F410162

General Info

Members Datasets Scaffolds Average Seq Length
330 206 660 305

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10199721|Ga0307410_101997212
Length 347
Sequence MEHRLPGRGPGGVDEVHPGRFQGDPRVRAVDEPRRGVCGIWYSYAMTTFELVPKGPFSLAAGAAFLEGFSSAAYRAAEAGHLHLAFVPDGEEAAAGVCLRQPDGVVTGEVSGDADPEAVRDQVARILSLDVDGSGFPDVGRRDPVVGGLQRRWPGLRPVGFCSPYEAAAWALIGHRIQMVQAARIKARMAEALGEAVDIHGDTRHAFPGPARLAGLEGFRGLFARKAENLRALGEAAMEGRLDGAWLRGLPREQALKELKQLPGIGAFSAELVLLRGAADPDHLPLHEPRLCRGAAIAYDLDEPPDREWLEERAEAWRPYRTWVVLLLRVLLEAETGDTGGTRNVAG

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
194 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
195 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
196 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
197 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
198 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
199 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
200 2891562705 Microbispora tritici MT50 Isolate Unclassified
201 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
202 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
203 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
204 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
205 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
206 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 0
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0.61
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10199721 3300031852 Bacteria 1526
2 JGI25406J46586_10024471 3300003203 Bacteria 2365
3 Ga0070658_10116347 3300005327 Bacteria 2218
4 Ga0070670_100250237 3300005331 Bacteria 1544
5 Ga0068869_100169520 3300005334 Bacteria 1705
6 Ga0070687_100207798 3300005343 Bacteria 1190
7 Ga0070661_100218350 3300005344 Bacteria 1462
8 Ga0070668_100038127 3300005347 Bacteria 3672
9 Ga0070675_100165953 3300005354 Bacteria 1902
10 Ga0070667_100106456 3300005367 Bacteria 2427
11 Ga0070709_10059933 3300005434 Bacteria 2418
12 Ga0070709_10088751 3300005434 Bacteria 2034
13 Ga0070714_100296340 3300005435 Bacteria 1506
14 Ga0070714_100322150 3300005435 Bacteria 1445
15 Ga0070711_100078606 3300005439 Bacteria 2344
16 Ga0070708_100156243 3300005445 Unclassified 2124
17 Ga0070708_100542914 3300005445 Bacteria 1097
18 Ga0070662_100177070 3300005457 Bacteria 1679
19 Ga0070681_10097308 3300005458 Bacteria 2890
20 Ga0070706_100082097 3300005467 Bacteria 2986
21 Ga0070707_100002704 3300005468 Bacteria 16863
22 Ga0070707_100389204 3300005468 Unclassified 1354
23 Ga0070698_100027321 3300005471 Bacteria 5937
24 Ga0070699_100006400 3300005518 Bacteria 10256
25 Ga0070697_100394770 3300005536 Bacteria 1200
26 Ga0070665_100272502 3300005548 Bacteria 1694
27 Ga0068855_100087061 3300005563 Bacteria 3611
28 Ga0068852_100192674 3300005616 Bacteria 1924
29 Ga0068866_10111399 3300005718 Bacteria 1528
30 Ga0081538_10000666 3300005981 Bacteria 37828
31 Ga0081538_10009370 3300005981 Bacteria 8183
32 Ga0081538_10010501 3300005981 Bacteria 7592
33 Ga0081538_10012760 3300005981 Bacteria 6710
34 Ga0081538_10019997 3300005981 Bacteria 4950
35 Ga0081538_10021410 3300005981 Bacteria 4721
36 Ga0081538_10043374 3300005981 Bacteria 2825
37 Ga0081538_10051417 3300005981 Bacteria 2475
38 Ga0081540_1000058 3300005983 Bacteria 120635
39 Ga0081540_1016764 3300005983 Bacteria 4566
40 Ga0081539_10001200 3300005985 Bacteria 46704
41 Ga0081539_10009068 3300005985 Bacteria 8433
42 Ga0081539_10023038 3300005985 Bacteria 4093
43 Ga0070717_10109397 3300006028 Unclassified 2355
44 Ga0070717_10336240 3300006028 Bacteria 1348
45 Ga0070712_100104677 3300006175 Bacteria 2100
46 Ga0070712_100182873 3300006175 Bacteria 1635
47 Ga0097621_100079783 3300006237 Bacteria 2721
48 Ga0068871_100208080 3300006358 Bacteria 1691
49 Ga0075436_100314896 3300006914 Bacteria 1123
50 Ga0105251_10051138 3300009011 Bacteria 1972
51 Ga0114129_10973909 3300009147 Bacteria 1070
52 Ga0105243_10116578 3300009148 Bacteria 2244
53 Ga0105241_10119972 3300009174 Bacteria 2116
54 Ga0105249_10025759 3300009553 Bacteria 5297
55 Ga0105249_10225326 3300009553 Bacteria 1847
56 Ga0105246_10170987 3300011119 Bacteria 1664
57 Ga0157373_10320721 3300013100 Bacteria 1102
58 Ga0157370_10350508 3300013104 Bacteria 1361
59 Ga0163162_10439576 3300013306 Bacteria 1436
60 Ga0157379_10158645 3300014968 Bacteria 2042
61 Ga0213875_10000327 3300021388 Bacteria 45240
62 Ga0213875_10039603 3300021388 Bacteria 2220
63 Ga0213875_10069945 3300021388 Bacteria 1638
64 Ga0228598_1008669 3300024227 Bacteria 2049
65 Ga0207426_1004073 3300025302 Bacteria 7378
66 Ga0207653_10005436 3300025885 Bacteria 3984
67 Ga0207692_10018471 3300025898 Bacteria 3131
68 Ga0207692_10091299 3300025898 Bacteria 1652
69 Ga0207688_10043311 3300025901 Bacteria 2506
70 Ga0207699_10008814 3300025906 Bacteria 4995
71 Ga0207684_10036177 3300025910 Bacteria 4191
72 Ga0207693_10049688 3300025915 Bacteria 3294
73 Ga0207693_10064201 3300025915 Bacteria 2876
74 Ga0207693_10097666 3300025915 Bacteria 2303
75 Ga0207693_10202335 3300025915 Bacteria 1562
76 Ga0207663_10156400 3300025916 Bacteria 1604
77 Ga0207663_10169915 3300025916 Bacteria 1548
78 Ga0207649_10100554 3300025920 Bacteria 1913
79 Ga0207646_10004604 3300025922 Bacteria 14911
80 Ga0207646_10057371 3300025922 Bacteria 3479
81 Ga0207646_10339538 3300025922 Unclassified 1357
82 Ga0207700_10141043 3300025928 Bacteria 1980
83 Ga0207700_10306156 3300025928 Bacteria 1373
84 Ga0207706_10029334 3300025933 Bacteria 4911
85 Ga0207686_10082900 3300025934 Bacteria 2097
86 Ga0207665_10018623 3300025939 Bacteria 4561
87 Ga0207665_10040016 3300025939 Bacteria 3126
88 Ga0207691_10063612 3300025940 Bacteria 3346
89 Ga0207711_10167661 3300025941 Bacteria 1991
90 Ga0207689_10047112 3300025942 Bacteria 3561
91 Ga0207689_10211736 3300025942 Bacteria 1601
92 Ga0207661_10177497 3300025944 Bacteria 1858
93 Ga0207651_10058578 3300025960 Bacteria 2663
94 Ga0207677_10063817 3300026023 Bacteria 2562
95 Ga0207678_10005582 3300026067 Bacteria 11246
96 Ga0207708_10022868 3300026075 Bacteria 4721
97 Ga0207641_10408214 3300026088 Bacteria 1305
98 Ga0207674_10012584 3300026116 Bacteria 9455
99 Ga0207675_100005038 3300026118 Bacteria 12715
100 Ga0207675_100071371 3300026118 Bacteria 3247
101 Ga0207683_10001498 3300026121 Bacteria 21070
102 Ga0307408_100031112 3300031548 Bacteria 3713
103 Ga0307408_100129649 3300031548 Bacteria 1966
104 Ga0307405_10001619 3300031731 Bacteria 9575
105 Ga0307405_10002645 3300031731 Bacteria 7965
106 Ga0307405_10041145 3300031731 Bacteria 2803
107 Ga0307405_10099956 3300031731 Bacteria 1943
108 Ga0307413_10017281 3300031824 Bacteria 3753
109 Ga0307413_10358446 3300031824 Bacteria 1128
110 Ga0307413_10393234 3300031824 Bacteria 1084
111 Ga0307410_10002747 3300031852 Bacteria 8611
112 Ga0307410_10016351 3300031852 Bacteria 4424
113 Ga0307410_10030242 3300031852 Bacteria 3459
114 Ga0307410_10054311 3300031852 Bacteria 2715
115 Ga0307410_10054523 3300031852 Bacteria 2711
116 Ga0307406_10001203 3300031901 Bacteria 14489
117 Ga0307406_10041076 3300031901 Bacteria 2880
118 Ga0307407_10210043 3300031903 Bacteria 1310
119 Ga0307412_10075329 3300031911 Bacteria 2315
120 Ga0307412_10111158 3300031911 Bacteria 1957
121 Ga0307409_100000303 3300031995 Bacteria 20044
122 Ga0307409_100028288 3300031995 Bacteria 3990
123 Ga0307409_100375598 3300031995 Bacteria 1349
124 Ga0307416_100003404 3300032002 Bacteria 9331
125 Ga0307416_100014630 3300032002 Bacteria 5387
126 Ga0307416_100052573 3300032002 Bacteria 3262
127 Ga0307416_100060549 3300032002 Bacteria 3084
128 Ga0307416_100064856 3300032002 Bacteria 2998
129 Ga0307416_100116806 3300032002 Bacteria 2366
130 Ga0307416_100141771 3300032002 Bacteria 2186
131 Ga0307416_100179789 3300032002 Bacteria 1981
132 Ga0307416_100199074 3300032002 Bacteria 1898
133 Ga0307414_10152289 3300032004 Bacteria 1826
134 Ga0307414_10228001 3300032004 Bacteria 1534
135 Ga0307411_10028434 3300032005 Bacteria 3399
136 Ga0307415_100000530 3300032126 Bacteria 16627
137 Ga0307415_100003358 3300032126 Bacteria 8131
138 Ga0307415_100011060 3300032126 Bacteria 5143
139 Ga0307415_100035866 3300032126 Bacteria 3243
140 Ga0307415_100213117 3300032126 Bacteria 1542
141 Ga0307415_100262368 3300032126 Bacteria 1410
142 Ga0373959_0032856 3300034820 Bacteria 1057
143 Ga0373938_0040073 3300034957 Bacteria 1038
144 Ga0373926_0001940 3300035083 Bacteria 6478
145 Ga0373934_0020550 3300035086 Bacteria 2538
146 Ga0373944_0015936 3300035089 Bacteria 2113
147 Ga0373923_0010313 3300035111 Bacteria 3395
148 Ga0373923_0014290 3300035111 Bacteria 2981
149 Ga0373936_0000865 3300035113 Bacteria 10802
150 Ga0373945_0001180 3300035116 Bacteria 7936
151 Ga0373945_0006175 3300035116 Bacteria 3852
152 Ga0373954_0024842 3300035118 Bacteria 2734
153 Ga0373954_0194320 3300035118 Bacteria 996
154 Ga0373957_0081958 3300035120 Bacteria 1275
155 Ga0373943_0004999 3300035170 Bacteria 5983
156 Ga0373946_0003535 3300035171 Bacteria 5547
157 Ga0373961_0015422 3300035241 Bacteria 1954
158 Ga0373924_0027908 3300035410 Bacteria 2247
159 Ga0373931_0066955 3300035691 Bacteria 1950
160 Ga0373927_0004371 3300035695 Bacteria 9912
161 Ga0373933_0122779 3300035724 Bacteria 1627
162 Ga0373947_0004210 3300035725 Bacteria 8441
163 Ga0373937_0179002 3300036401 Bacteria 1991
164 Ga0373925_0006471 3300037068 Bacteria 8614
165 Ga0373925_0104756 3300037068 Bacteria 2179
166 Ga0395900_0063740 3300037418 Bacteria 3788
167 Ga0395900_0241370 3300037418 Bacteria 1812
168 Ga0395900_0663975 3300037418 Bacteria 978
169 Ga0395898_0058814 3300037466 Bacteria 3741
170 Ga0395898_0181605 3300037466 Bacteria 2011
171 Ga0395905_0023409 3300037471 Bacteria 5837
172 Ga0395905_0251384 3300037471 Bacteria 1651
173 Ga0436364_0355197 3300037853 Bacteria 87848
174 Ga0436364_0508514 3300037853 Bacteria 4022
175 Ga0436364_0970630 3300037853 Bacteria 9888
176 Ga0436364_0991896 3300037853 Bacteria 3398
177 Ga0395901_0010604 3300038443 Bacteria 9335
178 Ga0395901_0037053 3300038443 Bacteria 5044
179 Ga0395901_0050486 3300038443 Bacteria 4321
180 Ga0395901_0349403 3300038443 Bacteria 1526
181 Ga0436360_0436515 3300039438 Bacteria 1312
182 Ga0439448_0002234 3300042005 Bacteria 5230
183 Ga0439448_0011213 3300042005 Bacteria 2669
184 Ga0439448_0064337 3300042005 Bacteria 1216
185 Ga0439450_001319 3300042008 Bacteria 3603
186 Ga0439450_032240 3300042008 Bacteria 1183
187 Ga0439455_0000248 3300042012 Bacteria 6514
188 Ga0439455_0008275 3300042012 Bacteria 2225
189 Ga0439463_000620 3300042016 Bacteria 9827
190 Ga0439444_0002142 3300042437 Bacteria 2666
191 Ga0439464_0003254 3300042439 Bacteria 4089
192 Ga0439464_0016872 3300042439 Bacteria 1977
193 Ga0439460_0008027 3300042461 Bacteria 2659
194 Ga0439440_0004405 3300042993 Bacteria 2765
195 Ga0439440_0014000 3300042993 Bacteria 1727
196 Ga0466963_0239209 3300044694 Bacteria 1273
197 Ga0466967_0010688 3300045976 Bacteria 6901
198 Ga0495603_0227918 3300046455 Bacteria 1074
199 Ga0495629_0006217 3300046459 Bacteria 8863
200 Ga0495641_0007823 3300046461 Bacteria 6618
201 Ga0495641_0017983 3300046461 Bacteria 3661
202 Ga0495651_0114811 3300046462 Bacteria 1986
203 Ga0495653_0006268 3300046463 Bacteria 9759
204 Ga0495653_0090723 3300046463 Bacteria 2235
205 Ga0495582_0010646 3300046473 Bacteria 5058
206 Ga0495639_0010827 3300046475 Bacteria 3928
207 Ga0495662_0004210 3300046476 Bacteria 7241
208 Ga0495662_0034750 3300046476 Bacteria 2433
209 Ga0495664_0004800 3300046477 Bacteria 7393
210 Ga0495585_0199448 3300046492 Bacteria 1020
211 Ga0495594_0028480 3300046499 Bacteria 3015
212 Ga0495608_0232872 3300046511 Bacteria 1152
213 Ga0495616_0141031 3300046513 Bacteria 1097
214 Ga0495618_0018574 3300046514 Bacteria 4269
215 Ga0495630_0038153 3300046517 Bacteria 3593
216 Ga0495652_0053621 3300046529 Bacteria 3436
217 Ga0495665_0008956 3300046531 Bacteria 5431
218 Ga0495586_0030361 3300046535 Bacteria 2892
219 Ga0495587_0029692 3300046536 Bacteria 3318
220 Ga0495587_0038121 3300046536 Bacteria 2883
221 Ga0495645_0045275 3300046543 Bacteria 3210
222 Ga0495645_0256222 3300046543 Bacteria 1160
223 Ga0495667_0029293 3300046559 Bacteria 3705
224 Ga0495634_0064484 3300046642 Bacteria 2428
225 Ga0495634_0109373 3300046642 Bacteria 1778
226 Ga0495634_0159714 3300046642 Unclassified 1422
227 Ga0495635_0006275 3300046663 Bacteria 8280
228 Ga0495588_0113267 3300046674 Bacteria 1429
229 Ga0495657_0042652 3300046675 Bacteria 3096
230 Ga0495599_0054830 3300046678 Bacteria 2497
231 Ga0495599_0118986 3300046678 Bacteria 1642
232 Ga0495623_0020873 3300046679 Bacteria 4233
233 Ga0495658_0263772 3300046683 Bacteria 1085
234 Ga0495613_0007062 3300046689 Bacteria 8360
235 Ga0495624_0011277 3300046690 Bacteria 6144
236 Ga0495581_0008332 3300047315 Bacteria 6009
237 Ga0495581_0013019 3300047315 Bacteria 4821
238 Ga0495674_0000397 3300047319 Bacteria 39073
239 Ga0495674_0095952 3300047319 Bacteria 2527
240 Ga0495674_0125905 3300047319 Bacteria 2162
241 Ga0495676_0047754 3300047321 Bacteria 3457
242 Ga0495676_0052074 3300047321 Bacteria 3270
243 Ga0495680_0013723 3300047322 Bacteria 7051
244 Ga0495680_0016080 3300047322 Bacteria 6433
245 Ga0495684_0008077 3300047471 Bacteria 8140
246 Ga0495684_0009725 3300047471 Bacteria 7418
247 Ga0495684_0272329 3300047471 Bacteria 1224
248 Ga0495593_0002669 3300047673 Bacteria 10729
249 Ga0496104_0182909 3300048907 Bacteria 2006
250 Ga0496110_0027757 3300048913 Bacteria 4855
251 Ga0496117_0000071 3300048920 Bacteria 242170
252 Ga0501031_0008162 3300049568 Bacteria 6814
253 Ga0501031_0059637 3300049568 Bacteria 2486
254 Ga0501032_0070024 3300049569 Bacteria 2340
255 Ga0501032_0273308 3300049569 Bacteria 1095
256 Ga0501033_0076140 3300049570 Bacteria 2463
257 Ga0501036_0006473 3300049572 Bacteria 9515
258 Ga0501036_0072531 3300049572 Bacteria 2910
259 Ga0501037_0032309 3300049573 Bacteria 3865
260 Ga0501037_0270303 3300049573 Bacteria 1186
261 Ga0501038_0014156 3300049574 Bacteria 7268
262 Ga0501038_0046720 3300049574 Bacteria 3753
263 Ga0501039_0008440 3300049575 Bacteria 7851
264 Ga0501039_0010945 3300049575 Bacteria 6912
265 Ga0501039_0243219 3300049575 Bacteria 1415
266 Ga0501040_0001804 3300049576 Bacteria 13748
267 Ga0501040_0003907 3300049576 Bacteria 9671
268 Ga0501041_0002927 3300049577 Bacteria 9796
269 Ga0501042_0003176 3300049578 Bacteria 10247
270 Ga0501042_0003447 3300049578 Bacteria 9928
271 Ga0501042_0039650 3300049578 Bacteria 3348
272 Ga0501043_0061628 3300049579 Bacteria 2946
273 Ga0501043_0069485 3300049579 Bacteria 2766
274 Ga0501043_0207827 3300049579 Bacteria 1517
275 Ga0501046_0000684 3300049580 Bacteria 32896
276 Ga0501046_0004161 3300049580 Bacteria 13173
277 Ga0501047_0016079 3300049581 Bacteria 7136
278 Ga0501048_0000207 3300049582 Bacteria 38591
279 Ga0501048_0001188 3300049582 Bacteria 19703
280 Ga0501068_0113871 3300049584 Bacteria 1683
281 Ga0501071_0013596 3300049587 Bacteria 5551
282 Ga0501071_0075251 3300049587 Bacteria 2465
283 Ga0501072_0000086 3300049588 Bacteria 68239
284 Ga0501072_0008647 3300049588 Bacteria 7729
285 Ga0501074_0000806 3300049590 Bacteria 19797
286 Ga0501074_0023673 3300049590 Bacteria 4463
287 Ga0501074_0034287 3300049590 Bacteria 3680
288 Ga0501075_0003024 3300049591 Bacteria 11232
289 Ga0501075_0009241 3300049591 Bacteria 6892
290 Ga0501076_0005395 3300049592 Bacteria 9189
291 Ga0501076_0009319 3300049592 Bacteria 7244
292 Ga0501077_0000155 3300049593 Bacteria 38326
293 Ga0501077_0003085 3300049593 Bacteria 10016
294 Ga0501079_0005801 3300049741 Bacteria 9229
295 Ga0501079_0005825 3300049741 Bacteria 9213
296 Ga0501080_0010682 3300049742 Bacteria 8401
297 Ga0501080_0148529 3300049742 Bacteria 2167
298 Ga0501081_0001011 3300049743 Bacteria 16773
299 Ga0501081_0009672 3300049743 Bacteria 6284
300 Ga0501083_0123456 3300049744 Bacteria 1698
301 Ga0501035_0016245 3300049822 Bacteria 6870
302 Ga0501035_0241999 3300049822 Bacteria 1534
303 Ga0501044_0191255 3300049823 Bacteria 2009
304 Ga0501044_0229994 3300049823 Bacteria 1802
305 Ga0501045_0005377 3300049824 Bacteria 8876
306 Ga0501045_0028851 3300049824 Bacteria 4005
307 Ga0495595_0034511 3300053084 Bacteria 2288
308 Ga0500645_005520 3300053730 Bacteria 4639
309 Ga0501084_0001972 3300054114 Bacteria 16389
310 Ga0501084_0011154 3300054114 Bacteria 7444
311 Ga0590074_006452 3300059423 Bacteria 1946
312 Ga0590077_001000 3300059426 Bacteria 7158
313 Ga0501082_0001276 3300060353 Bacteria 22105
314 Ga0501082_0009010 3300060353 Bacteria 8611
315 Ga0530510_0003234 3300061734 Bacteria 11188
316 Ga0530510_0051662 3300061734 Bacteria 2970
317 2676488369 2675903060 Bacteria 10051191
318 2804848926 2802429296 Bacteria 7227771
319 2844853203 2844852863 Bacteria 3849151
320 2856747849 2856741275 Bacteria 8096094
321 2884701934 2884693830 Bacteria 11273186
322 2891396530 2891395885 Bacteria 9251614
323 2891555818 2891554331 Bacteria 8812224
324 2891567880 2891562705 Bacteria 8039471
325 2895433241 2895427314 Bacteria 13147766
326 2895444093 2895442618 Bacteria 11027144
327 8025417537 8025413630 Bacteria 7014048
328 8055181582 8055172936 Bacteria 9305943
329 8056038483 8056037122 Bacteria 3854319
330 8057346230 8057345674 Bacteria 4160394
331 Ga0307410_10199721
332 JGI25406J46586_10024471
333 Ga0070658_10116347
334 Ga0070670_100250237
335 Ga0068869_100169520
336 Ga0070687_100207798
337 Ga0070661_100218350
338 Ga0070668_100038127
339 Ga0070675_100165953
340 Ga0070667_100106456
341 Ga0070709_10059933
342 Ga0070709_10088751
343 Ga0070714_100296340
344 Ga0070714_100322150
345 Ga0070711_100078606
346 Ga0070708_100156243
347 Ga0070708_100542914
348 Ga0070662_100177070
349 Ga0070681_10097308
350 Ga0070706_100082097
351 Ga0070707_100002704
352 Ga0070707_100389204
353 Ga0070698_100027321
354 Ga0070699_100006400
355 Ga0070697_100394770
356 Ga0070665_100272502
357 Ga0068855_100087061
358 Ga0068852_100192674
359 Ga0068866_10111399
360 Ga0081538_10000666
361 Ga0081538_10009370
362 Ga0081538_10010501
363 Ga0081538_10012760
364 Ga0081538_10019997
365 Ga0081538_10021410
366 Ga0081538_10043374
367 Ga0081538_10051417
368 Ga0081540_1000058
369 Ga0081540_1016764
370 Ga0081539_10001200
371 Ga0081539_10009068
372 Ga0081539_10023038
373 Ga0070717_10109397
374 Ga0070717_10336240
375 Ga0070712_100104677
376 Ga0070712_100182873
377 Ga0097621_100079783
378 Ga0068871_100208080
379 Ga0075436_100314896
380 Ga0105251_10051138
381 Ga0114129_10973909
382 Ga0105243_10116578
383 Ga0105241_10119972
384 Ga0105249_10025759
385 Ga0105249_10225326
386 Ga0105246_10170987
387 Ga0157373_10320721
388 Ga0157370_10350508
389 Ga0163162_10439576
390 Ga0157379_10158645
391 Ga0213875_10000327
392 Ga0213875_10039603
393 Ga0213875_10069945
394 Ga0228598_1008669
395 Ga0207426_1004073
396 Ga0207653_10005436
397 Ga0207692_10018471
398 Ga0207692_10091299
399 Ga0207688_10043311
400 Ga0207699_10008814
401 Ga0207684_10036177
402 Ga0207693_10049688
403 Ga0207693_10064201
404 Ga0207693_10097666
405 Ga0207693_10202335
406 Ga0207663_10156400
407 Ga0207663_10169915
408 Ga0207649_10100554
409 Ga0207646_10004604
410 Ga0207646_10057371
411 Ga0207646_10339538
412 Ga0207700_10141043
413 Ga0207700_10306156
414 Ga0207706_10029334
415 Ga0207686_10082900
416 Ga0207665_10018623
417 Ga0207665_10040016
418 Ga0207691_10063612
419 Ga0207711_10167661
420 Ga0207689_10047112
421 Ga0207689_10211736
422 Ga0207661_10177497
423 Ga0207651_10058578
424 Ga0207677_10063817
425 Ga0207678_10005582
426 Ga0207708_10022868
427 Ga0207641_10408214
428 Ga0207674_10012584
429 Ga0207675_100005038
430 Ga0207675_100071371
431 Ga0207683_10001498
432 Ga0307408_100031112
433 Ga0307408_100129649
434 Ga0307405_10001619
435 Ga0307405_10002645
436 Ga0307405_10041145
437 Ga0307405_10099956
438 Ga0307413_10017281
439 Ga0307413_10358446
440 Ga0307413_10393234
441 Ga0307410_10002747
442 Ga0307410_10016351
443 Ga0307410_10030242
444 Ga0307410_10054311
445 Ga0307410_10054523
446 Ga0307406_10001203
447 Ga0307406_10041076
448 Ga0307407_10210043
449 Ga0307412_10075329
450 Ga0307412_10111158
451 Ga0307409_100000303
452 Ga0307409_100028288
453 Ga0307409_100375598
454 Ga0307416_100003404
455 Ga0307416_100014630
456 Ga0307416_100052573
457 Ga0307416_100060549
458 Ga0307416_100064856
459 Ga0307416_100116806
460 Ga0307416_100141771
461 Ga0307416_100179789
462 Ga0307416_100199074
463 Ga0307414_10152289
464 Ga0307414_10228001
465 Ga0307411_10028434
466 Ga0307415_100000530
467 Ga0307415_100003358
468 Ga0307415_100011060
469 Ga0307415_100035866
470 Ga0307415_100213117
471 Ga0307415_100262368
472 Ga0373959_0032856
473 Ga0373938_0040073
474 Ga0373926_0001940
475 Ga0373934_0020550
476 Ga0373944_0015936
477 Ga0373923_0010313
478 Ga0373923_0014290
479 Ga0373936_0000865
480 Ga0373945_0001180
481 Ga0373945_0006175
482 Ga0373954_0024842
483 Ga0373954_0194320
484 Ga0373957_0081958
485 Ga0373943_0004999
486 Ga0373946_0003535
487 Ga0373961_0015422
488 Ga0373924_0027908
489 Ga0373931_0066955
490 Ga0373927_0004371
491 Ga0373933_0122779
492 Ga0373947_0004210
493 Ga0373937_0179002
494 Ga0373925_0006471
495 Ga0373925_0104756
496 Ga0395900_0063740
497 Ga0395900_0241370
498 Ga0395900_0663975
499 Ga0395898_0058814
500 Ga0395898_0181605
501 Ga0395905_0023409
502 Ga0395905_0251384
503 Ga0436364_0355197
504 Ga0436364_0508514
505 Ga0436364_0970630
506 Ga0436364_0991896
507 Ga0395901_0010604
508 Ga0395901_0037053
509 Ga0395901_0050486
510 Ga0395901_0349403
511 Ga0436360_0436515
512 Ga0439448_0002234
513 Ga0439448_0011213
514 Ga0439448_0064337
515 Ga0439450_001319
516 Ga0439450_032240
517 Ga0439455_0000248
518 Ga0439455_0008275
519 Ga0439463_000620
520 Ga0439444_0002142
521 Ga0439464_0003254
522 Ga0439464_0016872
523 Ga0439460_0008027
524 Ga0439440_0004405
525 Ga0439440_0014000
526 Ga0466963_0239209
527 Ga0466967_0010688
528 Ga0495603_0227918
529 Ga0495629_0006217
530 Ga0495641_0007823
531 Ga0495641_0017983
532 Ga0495651_0114811
533 Ga0495653_0006268
534 Ga0495653_0090723
535 Ga0495582_0010646
536 Ga0495639_0010827
537 Ga0495662_0004210
538 Ga0495662_0034750
539 Ga0495664_0004800
540 Ga0495585_0199448
541 Ga0495594_0028480
542 Ga0495608_0232872
543 Ga0495616_0141031
544 Ga0495618_0018574
545 Ga0495630_0038153
546 Ga0495652_0053621
547 Ga0495665_0008956
548 Ga0495586_0030361
549 Ga0495587_0029692
550 Ga0495587_0038121
551 Ga0495645_0045275
552 Ga0495645_0256222
553 Ga0495667_0029293
554 Ga0495634_0064484
555 Ga0495634_0109373
556 Ga0495634_0159714
557 Ga0495635_0006275
558 Ga0495588_0113267
559 Ga0495657_0042652
560 Ga0495599_0054830
561 Ga0495599_0118986
562 Ga0495623_0020873
563 Ga0495658_0263772
564 Ga0495613_0007062
565 Ga0495624_0011277
566 Ga0495581_0008332
567 Ga0495581_0013019
568 Ga0495674_0000397
569 Ga0495674_0095952
570 Ga0495674_0125905
571 Ga0495676_0047754
572 Ga0495676_0052074
573 Ga0495680_0013723
574 Ga0495680_0016080
575 Ga0495684_0008077
576 Ga0495684_0009725
577 Ga0495684_0272329
578 Ga0495593_0002669
579 Ga0496104_0182909
580 Ga0496110_0027757
581 Ga0496117_0000071
582 Ga0501031_0008162
583 Ga0501031_0059637
584 Ga0501032_0070024
585 Ga0501032_0273308
586 Ga0501033_0076140
587 Ga0501036_0006473
588 Ga0501036_0072531
589 Ga0501037_0032309
590 Ga0501037_0270303
591 Ga0501038_0014156
592 Ga0501038_0046720
593 Ga0501039_0008440
594 Ga0501039_0010945
595 Ga0501039_0243219
596 Ga0501040_0001804
597 Ga0501040_0003907
598 Ga0501041_0002927
599 Ga0501042_0003176
600 Ga0501042_0003447
601 Ga0501042_0039650
602 Ga0501043_0061628
603 Ga0501043_0069485
604 Ga0501043_0207827
605 Ga0501046_0000684
606 Ga0501046_0004161
607 Ga0501047_0016079
608 Ga0501048_0000207
609 Ga0501048_0001188
610 Ga0501068_0113871
611 Ga0501071_0013596
612 Ga0501071_0075251
613 Ga0501072_0000086
614 Ga0501072_0008647
615 Ga0501074_0000806
616 Ga0501074_0023673
617 Ga0501074_0034287
618 Ga0501075_0003024
619 Ga0501075_0009241
620 Ga0501076_0005395
621 Ga0501076_0009319
622 Ga0501077_0000155
623 Ga0501077_0003085
624 Ga0501079_0005801
625 Ga0501079_0005825
626 Ga0501080_0010682
627 Ga0501080_0148529
628 Ga0501081_0001011
629 Ga0501081_0009672
630 Ga0501083_0123456
631 Ga0501035_0016245
632 Ga0501035_0241999
633 Ga0501044_0191255
634 Ga0501044_0229994
635 Ga0501045_0005377
636 Ga0501045_0028851
637 Ga0495595_0034511
638 Ga0500645_005520
639 Ga0501084_0001972
640 Ga0501084_0011154
641 Ga0590074_006452
642 Ga0590077_001000
643 Ga0501082_0001276
644 Ga0501082_0009010
645 Ga0530510_0003234
646 Ga0530510_0051662
647 2676488369
648 2804848926
649 2844853203
650 2856747849
651 2884701934
652 2891396530
653 2891555818
654 2891567880
655 2895433241
656 2895444093
657 8025417537
658 8055181582
659 8056038483
660 8057346230

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jhj-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.8043 3 290
2jhn-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.7951 3 293
2jhj-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.7919 3 290
2jhj-assembly1.cif.gz_A 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.79 3 291
2jhn-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.7878 3 293
ID Description Score Start End Superfamily
2jhnB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8391 117 233 1.10.340.30
3i0xA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8256 117 233 1.10.340.30
4ejzB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8242 117 232 1.10.340.30
af_P9WJW3_319_432_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8208 122 232 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8092 118 233 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A3D2MFF2-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9776 1 277 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A7V8VZH2-F1-model_v4 DNA-3-methyladenine glycosylase 2 family protein 0.9704 1 220 GO:0003824
GO:0006281
AF-A0A0L8QTB1-F1-model_v4 deleted 0.9645 90 292
AF-A0A535TSM9-F1-model_v4 DNA-3-methyladenine glycosylase 2 family protein 0.962 34 243 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A401VTX0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9605 1 288 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map