F410133

General Info

Members Datasets Scaffolds Average Seq Length
330 218 660 248

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10073142|Ga0207702_100731422
Length 298
Sequence VSPDASDRTSPTPTASRVCLYKLTYPHIVRSSGHTELVQHNIPVHPRADLAAVVTIDRGSPVPLYFQVAQALQAAIEAGTLPPGSRLDNEIQLADELGLSRPTMRRAMEYLVGKGLIIRRRGIGTIIVQPKVRRPLQLSSLYDDLRTGGQEPTTSVLSLEVVLAPAEVADSLSLTPGTPVHRLVRLRGANGRPIARMTNYLPATLPGLGVGELTETQLEAAGLYQVLRAAGVHLHAADQTISARKATAEESRVLEEPRGAALLTMQRVAYDDRGRAVEYGTHVYAASRYSFSLSMLNG

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
81 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
82 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
211 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
212 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
213 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
214 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
215 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
216 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
217 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
218 2920879853 Kocuria salina CV6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.3
Nodule 0
Rhizoplane 9.7
Rhizosphere 76.36
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10073142 3300026078 Bacteria 2955
2 JGI25406J46586_10014912 3300003203 Bacteria 3291
3 Ga0070658_10009014 3300005327 Bacteria 8023
4 Ga0068869_100197871 3300005334 Bacteria 1583
5 Ga0070666_10035831 3300005335 Bacteria 3290
6 Ga0070682_100093058 3300005337 Bacteria 1976
7 Ga0068868_100364167 3300005338 Bacteria 1241
8 Ga0070668_100334541 3300005347 Bacteria 1278
9 Ga0070668_100339161 3300005347 Bacteria 1269
10 Ga0070667_100022538 3300005367 Bacteria 5222
11 Ga0070667_100066680 3300005367 Bacteria 3059
12 Ga0070709_10198740 3300005434 Unclassified 1418
13 Ga0070709_10206036 3300005434 Bacteria 1395
14 Ga0070714_100020361 3300005435 Bacteria 5417
15 Ga0070714_100032801 3300005435 Bacteria 4337
16 Ga0070714_100176659 3300005435 Bacteria 1940
17 Ga0070713_100062523 3300005436 Bacteria 3118
18 Ga0070713_100193327 3300005436 Bacteria 1835
19 Ga0070700_100360741 3300005441 Bacteria 1080
20 Ga0070698_100003844 3300005471 Bacteria 16514
21 Ga0070684_100004830 3300005535 Bacteria 10297
22 Ga0070684_100593229 3300005535 Bacteria 1030
23 Ga0070665_100010691 3300005548 Bacteria 9292
24 Ga0068856_100345010 3300005614 Bacteria 1507
25 Ga0068863_100000501 3300005841 Bacteria 39833
26 Ga0068863_100257104 3300005841 Bacteria 1688
27 Ga0068858_100042548 3300005842 Bacteria 4212
28 Ga0068860_100000357 3300005843 Bacteria 60525
29 Ga0068860_100000646 3300005843 Bacteria 40734
30 Ga0081538_10082757 3300005981 Bacteria 1700
31 Ga0081540_1002580 3300005983 Bacteria 14707
32 Ga0081540_1120345 3300005983 Bacteria 1091
33 Ga0081539_10012897 3300005985 Bacteria 6364
34 Ga0081539_10069456 3300005985 Bacteria 1896
35 Ga0070717_10151085 3300006028 Bacteria 2009
36 Ga0075365_10103268 3300006038 Bacteria 1953
37 Ga0075365_10108227 3300006038 Bacteria 1909
38 Ga0075365_10308124 3300006038 Bacteria 1115
39 Ga0075368_10000054 3300006042 Bacteria 28035
40 Ga0075363_100004577 3300006048 Bacteria 6065
41 Ga0075363_100015260 3300006048 Bacteria 3773
42 Ga0075363_100061024 3300006048 Bacteria 2031
43 Ga0075364_10026325 3300006051 Bacteria 3710
44 Ga0075364_10082518 3300006051 Bacteria 2127
45 Ga0075364_10291982 3300006051 Bacteria 1110
46 Ga0070715_10095875 3300006163 Bacteria 1374
47 Ga0070716_100054788 3300006173 Bacteria 2279
48 Ga0070716_100152216 3300006173 Bacteria 1489
49 Ga0070716_100206521 3300006173 Bacteria 1309
50 Ga0070712_100630619 3300006175 Bacteria 909
51 Ga0075362_10128444 3300006177 Bacteria 1204
52 Ga0075367_10002241 3300006178 Bacteria 8740
53 Ga0075370_10087609 3300006353 Bacteria 1794
54 Ga0075370_10099482 3300006353 Bacteria 1682
55 Ga0068871_100449405 3300006358 Bacteria 1155
56 Ga0075428_100077666 3300006844 Bacteria 3624
57 Ga0075431_100230939 3300006847 Bacteria 1885
58 Ga0075433_10314306 3300006852 Bacteria 1386
59 Ga0075434_100135311 3300006871 Bacteria 2484
60 Ga0075429_100384911 3300006880 Bacteria 1228
61 Ga0075429_100424104 3300006880 Bacteria 1165
62 Ga0075436_100061866 3300006914 Bacteria 2587
63 Ga0075435_100030728 3300007076 Bacteria 4226
64 Ga0105244_10004263 3300009036 Bacteria 9920
65 Ga0105247_10026949 3300009101 Bacteria 3474
66 Ga0114129_10000051 3300009147 Bacteria 101583
67 Ga0114129_10403078 3300009147 Bacteria 1802
68 Ga0105243_10095099 3300009148 Bacteria 2462
69 Ga0105242_10267521 3300009176 Bacteria 1547
70 Ga0105246_10009480 3300011119 Bacteria 5998
71 Ga0157369_10023712 3300013105 Bacteria 6833
72 Ga0163162_10065019 3300013306 Bacteria 3693
73 Ga0157372_10311792 3300013307 Bacteria 1831
74 Ga0157375_10206244 3300013308 Bacteria 2122
75 Ga0157375_10471335 3300013308 Bacteria 1421
76 Ga0157375_10705825 3300013308 Bacteria 1162
77 Ga0163163_10158923 3300014325 Bacteria 2305
78 Ga0157379_10058265 3300014968 Bacteria 3453
79 Ga0207655_1035288 3300025728 Bacteria 2235
80 Ga0207692_10031124 3300025898 Bacteria 2552
81 Ga0207692_10078919 3300025898 Bacteria 1755
82 Ga0207680_10002698 3300025903 Bacteria 8292
83 Ga0207699_10063632 3300025906 Bacteria 2229
84 Ga0207699_10174852 3300025906 Bacteria 1439
85 Ga0207663_10060748 3300025916 Bacteria 2396
86 Ga0207663_10200176 3300025916 Bacteria 1440
87 Ga0207663_10212032 3300025916 Bacteria 1404
88 Ga0207700_10072481 3300025928 Bacteria 2656
89 Ga0207700_10170783 3300025928 Bacteria 1814
90 Ga0207700_10331898 3300025928 Bacteria 1320
91 Ga0207664_10037508 3300025929 Bacteria 3752
92 Ga0207664_10043723 3300025929 Bacteria 3506
93 Ga0207664_10079500 3300025929 Bacteria 2662
94 Ga0207664_10083753 3300025929 Bacteria 2600
95 Ga0207664_10260569 3300025929 Bacteria 1516
96 Ga0207664_10354221 3300025929 Bacteria 1299
97 Ga0207709_10095551 3300025935 Bacteria 1953
98 Ga0207665_10031159 3300025939 Bacteria 3528
99 Ga0207689_10020549 3300025942 Bacteria 5555
100 Ga0207679_10076873 3300025945 Bacteria 2538
101 Ga0207668_10324101 3300025972 Bacteria 1279
102 Ga0207658_10015486 3300025986 Bacteria 5231
103 Ga0207677_10315697 3300026023 Bacteria 1297
104 Ga0207703_10032291 3300026035 Bacteria 4143
105 Ga0207702_10340762 3300026078 Bacteria 1432
106 Ga0207641_10014067 3300026088 Bacteria 6560
107 Ga0207683_10205629 3300026121 Bacteria 1791
108 Ga0209813_10001330 3300027866 Bacteria 5530
109 Ga0268266_10014352 3300028379 Bacteria 6813
110 Ga0268264_10000530 3300028381 Bacteria 48308
111 Ga0268264_10005320 3300028381 Bacteria 10901
112 Ga0268264_10344250 3300028381 Bacteria 1417
113 Ga0265340_10000966 3300031247 Bacteria 16391
114 Ga0307513_10000135 3300031456 Bacteria 103254
115 Ga0307410_10144804 3300031852 Bacteria 1762
116 Ga0307410_10158466 3300031852 Bacteria 1693
117 Ga0307409_100147108 3300031995 Bacteria 2039
118 Ga0307416_100115433 3300032002 Bacteria 2378
119 Ga0307416_100643721 3300032002 Bacteria 1144
120 Ga0373948_0000204 3300034817 Bacteria 6830
121 Ga0373950_0002323 3300034818 Bacteria 2608
122 Ga0373958_0002408 3300034819 Bacteria 2618
123 Ga0373926_0001463 3300035083 Bacteria 7191
124 Ga0373928_0010481 3300035084 Bacteria 1822
125 Ga0373929_0015181 3300035085 Bacteria 1495
126 Ga0373934_0018323 3300035086 Bacteria 2678
127 Ga0373934_0110091 3300035086 Bacteria 1116
128 Ga0373944_0001058 3300035089 Bacteria 6803
129 Ga0373923_0130612 3300035111 Unclassified 1128
130 Ga0373932_0065240 3300035112 Bacteria 1116
131 Ga0373936_0000396 3300035113 Bacteria 14759
132 Ga0373945_0001355 3300035116 Bacteria 7448
133 Ga0373953_0019370 3300035117 Bacteria 2530
134 Ga0373956_0009645 3300035119 Bacteria 3931
135 Ga0373956_0015536 3300035119 Bacteria 3189
136 Ga0373957_0009989 3300035120 Bacteria 3123
137 Ga0373957_0032923 3300035120 Bacteria 1912
138 Ga0373960_0107835 3300035121 Bacteria 910
139 Ga0373943_0000325 3300035170 Bacteria 19885
140 Ga0373946_0000069 3300035171 Bacteria 27568
141 Ga0373946_0021241 3300035171 Bacteria 2516
142 Ga0373955_0003938 3300035172 Bacteria 6547
143 Ga0373955_0030677 3300035172 Bacteria 2809
144 Ga0373955_0091061 3300035172 Bacteria 1738
145 Ga0373955_0288181 3300035172 Bacteria 989
146 Ga0373961_0058405 3300035241 Bacteria 1163
147 Ga0373962_0008679 3300035242 Bacteria 2506
148 Ga0373931_0278840 3300035691 Bacteria 1025
149 Ga0373935_0000749 3300035692 Bacteria 17256
150 Ga0373935_0034541 3300035692 Bacteria 3152
151 Ga0373935_0076857 3300035692 Bacteria 2163
152 Ga0373927_0001455 3300035695 Bacteria 17854
153 Ga0373927_0032505 3300035695 Bacteria 3398
154 Ga0373933_0000434 3300035724 Bacteria 26252
155 Ga0373933_0032981 3300035724 Bacteria 3010
156 Ga0373947_0001054 3300035725 Bacteria 16819
157 Ga0373947_0053168 3300035725 Bacteria 2441
158 Ga0373937_0015913 3300036401 Bacteria 6670
159 Ga0373937_1305154 3300036401 Bacteria 674
160 Ga0373925_0024167 3300037068 Bacteria 4436
161 Ga0373925_0146038 3300037068 Bacteria 1854
162 Ga0395905_0085535 3300037471 Bacteria 2955
163 Ga0395901_0042502 3300038443 Bacteria 4712
164 Ga0436363_0000677 3300039450 Bacteria 2618
165 Ga0451791_0057542 3300041451 Bacteria 839
166 Ga0451833_0416799 3300041491 Bacteria 1129
167 Ga0451837_0962703 3300041494 Bacteria 2134
168 Ga0451843_1073798 3300041509 Bacteria 3409
169 Ga0466965_0263595 3300044683 Bacteria 927
170 Ga0466966_0120505 3300044684 Bacteria 1612
171 Ga0466963_0154457 3300044694 Bacteria 1595
172 Ga0466957_0117891 3300044842 Bacteria 1690
173 Ga0466967_0043317 3300045976 Bacteria 3897
174 Ga0466967_0109943 3300045976 Bacteria 2531
175 Ga0466967_0513525 3300045976 Bacteria 1177
176 Ga0466967_0718740 3300045976 Bacteria 990
177 Ga0495592_0024346 3300046454 Bacteria 4603
178 Ga0495629_0008427 3300046459 Bacteria 7587
179 Ga0495638_0044448 3300046460 Bacteria 2798
180 Ga0495641_0031639 3300046461 Bacteria 2526
181 Ga0495651_0025943 3300046462 Bacteria 4562
182 Ga0495651_0048781 3300046462 Bacteria 3269
183 Ga0495653_0019384 3300046463 Bacteria 5517
184 Ga0495653_0033951 3300046463 Bacteria 4038
185 Ga0495653_0055675 3300046463 Bacteria 3017
186 Ga0495580_0017262 3300046472 Bacteria 5403
187 Ga0495580_0128667 3300046472 Bacteria 1757
188 Ga0495639_0009459 3300046475 Bacteria 4179
189 Ga0495662_0020354 3300046476 Bacteria 3209
190 Ga0495664_0000883 3300046477 Bacteria 15417
191 Ga0495664_0003645 3300046477 Bacteria 8392
192 Ga0495608_0030543 3300046511 Bacteria 3647
193 Ga0495608_0042839 3300046511 Bacteria 3026
194 Ga0495618_0073575 3300046514 Bacteria 2175
195 Ga0495628_0025702 3300046516 Bacteria 4809
196 Ga0495630_0010326 3300046517 Bacteria 6740
197 Ga0495630_0017626 3300046517 Bacteria 5234
198 Ga0495642_0044957 3300046528 Unclassified 1804
199 Ga0495652_0023623 3300046529 Bacteria 5449
200 Ga0495665_0042008 3300046531 Bacteria 2434
201 Ga0495640_0067246 3300046533 Bacteria 2414
202 Ga0495640_0076305 3300046533 Bacteria 2236
203 Ga0495586_0002391 3300046535 Bacteria 10194
204 Ga0495587_0005814 3300046536 Bacteria 8034
205 Ga0495587_0123950 3300046536 Bacteria 1479
206 Ga0495645_0031471 3300046543 Bacteria 3866
207 Ga0495645_0040424 3300046543 Bacteria 3402
208 Ga0495667_0007721 3300046559 Bacteria 7291
209 Ga0495667_0054124 3300046559 Bacteria 2641
210 Ga0495667_0060751 3300046559 Bacteria 2478
211 Ga0495668_0185895 3300046616 Bacteria 1138
212 Ga0495634_0026118 3300046642 Bacteria 4077
213 Ga0495634_0028037 3300046642 Bacteria 3912
214 Ga0495634_0096783 3300046642 Bacteria 1911
215 Ga0495635_0002280 3300046663 Bacteria 13041
216 Ga0495635_0018315 3300046663 Bacteria 4886
217 Ga0495635_0050838 3300046663 Bacteria 2856
218 Ga0495588_0002118 3300046674 Bacteria 8519
219 Ga0495588_0052153 3300046674 Bacteria 2108
220 Ga0495657_0005036 3300046675 Bacteria 10498
221 Ga0495657_0013862 3300046675 Bacteria 5932
222 Ga0495599_0036420 3300046678 Bacteria 3090
223 Ga0495599_0037316 3300046678 Bacteria 3052
224 Ga0495599_0122145 3300046678 Bacteria 1619
225 Ga0495646_0131207 3300046680 Bacteria 1410
226 Ga0495646_0165646 3300046680 Bacteria 1221
227 Ga0495658_0084865 3300046683 Bacteria 1865
228 Ga0495613_0063527 3300046689 Bacteria 2701
229 Ga0495624_0003425 3300046690 Bacteria 11767
230 Ga0495600_0022122 3300046809 Bacteria 4080
231 Ga0495600_0060714 3300046809 Bacteria 2469
232 Ga0495581_0001475 3300047315 Bacteria 13089
233 Ga0495581_0048477 3300047315 Bacteria 2453
234 Ga0495604_0012405 3300047317 Bacteria 6774
235 Ga0495674_0000343 3300047319 Bacteria 41172
236 Ga0495674_0091648 3300047319 Bacteria 2595
237 Ga0495676_0004107 3300047321 Bacteria 13268
238 Ga0495676_0080405 3300047321 Bacteria 2475
239 Ga0495680_0045832 3300047322 Bacteria 3450
240 Ga0495680_0076384 3300047322 Bacteria 2540
241 Ga0495680_0270652 3300047322 Bacteria 1199
242 Ga0495675_0004360 3300047444 Bacteria 8564
243 Ga0495684_0002771 3300047471 Bacteria 13830
244 Ga0495684_0049367 3300047471 Bacteria 3215
245 Ga0495593_0079827 3300047673 Bacteria 1693
246 Ga0495602_0042209 3300048088 Bacteria 4158
247 Ga0496100_0187534 3300048903 Bacteria 1499
248 Ga0496101_0125898 3300048904 Bacteria 1941
249 Ga0496101_0275856 3300048904 Bacteria 1313
250 Ga0496102_0004220 3300048905 Bacteria 12146
251 Ga0496102_0133583 3300048905 Bacteria 2324
252 Ga0496102_0497086 3300048905 Bacteria 1141
253 Ga0496103_0003587 3300048906 Bacteria 9469
254 Ga0496103_0260130 3300048906 Bacteria 1117
255 Ga0496104_0121884 3300048907 Bacteria 2503
256 Ga0496104_0321382 3300048907 Bacteria 1460
257 Ga0496105_0201935 3300048908 Bacteria 1622
258 Ga0496105_0345416 3300048908 Bacteria 1189
259 Ga0496106_0100292 3300048909 Bacteria 2245
260 Ga0496107_0043099 3300048910 Bacteria 3242
261 Ga0496108_0196361 3300048911 Bacteria 1750
262 Ga0496109_0133575 3300048912 Bacteria 2318
263 Ga0496109_0289085 3300048912 Bacteria 1545
264 Ga0496109_0459032 3300048912 Bacteria 1203
265 Ga0496110_0056785 3300048913 Bacteria 3445
266 Ga0496110_0058393 3300048913 Bacteria 3398
267 Ga0496111_0004251 3300048914 Bacteria 9025
268 Ga0496112_0053712 3300048915 Bacteria 3958
269 Ga0496112_0385272 3300048915 Bacteria 1343
270 Ga0496113_0072399 3300048916 Bacteria 2623
271 Ga0496113_0209387 3300048916 Bacteria 1552
272 Ga0496114_0012166 3300048917 Bacteria 6886
273 Ga0496114_0062646 3300048917 Bacteria 3113
274 Ga0496114_0187483 3300048917 Bacteria 1808
275 Ga0496114_0205418 3300048917 Bacteria 1726
276 Ga0496115_0013540 3300048918 Bacteria 6170
277 Ga0496115_0316788 3300048918 Bacteria 1276
278 Ga0501034_0593285 3300049571 Bacteria 1014
279 Ga0501041_0100653 3300049577 Bacteria 1789
280 Ga0501042_0080834 3300049578 Bacteria 2329
281 Ga0501067_0050981 3300049583 Bacteria 2294
282 Ga0501068_0037496 3300049584 Bacteria 2902
283 Ga0501071_0263732 3300049587 Bacteria 1301
284 Ga0501072_0251222 3300049588 Bacteria 1408
285 Ga0501074_0204327 3300049590 Bacteria 1408
286 Ga0501076_0255249 3300049592 Bacteria 1435
287 Ga0501081_0312697 3300049743 Bacteria 1154
288 Ga0501045_0047349 3300049824 Bacteria 3132
289 Ga0501045_0296556 3300049824 Bacteria 1203
290 nmdc:mga03n38_10739_c1 3300050490 Bacteria 3383
291 nmdc:mga03n38_263520_c1 3300050490 Bacteria 914
292 nmdc:mga03n38_512192_c1 3300050490 Bacteria 675
293 nmdc:mga03n38_69822_c1 3300050490 Bacteria 1623
294 nmdc:mga00v17_22074_c1 3300050491 Bacteria 3668
295 nmdc:mga00v17_545456_c1 3300050491 Unclassified 750
296 nmdc:mga0yw44_133344_c1 3300050492 Bacteria 1610
297 nmdc:mga0yw44_161054_c1 3300050492 Bacteria 1469
298 nmdc:mga0yw44_24640_c1 3300050492 Bacteria 3408
299 nmdc:mga0yw44_391174_c1 3300050492 Bacteria 939
300 nmdc:mga06z11_117223_c1 3300050494 Bacteria 1482
301 nmdc:mga04h51_1335_c1 3300050495 Bacteria 5684
302 nmdc:mga07m45_11336_c1 3300050496 Bacteria 4681
303 nmdc:mga05p37_944167_c1 3300050507 Bacteria 924
304 nmdc:mga09592_317725_c1 3300050508 Bacteria 1349
305 nmdc:mga06r32_191410_c1 3300050510 Bacteria 2033
306 nmdc:mga0n895_36895_c1 3300050512 Bacteria 4723
307 nmdc:mga0rr50_62269_c1 3300050513 Bacteria 2814
308 nmdc:mga08x19_107889_c1 3300050514 Bacteria 1854
309 nmdc:mga08x19_248947_c1 3300050514 Bacteria 1226
310 Ga0495601_0023201 3300053077 Bacteria 3812
311 Ga0495601_0329158 3300053077 Bacteria 994
312 Ga0495612_0039436 3300053078 Bacteria 1921
313 Ga0495595_0021161 3300053084 Bacteria 2838
314 Ga0495619_0035772 3300053085 Bacteria 3231
315 Ga0495619_0042600 3300053085 Bacteria 2974
316 Ga0500646_0000419 3300053090 Bacteria 12613
317 Ga0500641_0104630 3300053096 Unclassified 1215
318 Ga0500559_0042357 3300053136 Bacteria 1986
319 Ga0500588_0001691 3300053146 Bacteria 4272
320 Ga0500616_0000145 3300053153 Bacteria 120927
321 Ga0500616_0000900 3300053153 Bacteria 32632
322 2515850765 2515154155 Bacteria 7985436
323 2816511201 2816332139 Bacteria 9138787
324 2837275441 2837268691 Bacteria 7850704
325 2866553858 2866552031 Bacteria 5824618
326 2868089648 2868088558 Bacteria 7609351
327 2891397906 2891395885 Bacteria 9251614
328 2891559702 2891554331 Bacteria 8812224
329 2895430489 2895427314 Bacteria 13147766
330 2920883364 2920879853 Bacteria 4216831
331 Ga0207702_10073142
332 JGI25406J46586_10014912
333 Ga0070658_10009014
334 Ga0068869_100197871
335 Ga0070666_10035831
336 Ga0070682_100093058
337 Ga0068868_100364167
338 Ga0070668_100334541
339 Ga0070668_100339161
340 Ga0070667_100022538
341 Ga0070667_100066680
342 Ga0070709_10198740
343 Ga0070709_10206036
344 Ga0070714_100020361
345 Ga0070714_100032801
346 Ga0070714_100176659
347 Ga0070713_100062523
348 Ga0070713_100193327
349 Ga0070700_100360741
350 Ga0070698_100003844
351 Ga0070684_100004830
352 Ga0070684_100593229
353 Ga0070665_100010691
354 Ga0068856_100345010
355 Ga0068863_100000501
356 Ga0068863_100257104
357 Ga0068858_100042548
358 Ga0068860_100000357
359 Ga0068860_100000646
360 Ga0081538_10082757
361 Ga0081540_1002580
362 Ga0081540_1120345
363 Ga0081539_10012897
364 Ga0081539_10069456
365 Ga0070717_10151085
366 Ga0075365_10103268
367 Ga0075365_10108227
368 Ga0075365_10308124
369 Ga0075368_10000054
370 Ga0075363_100004577
371 Ga0075363_100015260
372 Ga0075363_100061024
373 Ga0075364_10026325
374 Ga0075364_10082518
375 Ga0075364_10291982
376 Ga0070715_10095875
377 Ga0070716_100054788
378 Ga0070716_100152216
379 Ga0070716_100206521
380 Ga0070712_100630619
381 Ga0075362_10128444
382 Ga0075367_10002241
383 Ga0075370_10087609
384 Ga0075370_10099482
385 Ga0068871_100449405
386 Ga0075428_100077666
387 Ga0075431_100230939
388 Ga0075433_10314306
389 Ga0075434_100135311
390 Ga0075429_100384911
391 Ga0075429_100424104
392 Ga0075436_100061866
393 Ga0075435_100030728
394 Ga0105244_10004263
395 Ga0105247_10026949
396 Ga0114129_10000051
397 Ga0114129_10403078
398 Ga0105243_10095099
399 Ga0105242_10267521
400 Ga0105246_10009480
401 Ga0157369_10023712
402 Ga0163162_10065019
403 Ga0157372_10311792
404 Ga0157375_10206244
405 Ga0157375_10471335
406 Ga0157375_10705825
407 Ga0163163_10158923
408 Ga0157379_10058265
409 Ga0207655_1035288
410 Ga0207692_10031124
411 Ga0207692_10078919
412 Ga0207680_10002698
413 Ga0207699_10063632
414 Ga0207699_10174852
415 Ga0207663_10060748
416 Ga0207663_10200176
417 Ga0207663_10212032
418 Ga0207700_10072481
419 Ga0207700_10170783
420 Ga0207700_10331898
421 Ga0207664_10037508
422 Ga0207664_10043723
423 Ga0207664_10079500
424 Ga0207664_10083753
425 Ga0207664_10260569
426 Ga0207664_10354221
427 Ga0207709_10095551
428 Ga0207665_10031159
429 Ga0207689_10020549
430 Ga0207679_10076873
431 Ga0207668_10324101
432 Ga0207658_10015486
433 Ga0207677_10315697
434 Ga0207703_10032291
435 Ga0207702_10340762
436 Ga0207641_10014067
437 Ga0207683_10205629
438 Ga0209813_10001330
439 Ga0268266_10014352
440 Ga0268264_10000530
441 Ga0268264_10005320
442 Ga0268264_10344250
443 Ga0265340_10000966
444 Ga0307513_10000135
445 Ga0307410_10144804
446 Ga0307410_10158466
447 Ga0307409_100147108
448 Ga0307416_100115433
449 Ga0307416_100643721
450 Ga0373948_0000204
451 Ga0373950_0002323
452 Ga0373958_0002408
453 Ga0373926_0001463
454 Ga0373928_0010481
455 Ga0373929_0015181
456 Ga0373934_0018323
457 Ga0373934_0110091
458 Ga0373944_0001058
459 Ga0373923_0130612
460 Ga0373932_0065240
461 Ga0373936_0000396
462 Ga0373945_0001355
463 Ga0373953_0019370
464 Ga0373956_0009645
465 Ga0373956_0015536
466 Ga0373957_0009989
467 Ga0373957_0032923
468 Ga0373960_0107835
469 Ga0373943_0000325
470 Ga0373946_0000069
471 Ga0373946_0021241
472 Ga0373955_0003938
473 Ga0373955_0030677
474 Ga0373955_0091061
475 Ga0373955_0288181
476 Ga0373961_0058405
477 Ga0373962_0008679
478 Ga0373931_0278840
479 Ga0373935_0000749
480 Ga0373935_0034541
481 Ga0373935_0076857
482 Ga0373927_0001455
483 Ga0373927_0032505
484 Ga0373933_0000434
485 Ga0373933_0032981
486 Ga0373947_0001054
487 Ga0373947_0053168
488 Ga0373937_0015913
489 Ga0373937_1305154
490 Ga0373925_0024167
491 Ga0373925_0146038
492 Ga0395905_0085535
493 Ga0395901_0042502
494 Ga0436363_0000677
495 Ga0451791_0057542
496 Ga0451833_0416799
497 Ga0451837_0962703
498 Ga0451843_1073798
499 Ga0466965_0263595
500 Ga0466966_0120505
501 Ga0466963_0154457
502 Ga0466957_0117891
503 Ga0466967_0043317
504 Ga0466967_0109943
505 Ga0466967_0513525
506 Ga0466967_0718740
507 Ga0495592_0024346
508 Ga0495629_0008427
509 Ga0495638_0044448
510 Ga0495641_0031639
511 Ga0495651_0025943
512 Ga0495651_0048781
513 Ga0495653_0019384
514 Ga0495653_0033951
515 Ga0495653_0055675
516 Ga0495580_0017262
517 Ga0495580_0128667
518 Ga0495639_0009459
519 Ga0495662_0020354
520 Ga0495664_0000883
521 Ga0495664_0003645
522 Ga0495608_0030543
523 Ga0495608_0042839
524 Ga0495618_0073575
525 Ga0495628_0025702
526 Ga0495630_0010326
527 Ga0495630_0017626
528 Ga0495642_0044957
529 Ga0495652_0023623
530 Ga0495665_0042008
531 Ga0495640_0067246
532 Ga0495640_0076305
533 Ga0495586_0002391
534 Ga0495587_0005814
535 Ga0495587_0123950
536 Ga0495645_0031471
537 Ga0495645_0040424
538 Ga0495667_0007721
539 Ga0495667_0054124
540 Ga0495667_0060751
541 Ga0495668_0185895
542 Ga0495634_0026118
543 Ga0495634_0028037
544 Ga0495634_0096783
545 Ga0495635_0002280
546 Ga0495635_0018315
547 Ga0495635_0050838
548 Ga0495588_0002118
549 Ga0495588_0052153
550 Ga0495657_0005036
551 Ga0495657_0013862
552 Ga0495599_0036420
553 Ga0495599_0037316
554 Ga0495599_0122145
555 Ga0495646_0131207
556 Ga0495646_0165646
557 Ga0495658_0084865
558 Ga0495613_0063527
559 Ga0495624_0003425
560 Ga0495600_0022122
561 Ga0495600_0060714
562 Ga0495581_0001475
563 Ga0495581_0048477
564 Ga0495604_0012405
565 Ga0495674_0000343
566 Ga0495674_0091648
567 Ga0495676_0004107
568 Ga0495676_0080405
569 Ga0495680_0045832
570 Ga0495680_0076384
571 Ga0495680_0270652
572 Ga0495675_0004360
573 Ga0495684_0002771
574 Ga0495684_0049367
575 Ga0495593_0079827
576 Ga0495602_0042209
577 Ga0496100_0187534
578 Ga0496101_0125898
579 Ga0496101_0275856
580 Ga0496102_0004220
581 Ga0496102_0133583
582 Ga0496102_0497086
583 Ga0496103_0003587
584 Ga0496103_0260130
585 Ga0496104_0121884
586 Ga0496104_0321382
587 Ga0496105_0201935
588 Ga0496105_0345416
589 Ga0496106_0100292
590 Ga0496107_0043099
591 Ga0496108_0196361
592 Ga0496109_0133575
593 Ga0496109_0289085
594 Ga0496109_0459032
595 Ga0496110_0056785
596 Ga0496110_0058393
597 Ga0496111_0004251
598 Ga0496112_0053712
599 Ga0496112_0385272
600 Ga0496113_0072399
601 Ga0496113_0209387
602 Ga0496114_0012166
603 Ga0496114_0062646
604 Ga0496114_0187483
605 Ga0496114_0205418
606 Ga0496115_0013540
607 Ga0496115_0316788
608 Ga0501034_0593285
609 Ga0501041_0100653
610 Ga0501042_0080834
611 Ga0501067_0050981
612 Ga0501068_0037496
613 Ga0501071_0263732
614 Ga0501072_0251222
615 Ga0501074_0204327
616 Ga0501076_0255249
617 Ga0501081_0312697
618 Ga0501045_0047349
619 Ga0501045_0296556
620 nmdc:mga03n38_10739_c1
621 nmdc:mga03n38_263520_c1
622 nmdc:mga03n38_512192_c1
623 nmdc:mga03n38_69822_c1
624 nmdc:mga00v17_22074_c1
625 nmdc:mga00v17_545456_c1
626 nmdc:mga0yw44_133344_c1
627 nmdc:mga0yw44_161054_c1
628 nmdc:mga0yw44_24640_c1
629 nmdc:mga0yw44_391174_c1
630 nmdc:mga06z11_117223_c1
631 nmdc:mga04h51_1335_c1
632 nmdc:mga07m45_11336_c1
633 nmdc:mga05p37_944167_c1
634 nmdc:mga09592_317725_c1
635 nmdc:mga06r32_191410_c1
636 nmdc:mga0n895_36895_c1
637 nmdc:mga0rr50_62269_c1
638 nmdc:mga08x19_107889_c1
639 nmdc:mga08x19_248947_c1
640 Ga0495601_0023201
641 Ga0495601_0329158
642 Ga0495612_0039436
643 Ga0495595_0021161
644 Ga0495619_0035772
645 Ga0495619_0042600
646 Ga0500646_0000419
647 Ga0500641_0104630
648 Ga0500559_0042357
649 Ga0500588_0001691
650 Ga0500616_0000145
651 Ga0500616_0000900
652 2515850765
653 2816511201
654 2837275441
655 2866553858
656 2868089648
657 2891397906
658 2891559702
659 2895430489
660 2920883364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07702

UTRA

UTRA domain

147

290

0.98

PF00392

GntR

Bacterial regulatory proteins, gntR family

64

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9648 20 92
2ra5-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator from streptomyces coelicolor 0.9464 116 258
2p19-assembly2.cif.gz_B-2 crystal structure of bacterial regulatory protein of gntr family from corynebacterium glutamicum 0.9373 117 257
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9359 19 92
3cnv-assembly1.cif.gz_A crystal structure of the ligand-binding domain of a putative gntr-family transcriptional regulator from bordetella bronchiseptica 0.9316 117 256
ID Description Score Start End Superfamily
2ra5A01 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.9582 116 244 3.40.1410.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 19 92 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9474 50 92 1.10.10.10
af_P0ACM5_96_247_3.40.1410.10 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.9456 102 254 3.40.1410.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.944 19 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1M4RV99-F1-model_v4 Transcription regulator hth gntr 0.9842 19 92 GO:0003677
GO:0003700
AF-A0A3D5S2I1-F1-model_v4 GntR family transcriptional regulator 0.9829 14 92 GO:0003677
GO:0003700
GO:0005737
GO:0009058
GO:0030170
AF-A0A0S7WV58-F1-model_v4 HTH gntR-type domain-containing protein 0.9788 18 92 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-A0A5J4J5N0-F1-model_v4 GntR family transcriptional regulator 0.9773 19 92 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A351KFC4-F1-model_v4 GntR family transcriptional regulator 0.9737 19 92 GO:0003677
GO:0003700

Map