 68239 |
| 284 | Ga0501072_0008647 | 3300049588 | Bacteria | 7729 |
| 285 | Ga0501074_0000806 | 3300049590 | Bacteria | 19797 |
| 286 | Ga0501074_0023673 | 3300049590 | Bacteria | 4463 |
| 287 | Ga0501074_0034287 | 3300049590 | Bacteria | 3680 |
| 288 | Ga0501075_0003024 | 3300049591 | Bacteria | 11232 |
| 289 | Ga0501075_0009241 | 3300049591 | Bacteria | 6892 |
| 290 | Ga0501076_0005395 | 3300049592 | Bacteria | 9189 |
| 291 | Ga0501076_0009319 | 3300049592 | Bacteria | 7244 |
| 292 | Ga0501077_0000155 | 3300049593 | Bacteria | 38326 |
| 293 | Ga0501077_0003085 | 3300049593 | Bacteria | 10016 |
| 294 | Ga0501079_0005801 | 3300049741 | Bacteria | 9229 |
| 295 | Ga0501079_0005825 | 3300049741 | Bacteria | 9213 |
| 296 | Ga0501080_0010682 | 3300049742 | Bacteria | 8401 |
| 297 | Ga0501080_0148529 | 3300049742 | Bacteria | 2167 |
| 298 | Ga0501081_0001011 | 3300049743 | Bacteria | 16773 |
| 299 | Ga0501081_0009672 | 3300049743 | Bacteria | 6284 |
| 300 | Ga0501083_0123456 | 3300049744 | Bacteria | 1698 |
| 301 | Ga0501035_0016245 | 3300049822 | Bacteria | 6870 |
| 302 | Ga0501035_0241999 | 3300049822 | Bacteria | 1534 |
| 303 | Ga0501044_0191255 | 3300049823 | Bacteria | 2009 |
| 304 | Ga0501044_0229994 | 3300049823 | Bacteria | 1802 |
| 305 | Ga0501045_0005377 | 3300049824 | Bacteria | 8876 |
| 306 | Ga0501045_0028851 | 3300049824 | Bacteria | 4005 |
| 307 | Ga0495595_0034511 | 3300053084 | Bacteria | 2288 |
| 308 | Ga0500645_005520 | 3300053730 | Bacteria | 4639 |
| 309 | Ga0501084_0001972 | 3300054114 | Bacteria | 16389 |
| 310 | Ga0501084_0011154 | 3300054114 | Bacteria | 7444 |
| 311 | Ga0590074_006452 | 3300059423 | Bacteria | 1946 |
| 312 | Ga0590077_001000 | 3300059426 | Bacteria | 7158 |
| 313 | Ga0501082_0001276 | 3300060353 | Bacteria | 22105 |
| 314 | Ga0501082_0009010 | 3300060353 | Bacteria | 8611 |
| 315 | Ga0530510_0003234 | 3300061734 | Bacteria | 11188 |
| 316 | Ga0530510_0051662 | 3300061734 | Bacteria | 2970 |
| 317 | 2676488369 | 2675903060 | Bacteria | 10051191 |
| 318 | 2804848926 | 2802429296 | Bacteria | 7227771 |
| 319 | 2844853203 | 2844852863 | Bacteria | 3849151 |
| 320 | 2856747849 | 2856741275 | Bacteria | 8096094 |
| 321 | 2884701934 | 2884693830 | Bacteria | 11273186 |
| 322 | 2891396530 | 2891395885 | Bacteria | 9251614 |
| 323 | 2891555818 | 2891554331 | Bacteria | 8812224 |
| 324 | 2891567880 | 2891562705 | Bacteria | 8039471 |
| 325 | 2895433241 | 2895427314 | Bacteria | 13147766 |
| 326 | 2895444093 | 2895442618 | Bacteria | 11027144 |
| 327 | 8025417537 | 8025413630 | Bacteria | 7014048 |
| 328 | 8055181582 | 8055172936 | Bacteria | 9305943 |
| 329 | 8056038483 | 8056037122 | Bacteria | 3854319 |
| 330 | 8057346230 | 8057345674 | Bacteria | 4160394 |
| 331 | Ga0307410_10199721 | |||
| 332 | JGI25406J46586_10024471 | |||
| 333 | Ga0070658_10116347 | |||
| 334 | Ga0070670_100250237 | |||
| 335 | Ga0068869_100169520 | |||
| 336 | Ga0070687_100207798 | |||
| 337 | Ga0070661_100218350 | |||
| 338 | Ga0070668_100038127 | |||
| 339 | Ga0070675_100165953 | |||
| 340 | Ga0070667_100106456 | |||
| 341 | Ga0070709_10059933 | |||
| 342 | Ga0070709_10088751 | |||
| 343 | Ga0070714_100296340 | |||
| 344 | Ga0070714_100322150 | |||
| 345 | Ga0070711_100078606 | |||
| 346 | Ga0070708_100156243 | |||
| 347 | Ga0070708_100542914 | |||
| 348 | Ga0070662_100177070 | |||
| 349 | Ga0070681_10097308 | |||
| 350 | Ga0070706_100082097 | |||
| 351 | Ga0070707_100002704 | |||
| 352 | Ga0070707_100389204 | |||
| 353 | Ga0070698_100027321 | |||
| 354 | Ga0070699_100006400 | |||
| 355 | Ga0070697_100394770 | |||
| 356 | Ga0070665_100272502 | |||
| 357 | Ga0068855_100087061 | |||
| 358 | Ga0068852_100192674 | |||
| 359 | Ga0068866_10111399 | |||
| 360 | Ga0081538_10000666 | |||
| 361 | Ga0081538_10009370 | |||
| 362 | Ga0081538_10010501 | |||
| 363 | Ga0081538_10012760 | |||
| 364 | Ga0081538_10019997 | |||
| 365 | Ga0081538_10021410 | |||
| 366 | Ga0081538_10043374 | |||
| 367 | Ga0081538_10051417 | |||
| 368 | Ga0081540_1000058 | |||
| 369 | Ga0081540_1016764 | |||
| 370 | Ga0081539_10001200 | |||
| 371 | Ga0081539_10009068 | |||
| 372 | Ga0081539_10023038 | |||
| 373 | Ga0070717_10109397 | |||
| 374 | Ga0070717_10336240 | |||
| 375 | Ga0070712_100104677 | |||
| 376 | Ga0070712_100182873 | |||
| 377 | Ga0097621_100079783 | |||
| 378 | Ga0068871_100208080 | |||
| 379 | Ga0075436_100314896 | |||
| 380 | Ga0105251_10051138 | |||
| 381 | Ga0114129_10973909 | |||
| 382 | Ga0105243_10116578 | |||
| 383 | Ga0105241_10119972 | |||
| 384 | Ga0105249_10025759 | |||
| 385 | Ga0105249_10225326 | |||
| 386 | Ga0105246_10170987 | |||
| 387 | Ga0157373_10320721 | |||
| 388 | Ga0157370_10350508 | |||
| 389 | Ga0163162_10439576 | |||
| 390 | Ga0157379_10158645 | |||
| 391 | Ga0213875_10000327 | |||
| 392 | Ga0213875_10039603 | |||
| 393 | Ga0213875_10069945 | |||
| 394 | Ga0228598_1008669 | |||
| 395 | Ga0207426_1004073 | |||
| 396 | Ga0207653_10005436 | |||
| 397 | Ga0207692_10018471 | |||
| 398 | Ga0207692_10091299 | |||
| 399 | Ga0207688_10043311 | |||
| 400 | Ga0207699_10008814 | |||
| 401 | Ga0207684_10036177 | |||
| 402 | Ga0207693_10049688 | |||
| 403 | Ga0207693_10064201 | |||
| 404 | Ga0207693_10097666 | |||
| 405 | Ga0207693_10202335 | |||
| 406 | Ga0207663_10156400 | |||
| 407 | Ga0207663_10169915 | |||
| 408 | Ga0207649_10100554 | |||
| 409 | Ga0207646_10004604 | |||
| 410 | Ga0207646_10057371 | |||
| 411 | Ga0207646_10339538 | |||
| 412 | Ga0207700_10141043 | |||
| 413 | Ga0207700_10306156 | |||
| 414 | Ga0207706_10029334 | |||
| 415 | Ga0207686_10082900 | |||
| 416 | Ga0207665_10018623 | |||
| 417 | Ga0207665_10040016 | |||
| 418 | Ga0207691_10063612 | |||
| 419 | Ga0207711_10167661 | |||
| 420 | Ga0207689_10047112 | |||
| 421 | Ga0207689_10211736 | |||
| 422 | Ga0207661_10177497 | |||
| 423 | Ga0207651_10058578 | |||
| 424 | Ga0207677_10063817 | |||
| 425 | Ga0207678_10005582 | |||
| 426 | Ga0207708_10022868 | |||
| 427 | Ga0207641_10408214 | |||
| 428 | Ga0207674_10012584 | |||
| 429 | Ga0207675_100005038 | |||
| 430 | Ga0207675_100071371 | |||
| 431 | Ga0207683_10001498 | |||
| 432 | Ga0307408_100031112 | |||
| 433 | Ga0307408_100129649 | |||
| 434 | Ga0307405_10001619 | |||
| 435 | Ga0307405_10002645 | |||
| 436 | Ga0307405_10041145 | |||
| 437 | Ga0307405_10099956 | |||
| 438 | Ga0307413_10017281 | |||
| 439 | Ga0307413_10358446 | |||
| 440 | Ga0307413_10393234 | |||
| 441 | Ga0307410_10002747 | |||
| 442 | Ga0307410_10016351 | |||
| 443 | Ga0307410_10030242 | |||
| 444 | Ga0307410_10054311 | |||
| 445 | Ga0307410_10054523 | |||
| 446 | Ga0307406_10001203 | |||
| 447 | Ga0307406_10041076 | |||
| 448 | Ga0307407_10210043 | |||
| 449 | Ga0307412_10075329 | |||
| 450 | Ga0307412_10111158 | |||
| 451 | Ga0307409_100000303 | |||
| 452 | Ga0307409_100028288 | |||
| 453 | Ga0307409_100375598 | |||
| 454 | Ga0307416_100003404 | |||
| 455 | Ga0307416_100014630 | |||
| 456 | Ga0307416_100052573 | |||
| 457 | Ga0307416_100060549 | |||
| 458 | Ga0307416_100064856 | |||
| 459 | Ga0307416_100116806 | |||
| 460 | Ga0307416_100141771 | |||
| 461 | Ga0307416_100179789 | |||
| 462 | Ga0307416_100199074 | |||
| 463 | Ga0307414_10152289 | |||
| 464 | Ga0307414_10228001 | |||
| 465 | Ga0307411_10028434 | |||
| 466 | Ga0307415_100000530 | |||
| 467 | Ga0307415_100003358 | |||
| 468 | Ga0307415_100011060 | |||
| 469 | Ga0307415_100035866 | |||
| 470 | Ga0307415_100213117 | |||
| 471 | Ga0307415_100262368 | |||
| 472 | Ga0373959_0032856 | |||
| 473 | Ga0373938_0040073 | |||
| 474 | Ga0373926_0001940 | |||
| 475 | Ga0373934_0020550 | |||
| 476 | Ga0373944_0015936 | |||
| 477 | Ga0373923_0010313 | |||
| 478 | Ga0373923_0014290 | |||
| 479 | Ga0373936_0000865 | |||
| 480 | Ga0373945_0001180 | |||
| 481 | Ga0373945_0006175 | |||
| 482 | Ga0373954_0024842 | |||
| 483 | Ga0373954_0194320 | |||
| 484 | Ga0373957_0081958 | |||
| 485 | Ga0373943_0004999 | |||
| 486 | Ga0373946_0003535 | |||
| 487 | Ga0373961_0015422 | |||
| 488 | Ga0373924_0027908 | |||
| 489 | Ga0373931_0066955 | |||
| 490 | Ga0373927_0004371 | |||
| 491 | Ga0373933_0122779 | |||
| 492 | Ga0373947_0004210 | |||
| 493 | Ga0373937_0179002 | |||
| 494 | Ga0373925_0006471 | |||
| 495 | Ga0373925_0104756 | |||
| 496 | Ga0395900_0063740 | |||
| 497 | Ga0395900_0241370 | |||
| 498 | Ga0395900_0663975 | |||
| 499 | Ga0395898_0058814 | |||
| 500 | Ga0395898_0181605 | |||
| 501 | Ga0395905_0023409 | |||
| 502 | Ga0395905_0251384 | |||
| 503 | Ga0436364_0355197 | |||
| 504 | Ga0436364_0508514 | |||
| 505 | Ga0436364_0970630 | |||
| 506 | Ga0436364_0991896 | |||
| 507 | Ga0395901_0010604 | |||
| 508 | Ga0395901_0037053 | |||
| 509 | Ga0395901_0050486 | |||
| 510 | Ga0395901_0349403 | |||
| 511 | Ga0436360_0436515 | |||
| 512 | Ga0439448_0002234 | |||
| 513 | Ga0439448_0011213 | |||
| 514 | Ga0439448_0064337 | |||
| 515 | Ga0439450_001319 | |||
| 516 | Ga0439450_032240 | |||
| 517 | Ga0439455_0000248 | |||
| 518 | Ga0439455_0008275 | |||
| 519 | Ga0439463_000620 | |||
| 520 | Ga0439444_0002142 | |||
| 521 | Ga0439464_0003254 | |||
| 522 | Ga0439464_0016872 | |||
| 523 | Ga0439460_0008027 | |||
| 524 | Ga0439440_0004405 | |||
| 525 | Ga0439440_0014000 | |||
| 526 | Ga0466963_0239209 | |||
| 527 | Ga0466967_0010688 | |||
| 528 | Ga0495603_0227918 | |||
| 529 | Ga0495629_0006217 | |||
| 530 | Ga0495641_0007823 | |||
| 531 | Ga0495641_0017983 | |||
| 532 | Ga0495651_0114811 | |||
| 533 | Ga0495653_0006268 | |||
| 534 | Ga0495653_0090723 | |||
| 535 | Ga0495582_0010646 | |||
| 536 | Ga0495639_0010827 | |||
| 537 | Ga0495662_0004210 | |||
| 538 | Ga0495662_0034750 | |||
| 539 | Ga0495664_0004800 | |||
| 540 | Ga0495585_0199448 | |||
| 541 | Ga0495594_0028480 | |||
| 542 | Ga0495608_0232872 | |||
| 543 | Ga0495616_0141031 | |||
| 544 | Ga0495618_0018574 | |||
| 545 | Ga0495630_0038153 | |||
| 546 | Ga0495652_0053621 | |||
| 547 | Ga0495665_0008956 | |||
| 548 | Ga0495586_0030361 | |||
| 549 | Ga0495587_0029692 | |||
| 550 | Ga0495587_0038121 | |||
| 551 | Ga0495645_0045275 | |||
| 552 | Ga0495645_0256222 | |||
| 553 | Ga0495667_0029293 | |||
| 554 | Ga0495634_0064484 | |||
| 555 | Ga0495634_0109373 | |||
| 556 | Ga0495634_0159714 | |||
| 557 | Ga0495635_0006275 | |||
| 558 | Ga0495588_0113267 | |||
| 559 | Ga0495657_0042652 | |||
| 560 | Ga0495599_0054830 | |||
| 561 | Ga0495599_0118986 | |||
| 562 | Ga0495623_0020873 | |||
| 563 | Ga0495658_0263772 | |||
| 564 | Ga0495613_0007062 | |||
| 565 | Ga0495624_0011277 | |||
| 566 | Ga0495581_0008332 | |||
| 567 | Ga0495581_0013019 | |||
| 568 | Ga0495674_0000397 | |||
| 569 | Ga0495674_0095952 | |||
| 570 | Ga0495674_0125905 | |||
| 571 | Ga0495676_0047754 | |||
| 572 | Ga0495676_0052074 | |||
| 573 | Ga0495680_0013723 | |||
| 574 | Ga0495680_0016080 | |||
| 575 | Ga0495684_0008077 | |||
| 576 | Ga0495684_0009725 | |||
| 577 | Ga0495684_0272329 | |||
| 578 | Ga0495593_0002669 | |||
| 579 | Ga0496104_0182909 | |||
| 580 | Ga0496110_0027757 | |||
| 581 | Ga0496117_0000071 | |||
| 582 | Ga0501031_0008162 | |||
| 583 | Ga0501031_0059637 | |||
| 584 | Ga0501032_0070024 | |||
| 585 | Ga0501032_0273308 | |||
| 586 | Ga0501033_0076140 | |||
| 587 | Ga0501036_0006473 | |||
| 588 | Ga0501036_0072531 | |||
| 589 | Ga0501037_0032309 | |||
| 590 | Ga0501037_0270303 | |||
| 591 | Ga0501038_0014156 | |||
| 592 | Ga0501038_0046720 | |||
| 593 | Ga0501039_0008440 | |||
| 594 | Ga0501039_0010945 | |||
| 595 | Ga0501039_0243219 | |||
| 596 | Ga0501040_0001804 | |||
| 597 | Ga0501040_0003907 | |||
| 598 | Ga0501041_0002927 | |||
| 599 | Ga0501042_0003176 | |||
| 600 | Ga0501042_0003447 | |||
| 601 | Ga0501042_0039650 | |||
| 602 | Ga0501043_0061628 | |||
| 603 | Ga0501043_0069485 | |||
| 604 | Ga0501043_0207827 | |||
| 605 | Ga0501046_0000684 | |||
| 606 | Ga0501046_0004161 | |||
| 607 | Ga0501047_0016079 | |||
| 608 | Ga0501048_0000207 | |||
| 609 | Ga0501048_0001188 | |||
| 610 | Ga0501068_0113871 | |||
| 611 | Ga0501071_0013596 | |||
| 612 | Ga0501071_0075251 | |||
| 613 | Ga0501072_0000086 | |||
| 614 | Ga0501072_0008647 | |||
| 615 | Ga0501074_0000806 | |||
| 616 | Ga0501074_0023673 | |||
| 617 | Ga0501074_0034287 | |||
| 618 | Ga0501075_0003024 | |||
| 619 | Ga0501075_0009241 | |||
| 620 | Ga0501076_0005395 | |||
| 621 | Ga0501076_0009319 | |||
| 622 | Ga0501077_0000155 | |||
| 623 | Ga0501077_0003085 | |||
| 624 | Ga0501079_0005801 | |||
| 625 | Ga0501079_0005825 | |||
| 626 | Ga0501080_0010682 | |||
| 627 | Ga0501080_0148529 | |||
| 628 | Ga0501081_0001011 | |||
| 629 | Ga0501081_0009672 | |||
| 630 | Ga0501083_0123456 | |||
| 631 | Ga0501035_0016245 | |||
| 632 | Ga0501035_0241999 | |||
| 633 | Ga0501044_0191255 | |||
| 634 | Ga0501044_0229994 | |||
| 635 | Ga0501045_0005377 | |||
| 636 | Ga0501045_0028851 | |||
| 637 | Ga0495595_0034511 | |||
| 638 | Ga0500645_005520 | |||
| 639 | Ga0501084_0001972 | |||
| 640 | Ga0501084_0011154 | |||
| 641 | Ga0590074_006452 | |||
| 642 | Ga0590077_001000 | |||
| 643 | Ga0501082_0001276 | |||
| 644 | Ga0501082_0009010 | |||
| 645 | Ga0530510_0003234 | |||
| 646 | Ga0530510_0051662 | |||
| 647 | 2676488369 | |||
| 648 | 2804848926 | |||
| 649 | 2844853203 | |||
| 650 | 2856747849 | |||
| 651 | 2884701934 | |||
| 652 | 2891396530 | |||
| 653 | 2891555818 | |||
| 654 | 2891567880 | |||
| 655 | 2895433241 | |||
| 656 | 2895444093 | |||
| 657 | 8025417537 | |||
| 658 | 8055181582 | |||
| 659 | 8056038483 | |||
| 660 | 8057346230 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jhj-assembly2.cif.gz_B | 3-methyladenine dna-glycosylase from archaeoglobus fulgidus | 0.8043 | 3 | 290 |
| 2jhn-assembly2.cif.gz_B | 3-methyladenine dna-glycosylase from archaeoglobus fulgidus | 0.7951 | 3 | 293 |
| 2jhj-assembly2.cif.gz_B | 3-methyladenine dna-glycosylase from archaeoglobus fulgidus | 0.7919 | 3 | 290 |
| 2jhj-assembly1.cif.gz_A | 3-methyladenine dna-glycosylase from archaeoglobus fulgidus | 0.79 | 3 | 291 |
| 2jhn-assembly2.cif.gz_B | 3-methyladenine dna-glycosylase from archaeoglobus fulgidus | 0.7878 | 3 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jhnB02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8391 | 117 | 233 | 1.10.340.30 |
| 3i0xA02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8256 | 117 | 233 | 1.10.340.30 |
| 4ejzB02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8242 | 117 | 232 | 1.10.340.30 |
| af_P9WJW3_319_432_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8208 | 122 | 232 | 1.10.340.30 |
| af_B4FZ58_120_231_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8092 | 118 | 233 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2MFF2-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9776 | 1 | 277 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A7V8VZH2-F1-model_v4 | DNA-3-methyladenine glycosylase 2 family protein | 0.9704 | 1 | 220 |
GO:0003824
GO:0006281 |
| AF-A0A0L8QTB1-F1-model_v4 | deleted | 0.9645 | 90 | 292 |
|
| AF-A0A535TSM9-F1-model_v4 | DNA-3-methyladenine glycosylase 2 family protein | 0.962 | 34 | 243 |
GO:0006285
GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A401VTX0-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9605 | 1 | 288 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |