F410119

General Info

Members Datasets Scaffolds Average Seq Length
330 192 660 253

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10197374|Ga0207644_101973742
Length 273
Sequence MSEPAIQVSELSRRFGDFTAVDRVSFEVNEGEVFGFLGANGAGKTTAIRMLIGLLQPTSGTARVAGYDVATQAEQVKRRIGYMSQRFSLYEDLTPRENIRLYGGIYGLTREQIRTRTAQMLDRLGLSRVADAAVRSLPLGWRQKLAFSVALVHQPRIVFLDEPTSGVDPITRRQFWELIYDAAANGTTVLVTTHYMDEAEYCDRISIMVAGRIAAMGAPADLKRDYRVSSIDEVEQHNLTRRGRRRPMVRMKPRAPASGARRLRPSDTPATSR

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.33
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10197374 3300025931 Bacteria 1586
2 Ga0065715_10161971 3300005293 Bacteria 1621
3 Ga0065707_10007593 3300005295 Bacteria 2641
4 Ga0065707_10121943 3300005295 Bacteria 2099
5 Ga0065707_10138568 3300005295 Bacteria 1804
6 Ga0070683_100005063 3300005329 Bacteria 10945
7 Ga0070683_100074068 3300005329 Bacteria 3180
8 Ga0070683_100088373 3300005329 Bacteria 2907
9 Ga0070690_100053529 3300005330 Bacteria 2582
10 Ga0070670_100029892 3300005331 Bacteria 4692
11 Ga0068869_100012773 3300005334 Bacteria 5555
12 Ga0070666_10335790 3300005335 Bacteria 1080
13 Ga0070680_100008368 3300005336 Bacteria 7921
14 Ga0070682_100021561 3300005337 Bacteria 3804
15 Ga0068868_100016485 3300005338 Bacteria 5488
16 Ga0070689_100018011 3300005340 Bacteria 5195
17 Ga0070689_100042311 3300005340 Bacteria 3498
18 Ga0070661_100085711 3300005344 Bacteria 2328
19 Ga0070661_100597223 3300005344 Bacteria 892
20 Ga0070692_10216404 3300005345 Bacteria 1130
21 Ga0070668_100089090 3300005347 Bacteria 2430
22 Ga0070669_100009238 3300005353 Bacteria 7023
23 Ga0070675_100005885 3300005354 Bacteria 9397
24 Ga0070675_100027058 3300005354 Bacteria 4606
25 Ga0070675_100040541 3300005354 Bacteria 3802
26 Ga0070675_100052936 3300005354 Bacteria 3338
27 Ga0070674_100309863 3300005356 Bacteria 1262
28 Ga0070673_100044705 3300005364 Bacteria 3431
29 Ga0070673_100175246 3300005364 Bacteria 1833
30 Ga0070688_100385445 3300005365 Bacteria 1034
31 Ga0070659_100001386 3300005366 Bacteria 17476
32 Ga0070713_100033890 3300005436 Bacteria 4096
33 Ga0070705_100000952 3300005440 Bacteria 16213
34 Ga0070705_100048680 3300005440 Bacteria 2457
35 Ga0070705_100261450 3300005440 Bacteria 1221
36 Ga0070700_100051832 3300005441 Bacteria 2556
37 Ga0070694_100003312 3300005444 Bacteria 9637
38 Ga0070694_100022591 3300005444 Bacteria 4032
39 Ga0070694_100025218 3300005444 Bacteria 3846
40 Ga0070694_100448176 3300005444 Bacteria 1019
41 Ga0070678_100237757 3300005456 Bacteria 1521
42 Ga0070678_100321359 3300005456 Bacteria 1322
43 Ga0070678_100433342 3300005456 Bacteria 1148
44 Ga0070678_100460793 3300005456 Bacteria 1115
45 Ga0070662_100097559 3300005457 Bacteria 2218
46 Ga0070681_10003838 3300005458 Bacteria 14131
47 Ga0070681_10028206 3300005458 Bacteria 5643
48 Ga0070681_10598934 3300005458 Bacteria 1016
49 Ga0068867_100000964 3300005459 Bacteria 19605
50 Ga0068867_100022559 3300005459 Bacteria 4500
51 Ga0068867_100034728 3300005459 Bacteria 3657
52 Ga0068867_100240346 3300005459 Bacteria 1468
53 Ga0068867_100530309 3300005459 Bacteria 1017
54 Ga0070685_10283534 3300005466 Bacteria 1110
55 Ga0070707_100596723 3300005468 Bacteria 1067
56 Ga0070707_100645634 3300005468 Bacteria 1021
57 Ga0070698_100038628 3300005471 Bacteria 4918
58 Ga0070699_100002383 3300005518 Bacteria 16856
59 Ga0070684_100032632 3300005535 Bacteria 4439
60 Ga0070684_100042872 3300005535 Bacteria 3907
61 Ga0070684_100064872 3300005535 Bacteria 3204
62 Ga0070684_100066547 3300005535 Bacteria 3163
63 Ga0070684_100080987 3300005535 Bacteria 2873
64 Ga0070697_100171996 3300005536 Bacteria 1834
65 Ga0068853_100735968 3300005539 Bacteria 942
66 Ga0070686_100001409 3300005544 Bacteria 13568
67 Ga0070686_100048097 3300005544 Bacteria 2701
68 Ga0070695_100008806 3300005545 Bacteria 5998
69 Ga0070695_100117938 3300005545 Bacteria 1812
70 Ga0070696_100007468 3300005546 Bacteria 7312
71 Ga0070696_100131222 3300005546 Bacteria 1823
72 Ga0070696_100181949 3300005546 Bacteria 1560
73 Ga0070693_100001357 3300005547 Bacteria 11014
74 Ga0070665_100013736 3300005548 Bacteria 8150
75 Ga0070704_100000619 3300005549 Bacteria 17129
76 Ga0070704_100026250 3300005549 Bacteria 3847
77 Ga0070704_100035851 3300005549 Bacteria 3375
78 Ga0070704_100158430 3300005549 Bacteria 1788
79 Ga0068855_100136615 3300005563 Bacteria 2797
80 Ga0068855_100166260 3300005563 Bacteria 2500
81 Ga0070664_100114322 3300005564 Bacteria 2358
82 Ga0070664_100538575 3300005564 Unclassified 1079
83 Ga0068857_100002035 3300005577 Bacteria 16386
84 Ga0068857_100026042 3300005577 Bacteria 5152
85 Ga0068854_100013404 3300005578 Bacteria 5380
86 Ga0068854_100324867 3300005578 Bacteria 1252
87 Ga0068856_100008392 3300005614 Bacteria 10065
88 Ga0070702_100026824 3300005615 Bacteria 3101
89 Ga0068852_100038846 3300005616 Bacteria 4004
90 Ga0068859_100001614 3300005617 Bacteria 23045
91 Ga0068859_100002475 3300005617 Bacteria 18783
92 Ga0068859_100322623 3300005617 Bacteria 1638
93 Ga0068859_100594583 3300005617 Bacteria 1200
94 Ga0068864_100063159 3300005618 Bacteria 3209
95 Ga0068864_100088339 3300005618 Bacteria 2730
96 Ga0068864_100254723 3300005618 Bacteria 1631
97 Ga0068861_100003034 3300005719 Bacteria 11094
98 Ga0068870_10000856 3300005840 Bacteria 11876
99 Ga0068870_10024973 3300005840 Bacteria 2962
100 Ga0068863_100035769 3300005841 Bacteria 4729
101 Ga0068858_100102779 3300005842 Bacteria 2666
102 Ga0068858_100231450 3300005842 Bacteria 1752
103 Ga0068860_100005929 3300005843 Bacteria 12295
104 Ga0068860_100062036 3300005843 Bacteria 3552
105 Ga0068860_100130177 3300005843 Bacteria 2414
106 Ga0068862_100000787 3300005844 Bacteria 31411
107 Ga0081455_10012624 3300005937 Bacteria 8412
108 Ga0070716_100215650 3300006173 Bacteria 1286
109 Ga0097621_100000962 3300006237 Bacteria 20193
110 Ga0097621_100014111 3300006237 Bacteria 5972
111 Ga0097621_100019847 3300006237 Bacteria 5169
112 Ga0097621_100161597 3300006237 Bacteria 1926
113 Ga0068871_100031533 3300006358 Bacteria 4181
114 Ga0068871_100032224 3300006358 Bacteria 4138
115 Ga0068871_100036347 3300006358 Bacteria 3921
116 Ga0068871_100066123 3300006358 Bacteria 2963
117 Ga0075433_10245670 3300006852 Bacteria 1589
118 Ga0075434_100012160 3300006871 Bacteria 8151
119 Ga0075434_100032229 3300006871 Bacteria 5167
120 Ga0075434_100564659 3300006871 Bacteria 1157
121 Ga0075429_100562146 3300006880 Bacteria 1000
122 Ga0068865_100021247 3300006881 Bacteria 4220
123 Ga0075436_100120870 3300006914 Bacteria 1832
124 Ga0097620_100001614 3300006931 Bacteria 23045
125 Ga0097620_100002475 3300006931 Bacteria 18783
126 Ga0097620_100322613 3300006931 Bacteria 1638
127 Ga0097620_100594640 3300006931 Bacteria 1200
128 Ga0075435_100009519 3300007076 Bacteria 7040
129 Ga0075435_100012591 3300007076 Bacteria 6266
130 Ga0075435_100054745 3300007076 Bacteria 3220
131 Ga0075435_100133014 3300007076 Bacteria 2082
132 Ga0105245_10082931 3300009098 Bacteria 2933
133 Ga0114129_10041818 3300009147 Bacteria 6453
134 Ga0105243_10316726 3300009148 Bacteria 1420
135 Ga0105243_10585190 3300009148 Bacteria 1072
136 Ga0105241_10006392 3300009174 Bacteria 8683
137 Ga0105241_10007752 3300009174 Bacteria 7893
138 Ga0105241_10219005 3300009174 Bacteria 1599
139 Ga0105242_10001858 3300009176 Bacteria 16563
140 Ga0105242_10048695 3300009176 Bacteria 3445
141 Ga0105242_10188740 3300009176 Bacteria 1823
142 Ga0105248_10030256 3300009177 Bacteria 6045
143 Ga0105248_10083473 3300009177 Bacteria 3594
144 Ga0105248_10131963 3300009177 Bacteria 2818
145 Ga0105248_10358519 3300009177 Bacteria 1641
146 Ga0105237_10146562 3300009545 Bacteria 2356
147 Ga0105238_10283511 3300009551 Bacteria 1638
148 Ga0105238_10320408 3300009551 Bacteria 1536
149 Ga0105246_10008291 3300011119 Bacteria 6381
150 Ga0157371_10006058 3300013102 Bacteria 10060
151 Ga0157370_10000540 3300013104 Bacteria 47409
152 Ga0157370_10097282 3300013104 Bacteria 2761
153 Ga0157374_10014564 3300013296 Bacteria 6884
154 Ga0163162_10077242 3300013306 Bacteria 3393
155 Ga0157372_10021769 3300013307 Bacteria 6930
156 Ga0157372_10713904 3300013307 Bacteria 1166
157 Ga0157375_10003060 3300013308 Bacteria 14523
158 Ga0157375_10234099 3300013308 Bacteria 1996
159 Ga0157375_10438931 3300013308 Bacteria 1471
160 Ga0163163_10021681 3300014325 Bacteria 6066
161 Ga0163163_10059272 3300014325 Bacteria 3786
162 Ga0157377_10002044 3300014745 Bacteria 8849
163 Ga0157376_10009844 3300014969 Bacteria 6969
164 Ga0157376_10015416 3300014969 Bacteria 5774
165 Ga0157376_10130329 3300014969 Bacteria 2243
166 Ga0157376_10146771 3300014969 Bacteria 2123
167 Ga0157376_10352289 3300014969 Bacteria 1409
168 Ga0213876_10022182 3300021384 Bacteria 3358
169 Ga0207642_10170424 3300025899 Bacteria 1177
170 Ga0207643_10001398 3300025908 Bacteria 13836
171 Ga0207643_10002245 3300025908 Bacteria 10526
172 Ga0207654_10130232 3300025911 Bacteria 1591
173 Ga0207707_10006252 3300025912 Bacteria 10399
174 Ga0207695_10096076 3300025913 Bacteria 2966
175 Ga0207695_10139889 3300025913 Bacteria 2370
176 Ga0207671_10099298 3300025914 Bacteria 2203
177 Ga0207660_10016362 3300025917 Bacteria 4908
178 Ga0207662_10009778 3300025918 Bacteria 5290
179 Ga0207662_10043767 3300025918 Bacteria 2642
180 Ga0207649_10218231 3300025920 Bacteria 1357
181 Ga0207652_10089414 3300025921 Bacteria 2704
182 Ga0207646_10188321 3300025922 Bacteria 1864
183 Ga0207646_10357159 3300025922 Bacteria 1320
184 Ga0207681_10008111 3300025923 Bacteria 6424
185 Ga0207694_10196051 3300025924 Bacteria 1642
186 Ga0207694_10265649 3300025924 Bacteria 1407
187 Ga0207650_10099823 3300025925 Bacteria 2232
188 Ga0207659_10000650 3300025926 Bacteria 20706
189 Ga0207659_10161392 3300025926 Bacteria 1760
190 Ga0207659_10211495 3300025926 Bacteria 1554
191 Ga0207659_10247820 3300025926 Bacteria 1444
192 Ga0207700_10063634 3300025928 Bacteria 2807
193 Ga0207644_10124056 3300025931 Bacteria 1969
194 Ga0207690_10087239 3300025932 Bacteria 2195
195 Ga0207706_10010860 3300025933 Bacteria 8308
196 Ga0207686_10063704 3300025934 Bacteria 2345
197 Ga0207709_10199012 3300025935 Bacteria 1429
198 Ga0207670_10003411 3300025936 Bacteria 8435
199 Ga0207670_10029263 3300025936 Bacteria 3507
200 Ga0207704_10011510 3300025938 Bacteria 4357
201 Ga0207665_10182129 3300025939 Bacteria 1522
202 Ga0207691_10067928 3300025940 Bacteria 3221
203 Ga0207691_10285013 3300025940 Bacteria 1421
204 Ga0207711_10164484 3300025941 Bacteria 2010
205 Ga0207689_10000783 3300025942 Bacteria 30512
206 Ga0207661_10000568 3300025944 Bacteria 23560
207 Ga0207661_10056036 3300025944 Bacteria 3164
208 Ga0207661_10063932 3300025944 Bacteria 2982
209 Ga0207661_10137116 3300025944 Bacteria 2102
210 Ga0207679_10062717 3300025945 Bacteria 2771
211 Ga0207679_10066148 3300025945 Bacteria 2707
212 Ga0207667_10129755 3300025949 Bacteria 2596
213 Ga0207667_10200251 3300025949 Bacteria 2049
214 Ga0207651_10110013 3300025960 Bacteria 2066
215 Ga0207651_10151066 3300025960 Bacteria 1808
216 Ga0207651_10361544 3300025960 Bacteria 1225
217 Ga0207640_10012114 3300025981 Bacteria 4902
218 Ga0207677_10069067 3300026023 Bacteria 2483
219 Ga0207677_10210671 3300026023 Bacteria 1552
220 Ga0207703_10014682 3300026035 Bacteria 6112
221 Ga0207703_10189417 3300026035 Bacteria 1821
222 Ga0207639_10141081 3300026041 Bacteria 2007
223 Ga0207708_10003395 3300026075 Bacteria 11728
224 Ga0207708_10015754 3300026075 Bacteria 5673
225 Ga0207702_10094450 3300026078 Bacteria 2625
226 Ga0207641_10115206 3300026088 Bacteria 2389
227 Ga0207648_10001651 3300026089 Bacteria 24463
228 Ga0207648_10006827 3300026089 Bacteria 11308
229 Ga0207648_10030989 3300026089 Bacteria 4730
230 Ga0207676_10005132 3300026095 Bacteria 9270
231 Ga0207676_10069070 3300026095 Bacteria 2828
232 Ga0207676_10215795 3300026095 Bacteria 1705
233 Ga0207674_10000285 3300026116 Bacteria 64094
234 Ga0207674_10003589 3300026116 Bacteria 18913
235 Ga0207674_10234237 3300026116 Bacteria 1784
236 Ga0207674_10348113 3300026116 Bacteria 1433
237 Ga0207675_100002912 3300026118 Bacteria 16830
238 Ga0207675_100357803 3300026118 Bacteria 1432
239 Ga0207683_10108887 3300026121 Bacteria 2480
240 Ga0207683_10227918 3300026121 Bacteria 1699
241 Ga0207683_10620567 3300026121 Bacteria 1001
242 Ga0207698_10015836 3300026142 Bacteria 5065
243 Ga0207698_10094969 3300026142 Bacteria 2453
244 Ga0207428_10175047 3300027907 Bacteria 1624
245 Ga0268266_10028446 3300028379 Bacteria 4751
246 Ga0268266_10156173 3300028379 Bacteria 2061
247 Ga0268265_10000519 3300028380 Bacteria 39355
248 Ga0268264_10007519 3300028381 Bacteria 9088
249 Ga0268264_10061761 3300028381 Bacteria 3144
250 Ga0268264_10550615 3300028381 Bacteria 1131
251 Ga0268264_10806547 3300028381 Bacteria 938
252 Ga0373958_0005672 3300034819 Bacteria 1909
253 Ga0373928_0008705 3300035084 Bacteria 1975
254 Ga0373934_0003551 3300035086 Bacteria 5733
255 Ga0373949_0003868 3300035090 Bacteria 3479
256 Ga0373956_0042704 3300035119 Bacteria 2016
257 Ga0373956_0252654 3300035119 Bacteria 838
258 Ga0373957_0088659 3300035120 Bacteria 1227
259 Ga0373955_0004001 3300035172 Bacteria 6508
260 Ga0373924_0054330 3300035410 Bacteria 1665
261 Ga0373927_0010333 3300035695 Bacteria 6233
262 Ga0373937_0014304 3300036401 Bacteria 7004
263 Ga0373937_0082326 3300036401 Bacteria 2978
264 Ga0395898_0358394 3300037466 Bacteria 1391
265 Ga0436365_1749240 3300039437 Bacteria 7137
266 Ga0451577_0192480 3300042876 Bacteria 1840
267 Ga0466963_0080238 3300044694 Bacteria 2209
268 Ga0466957_0330652 3300044842 Bacteria 1030
269 Ga0466957_0332111 3300044842 Bacteria 1028
270 Ga0451576_0008366 3300045051 Bacteria 12150
271 Ga0451576_0097905 3300045051 Bacteria 3050
272 Ga0451576_0121691 3300045051 Bacteria 2717
273 Ga0451576_0166050 3300045051 Bacteria 2304
274 Ga0466967_0045060 3300045976 Bacteria 3831
275 Ga0495651_0049473 3300046462 Bacteria 3244
276 Ga0495639_0056277 3300046475 Bacteria 1795
277 Ga0495594_0245072 3300046499 Bacteria 1021
278 Ga0495665_0077176 3300046531 Bacteria 1753
279 Ga0495621_0116309 3300046539 Bacteria 1030
280 Ga0495645_0000127 3300046543 Bacteria 51432
281 Ga0495634_0116624 3300046642 Bacteria 1713
282 Ga0495659_0010731 3300046664 Bacteria 2947
283 Ga0495588_0010180 3300046674 Bacteria 4363
284 Ga0495623_0002198 3300046679 Bacteria 12998
285 Ga0495600_0016232 3300046809 Bacteria 4722
286 Ga0495604_0082355 3300047317 Bacteria 2407
287 Ga0495636_0026081 3300047318 Bacteria 2375
288 Ga0495676_0052066 3300047321 Bacteria 3271
289 Ga0495675_0002369 3300047444 Bacteria 11261
290 Ga0495685_026743 3300047447 Bacteria 1984
291 Ga0496100_0083956 3300048903 Bacteria 2158
292 Ga0496101_0008615 3300048904 Bacteria 6668
293 Ga0496104_0027270 3300048907 Bacteria 5286
294 Ga0496105_0178488 3300048908 Bacteria 1739
295 Ga0496105_0571432 3300048908 Bacteria 880
296 Ga0496106_0228666 3300048909 Bacteria 1485
297 Ga0496106_0341723 3300048909 Bacteria 1202
298 Ga0496106_0541834 3300048909 Bacteria 934
299 Ga0496107_0022076 3300048910 Bacteria 4497
300 Ga0496108_0425183 3300048911 Bacteria 1160
301 Ga0496114_0043050 3300048917 Bacteria 3744
302 Ga0501032_0083877 3300049569 Bacteria 2119
303 Ga0501033_0031817 3300049570 Bacteria 3961
304 Ga0501034_0019805 3300049571 Bacteria 6876
305 Ga0501034_0091526 3300049571 Bacteria 3039
306 Ga0501037_0032163 3300049573 Bacteria 3873
307 Ga0501043_0270336 3300049579 Bacteria 1305
308 Ga0501047_0007504 3300049581 Bacteria 10263
309 Ga0501047_0027605 3300049581 Bacteria 5469
310 Ga0501048_0427846 3300049582 Bacteria 947
311 Ga0501035_0000390 3300049822 Bacteria 50364
312 Ga0501044_0004940 3300049823 Bacteria 14912
313 nmdc:mga09592_122165_c1 3300050508 Bacteria 2237
314 nmdc:mga09592_36638_c1 3300050508 Bacteria 4109
315 nmdc:mga08y16_133296_c1 3300050511 Bacteria 2583
316 nmdc:mga08y16_24682_c1 3300050511 Bacteria 6344
317 nmdc:mga0n895_2504_c1 3300050512 Bacteria 14376
318 nmdc:mga0n895_317372_c1 3300050512 Bacteria 1579
319 nmdc:mga0rr50_100729_c1 3300050513 Bacteria 2269
320 nmdc:mga0rr50_1067_c1 3300050513 Bacteria 14898
321 nmdc:mga0rr50_317051_c1 3300050513 Bacteria 1306
322 nmdc:mga0rr50_341635_c1 3300050513 Bacteria 1258
323 nmdc:mga0rr50_727473_c1 3300050513 Bacteria 847
324 nmdc:mga08x19_122037_c1 3300050514 Bacteria 1748
325 nmdc:mga08x19_12794_c1 3300050514 Bacteria 5062
326 nmdc:mga0a205_147049_c1 3300050515 Bacteria 2257
327 nmdc:mga0a205_253620_c1 3300050515 Bacteria 1638
328 nmdc:mga0a205_38064_c1 3300050515 Bacteria 4627
329 Ga0495619_0128997 3300053085 Bacteria 1737
330 Ga0466962_0175272 3300061719 Bacteria 1045
331 Ga0207644_10197374
332 Ga0065715_10161971
333 Ga0065707_10007593
334 Ga0065707_10121943
335 Ga0065707_10138568
336 Ga0070683_100005063
337 Ga0070683_100074068
338 Ga0070683_100088373
339 Ga0070690_100053529
340 Ga0070670_100029892
341 Ga0068869_100012773
342 Ga0070666_10335790
343 Ga0070680_100008368
344 Ga0070682_100021561
345 Ga0068868_100016485
346 Ga0070689_100018011
347 Ga0070689_100042311
348 Ga0070661_100085711
349 Ga0070661_100597223
350 Ga0070692_10216404
351 Ga0070668_100089090
352 Ga0070669_100009238
353 Ga0070675_100005885
354 Ga0070675_100027058
355 Ga0070675_100040541
356 Ga0070675_100052936
357 Ga0070674_100309863
358 Ga0070673_100044705
359 Ga0070673_100175246
360 Ga0070688_100385445
361 Ga0070659_100001386
362 Ga0070713_100033890
363 Ga0070705_100000952
364 Ga0070705_100048680
365 Ga0070705_100261450
366 Ga0070700_100051832
367 Ga0070694_100003312
368 Ga0070694_100022591
369 Ga0070694_100025218
370 Ga0070694_100448176
371 Ga0070678_100237757
372 Ga0070678_100321359
373 Ga0070678_100433342
374 Ga0070678_100460793
375 Ga0070662_100097559
376 Ga0070681_10003838
377 Ga0070681_10028206
378 Ga0070681_10598934
379 Ga0068867_100000964
380 Ga0068867_100022559
381 Ga0068867_100034728
382 Ga0068867_100240346
383 Ga0068867_100530309
384 Ga0070685_10283534
385 Ga0070707_100596723
386 Ga0070707_100645634
387 Ga0070698_100038628
388 Ga0070699_100002383
389 Ga0070684_100032632
390 Ga0070684_100042872
391 Ga0070684_100064872
392 Ga0070684_100066547
393 Ga0070684_100080987
394 Ga0070697_100171996
395 Ga0068853_100735968
396 Ga0070686_100001409
397 Ga0070686_100048097
398 Ga0070695_100008806
399 Ga0070695_100117938
400 Ga0070696_100007468
401 Ga0070696_100131222
402 Ga0070696_100181949
403 Ga0070693_100001357
404 Ga0070665_100013736
405 Ga0070704_100000619
406 Ga0070704_100026250
407 Ga0070704_100035851
408 Ga0070704_100158430
409 Ga0068855_100136615
410 Ga0068855_100166260
411 Ga0070664_100114322
412 Ga0070664_100538575
413 Ga0068857_100002035
414 Ga0068857_100026042
415 Ga0068854_100013404
416 Ga0068854_100324867
417 Ga0068856_100008392
418 Ga0070702_100026824
419 Ga0068852_100038846
420 Ga0068859_100001614
421 Ga0068859_100002475
422 Ga0068859_100322623
423 Ga0068859_100594583
424 Ga0068864_100063159
425 Ga0068864_100088339
426 Ga0068864_100254723
427 Ga0068861_100003034
428 Ga0068870_10000856
429 Ga0068870_10024973
430 Ga0068863_100035769
431 Ga0068858_100102779
432 Ga0068858_100231450
433 Ga0068860_100005929
434 Ga0068860_100062036
435 Ga0068860_100130177
436 Ga0068862_100000787
437 Ga0081455_10012624
438 Ga0070716_100215650
439 Ga0097621_100000962
440 Ga0097621_100014111
441 Ga0097621_100019847
442 Ga0097621_100161597
443 Ga0068871_100031533
444 Ga0068871_100032224
445 Ga0068871_100036347
446 Ga0068871_100066123
447 Ga0075433_10245670
448 Ga0075434_100012160
449 Ga0075434_100032229
450 Ga0075434_100564659
451 Ga0075429_100562146
452 Ga0068865_100021247
453 Ga0075436_100120870
454 Ga0097620_100001614
455 Ga0097620_100002475
456 Ga0097620_100322613
457 Ga0097620_100594640
458 Ga0075435_100009519
459 Ga0075435_100012591
460 Ga0075435_100054745
461 Ga0075435_100133014
462 Ga0105245_10082931
463 Ga0114129_10041818
464 Ga0105243_10316726
465 Ga0105243_10585190
466 Ga0105241_10006392
467 Ga0105241_10007752
468 Ga0105241_10219005
469 Ga0105242_10001858
470 Ga0105242_10048695
471 Ga0105242_10188740
472 Ga0105248_10030256
473 Ga0105248_10083473
474 Ga0105248_10131963
475 Ga0105248_10358519
476 Ga0105237_10146562
477 Ga0105238_10283511
478 Ga0105238_10320408
479 Ga0105246_10008291
480 Ga0157371_10006058
481 Ga0157370_10000540
482 Ga0157370_10097282
483 Ga0157374_10014564
484 Ga0163162_10077242
485 Ga0157372_10021769
486 Ga0157372_10713904
487 Ga0157375_10003060
488 Ga0157375_10234099
489 Ga0157375_10438931
490 Ga0163163_10021681
491 Ga0163163_10059272
492 Ga0157377_10002044
493 Ga0157376_10009844
494 Ga0157376_10015416
495 Ga0157376_10130329
496 Ga0157376_10146771
497 Ga0157376_10352289
498 Ga0213876_10022182
499 Ga0207642_10170424
500 Ga0207643_10001398
501 Ga0207643_10002245
502 Ga0207654_10130232
503 Ga0207707_10006252
504 Ga0207695_10096076
505 Ga0207695_10139889
506 Ga0207671_10099298
507 Ga0207660_10016362
508 Ga0207662_10009778
509 Ga0207662_10043767
510 Ga0207649_10218231
511 Ga0207652_10089414
512 Ga0207646_10188321
513 Ga0207646_10357159
514 Ga0207681_10008111
515 Ga0207694_10196051
516 Ga0207694_10265649
517 Ga0207650_10099823
518 Ga0207659_10000650
519 Ga0207659_10161392
520 Ga0207659_10211495
521 Ga0207659_10247820
522 Ga0207700_10063634
523 Ga0207644_10124056
524 Ga0207690_10087239
525 Ga0207706_10010860
526 Ga0207686_10063704
527 Ga0207709_10199012
528 Ga0207670_10003411
529 Ga0207670_10029263
530 Ga0207704_10011510
531 Ga0207665_10182129
532 Ga0207691_10067928
533 Ga0207691_10285013
534 Ga0207711_10164484
535 Ga0207689_10000783
536 Ga0207661_10000568
537 Ga0207661_10056036
538 Ga0207661_10063932
539 Ga0207661_10137116
540 Ga0207679_10062717
541 Ga0207679_10066148
542 Ga0207667_10129755
543 Ga0207667_10200251
544 Ga0207651_10110013
545 Ga0207651_10151066
546 Ga0207651_10361544
547 Ga0207640_10012114
548 Ga0207677_10069067
549 Ga0207677_10210671
550 Ga0207703_10014682
551 Ga0207703_10189417
552 Ga0207639_10141081
553 Ga0207708_10003395
554 Ga0207708_10015754
555 Ga0207702_10094450
556 Ga0207641_10115206
557 Ga0207648_10001651
558 Ga0207648_10006827
559 Ga0207648_10030989
560 Ga0207676_10005132
561 Ga0207676_10069070
562 Ga0207676_10215795
563 Ga0207674_10000285
564 Ga0207674_10003589
565 Ga0207674_10234237
566 Ga0207674_10348113
567 Ga0207675_100002912
568 Ga0207675_100357803
569 Ga0207683_10108887
570 Ga0207683_10227918
571 Ga0207683_10620567
572 Ga0207698_10015836
573 Ga0207698_10094969
574 Ga0207428_10175047
575 Ga0268266_10028446
576 Ga0268266_10156173
577 Ga0268265_10000519
578 Ga0268264_10007519
579 Ga0268264_10061761
580 Ga0268264_10550615
581 Ga0268264_10806547
582 Ga0373958_0005672
583 Ga0373928_0008705
584 Ga0373934_0003551
585 Ga0373949_0003868
586 Ga0373956_0042704
587 Ga0373956_0252654
588 Ga0373957_0088659
589 Ga0373955_0004001
590 Ga0373924_0054330
591 Ga0373927_0010333
592 Ga0373937_0014304
593 Ga0373937_0082326
594 Ga0395898_0358394
595 Ga0436365_1749240
596 Ga0451577_0192480
597 Ga0466963_0080238
598 Ga0466957_0330652
599 Ga0466957_0332111
600 Ga0451576_0008366
601 Ga0451576_0097905
602 Ga0451576_0121691
603 Ga0451576_0166050
604 Ga0466967_0045060
605 Ga0495651_0049473
606 Ga0495639_0056277
607 Ga0495594_0245072
608 Ga0495665_0077176
609 Ga0495621_0116309
610 Ga0495645_0000127
611 Ga0495634_0116624
612 Ga0495659_0010731
613 Ga0495588_0010180
614 Ga0495623_0002198
615 Ga0495600_0016232
616 Ga0495604_0082355
617 Ga0495636_0026081
618 Ga0495676_0052066
619 Ga0495675_0002369
620 Ga0495685_026743
621 Ga0496100_0083956
622 Ga0496101_0008615
623 Ga0496104_0027270
624 Ga0496105_0178488
625 Ga0496105_0571432
626 Ga0496106_0228666
627 Ga0496106_0341723
628 Ga0496106_0541834
629 Ga0496107_0022076
630 Ga0496108_0425183
631 Ga0496114_0043050
632 Ga0501032_0083877
633 Ga0501033_0031817
634 Ga0501034_0019805
635 Ga0501034_0091526
636 Ga0501037_0032163
637 Ga0501043_0270336
638 Ga0501047_0007504
639 Ga0501047_0027605
640 Ga0501048_0427846
641 Ga0501035_0000390
642 Ga0501044_0004940
643 nmdc:mga09592_122165_c1
644 nmdc:mga09592_36638_c1
645 nmdc:mga08y16_133296_c1
646 nmdc:mga08y16_24682_c1
647 nmdc:mga0n895_2504_c1
648 nmdc:mga0n895_317372_c1
649 nmdc:mga0rr50_100729_c1
650 nmdc:mga0rr50_1067_c1
651 nmdc:mga0rr50_317051_c1
652 nmdc:mga0rr50_341635_c1
653 nmdc:mga0rr50_727473_c1
654 nmdc:mga08x19_122037_c1
655 nmdc:mga08x19_12794_c1
656 nmdc:mga0a205_147049_c1
657 nmdc:mga0a205_253620_c1
658 nmdc:mga0a205_38064_c1
659 Ga0495619_0128997
660 Ga0466962_0175272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

165

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

128

196

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9631 4 225
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9623 4 225
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9477 4 218
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9463 5 240
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9376 4 218
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9672 3 223 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9612 6 226 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.959 2 225 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9575 2 230 3.40.50.300
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9506 1 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2P6BX22-F1-model_v4 deleted 0.9957 4 239
AF-A0A3N9NGW9-F1-model_v4 ABC transporter ATP-binding protein 0.9938 4 221 GO:0005524
GO:0016887
AF-A0A351F263-F1-model_v4 ABC transporter 0.9938 4 212 GO:0005524
GO:0016887
AF-A0A6A0QWS7-F1-model_v4 ABC transporter ATP-binding protein 0.9933 3 240 GO:0005524
GO:0016887
AF-A0A2V4XU72-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9932 3 240 GO:0005524
GO:0016887

Map