F410067

General Info

Members Datasets Scaffolds Average Seq Length
330 226 279 334

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10171487|Ga0105249_101714871
Length 378
Sequence MDLDAASTEVARNGLFGARLGGNNHKRSSHVELLGEDTNMKKALVSIAFGLTASLFATVASAQATLNSVKQKGLLTCGSNTGLAGFGQPDAQGNWTGLDVDFCRAIAAAIFNDPTKVRFIPLAAKDRFTALQSGEVDVLARNSTATMSRETQLGLDFPAINYYDGQGFMVRKKLGVASAKELNGASICTQQGTTTELNLADYFRANNMKYEVVAFATSDETFKAYDAGRCDAYTTDASGLYAERLRASAPDEQVVLPEIISKEPLGPAVRHGDNQWGDIVRWTHMAMLNAEELGVTKANVDQMKTSDNPEIKRLLGTEGKFGEAIGLPNDWAVRIIKHVGNYGESFDRNVGEGSRLKIKRGQNAQWTKGGLQYGIPVR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2643221733 Bosea sp. Root381 Isolate Unclassified
7 2643221734 Bosea sp. Root670 Isolate Unclassified
8 2643221736 Bosea sp. Root483D1 Isolate Unclassified
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
11 2818991467 Bosea vestrisii 3192 Isolate Unclassified
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2841760612 Bosea sp. Tri-49 Isolate Nodule
14 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
15 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
16 2844104063 Bosea sp. Tri-39 Isolate Nodule
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2851246043 Bosea sp. Tri-54 Isolate Nodule
19 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
20 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
21 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
22 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
23 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
24 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 641522639 Methylobacterium sp. 4-46 Isolate Nodule
225 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
226 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.15
Metatranscriptomes 1.52
Isolates 13.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.88
Nodule 6.67
Rhizoplane 2.73
Rhizosphere 60.91
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001222 3300002987 Bacteria 10879
2 JGI25159J45721_1010754 3300002987 Bacteria 2302
3 JGI25151J46595_10000022 3300003187 Bacteria 223477
4 JGI25151J46595_10000086 3300003187 Bacteria 126250
5 JGI25151J46595_10028663 3300003187 Bacteria 2214
6 JGI25406J46586_10008828 3300003203 Bacteria 4539
7 Ga0007417J51691_1037981 3300003544 Bacteria 1116
8 Ga0006562J51391_1012277 3300003578 Bacteria 2580
9 Ga0032354_1065742 3300003693 Bacteria 1208
10 Ga0055526_1000371 3300003771 Bacteria 36363
11 Ga0055526_1000491 3300003771 Bacteria 31412
12 Ga0055526_1002950 3300003771 Bacteria 11155
13 Ga0055524_1000055 3300003775 Bacteria 141970
14 Ga0055524_1000515 3300003775 Bacteria 29812
15 Ga0055524_1006102 3300003775 Bacteria 5276
16 Ga0055534_1015211 3300003784 Bacteria 1416
17 Ga0065165_1000240 3300005262 Bacteria 93895
18 Ga0065165_1000605 3300005262 Bacteria 52381
19 Ga0070683_100076341 3300005329 Bacteria 3132
20 Ga0068868_100112664 3300005338 Bacteria 2211
21 Ga0070668_100216209 3300005347 Bacteria 1579
22 Ga0070668_100234603 3300005347 Bacteria 1518
23 Ga0070674_100094108 3300005356 Bacteria 2169
24 Ga0070714_100123401 3300005435 Bacteria 2306
25 Ga0070710_10008546 3300005437 Bacteria 4985
26 Ga0070700_100132214 3300005441 Bacteria 1685
27 Ga0070681_10073042 3300005458 Bacteria 3392
28 Ga0070681_10320534 3300005458 Bacteria 1459
29 Ga0070679_100162756 3300005530 Bacteria 2205
30 Ga0070693_100016304 3300005547 Bacteria 3843
31 Ga0068852_100208012 3300005616 Bacteria 1855
32 Ga0068859_100188020 3300005617 Bacteria 2149
33 Ga0081455_10000267 3300005937 Bacteria 68735
34 Ga0081455_10036140 3300005937 Bacteria 4403
35 Ga0081538_10032635 3300005981 Bacteria 3483
36 Ga0081539_10001727 3300005985 Bacteria 34927
37 Ga0081539_10065431 3300005985 Bacteria 1974
38 Ga0070717_10112142 3300006028 Bacteria 2327
39 Ga0075363_100019189 3300006048 Bacteria 3415
40 Ga0075364_10015736 3300006051 Bacteria 4695
41 Ga0075432_10055757 3300006058 Bacteria 1400
42 Ga0075367_10002825 3300006178 Bacteria 8064
43 Ga0075369_10087834 3300006186 Bacteria 1385
44 Ga0075370_10024534 3300006353 Bacteria 3332
45 Ga0075428_100000557 3300006844 Bacteria 38146
46 Ga0075430_100067442 3300006846 Bacteria 3003
47 Ga0075431_100000469 3300006847 Bacteria 33367
48 Ga0075429_100001672 3300006880 Bacteria 18349
49 Ga0097620_100188026 3300006931 Bacteria 2149
50 Ga0105240_10069778 3300009093 Bacteria 4349
51 Ga0105240_10273318 3300009093 Bacteria 1944
52 Ga0111539_10000072 3300009094 Bacteria 100461
53 Ga0111539_10222831 3300009094 Bacteria 2196
54 Ga0105245_10506872 3300009098 Bacteria 1224
55 Ga0105247_10008826 3300009101 Bacteria 6144
56 Ga0105247_10130190 3300009101 Bacteria 1639
57 Ga0114129_10000134 3300009147 Bacteria 76265
58 Ga0105243_10061057 3300009148 Bacteria 3013
59 Ga0105241_10036716 3300009174 Bacteria 3689
60 Ga0105238_10098718 3300009551 Bacteria 2904
61 Ga0105249_10171487 3300009553 Bacteria 2104
62 Ga0105249_10492783 3300009553 Bacteria 1269
63 Ga0105246_10007656 3300011119 Bacteria 6629
64 Ga0105246_10193984 3300011119 Bacteria 1574
65 Ga0157369_10580260 3300013105 Bacteria 1158
66 Ga0171462_1009 3300013250 Bacteria 344993
67 Ga0171462_1011 3300013250 Bacteria 229282
68 Ga0157374_10250277 3300013296 Bacteria 1744
69 Ga0157372_10099521 3300013307 Bacteria 3316
70 Ga0157375_10238272 3300013308 Bacteria 1979
71 Ga0157379_10194004 3300014968 Bacteria 1835
72 Ga0182005_1006965 3300015265 Bacteria 3419
73 Ga0163161_10153226 3300017792 Bacteria 1753
74 Ga0213872_10098116 3300021361 Bacteria 1308
75 Ga0209673_1010338 3300025273 Bacteria 3940
76 Ga0209130_1000061 3300025284 Bacteria 200990
77 Ga0209130_1000182 3300025284 Bacteria 89233
78 Ga0209675_1000514 3300025291 Bacteria 28599
79 Ga0209675_1001083 3300025291 Bacteria 16767
80 Ga0209025_1000016 3300025294 Bacteria 770739
81 Ga0209025_1001097 3300025294 Bacteria 39005
82 Ga0209025_1001935 3300025294 Bacteria 23940
83 Ga0209025_1032705 3300025294 Bacteria 2424
84 Ga0209564_1000023 3300025295 Bacteria 555102
85 Ga0209564_1000034 3300025295 Bacteria 444284
86 Ga0209564_1000035 3300025295 Bacteria 442446
87 Ga0209256_1000025 3300025299 Bacteria 442449
88 Ga0209256_1000026 3300025299 Bacteria 432835
89 Ga0209256_1000188 3300025299 Bacteria 117988
90 Ga0209256_1000338 3300025299 Bacteria 78064
91 Ga0207426_1008639 3300025302 Bacteria 4090
92 Ga0207426_1019319 3300025302 Bacteria 2384
93 Ga0207692_10093998 3300025898 Bacteria 1632
94 Ga0207710_10033902 3300025900 Bacteria 2241
95 Ga0207710_10116371 3300025900 Bacteria 1273
96 Ga0207688_10017395 3300025901 Bacteria 3906
97 Ga0207688_10149923 3300025901 Bacteria 1377
98 Ga0207699_10017773 3300025906 Bacteria 3753
99 Ga0207699_10073387 3300025906 Bacteria 2098
100 Ga0207645_10012166 3300025907 Bacteria 5845
101 Ga0207643_10054561 3300025908 Bacteria 2272
102 Ga0207652_10171317 3300025921 Bacteria 1948
103 Ga0207694_10127066 3300025924 Bacteria 2041
104 Ga0207687_10048401 3300025927 Bacteria 2952
105 Ga0207664_10037954 3300025929 Bacteria 3732
106 Ga0207706_10132193 3300025933 Bacteria 2195
107 Ga0207709_10330089 3300025935 Bacteria 1145
108 Ga0207665_10029302 3300025939 Bacteria 3639
109 Ga0207711_10196276 3300025941 Bacteria 1841
110 Ga0207667_10161485 3300025949 Bacteria 2305
111 Ga0207708_10135009 3300026075 Bacteria 1932
112 Ga0207702_10158967 3300026078 Bacteria 2062
113 Ga0207674_10014030 3300026116 Bacteria 8856
114 Ga0207683_10121478 3300026121 Bacteria 2345
115 Ga0207428_10048427 3300027907 Bacteria 3409
116 Ga0207428_10190529 3300027907 Bacteria 1546
117 Ga0268265_10272317 3300028380 Bacteria 1511
118 Ga0307515_10099321 3300028794 Bacteria 3535
119 Ga0265330_10057000 3300031235 Bacteria 1705
120 Ga0265325_10000126 3300031241 Bacteria 52410
121 Ga0265340_10024953 3300031247 Bacteria 3032
122 Ga0265339_10029436 3300031249 Bacteria 3115
123 Ga0265339_10070482 3300031249 Bacteria 1864
124 Ga0265331_10040474 3300031250 Bacteria 2267
125 Ga0265316_10110877 3300031344 Bacteria 2078
126 Ga0265313_10001517 3300031595 Bacteria 21611
127 Ga0307508_10028105 3300031616 Bacteria 5088
128 Ga0265314_10004668 3300031711 Bacteria 12587
129 Ga0265342_10015013 3300031712 Bacteria 5114
130 Ga0307410_10021608 3300031852 Bacteria 3961
131 Ga0307406_10033288 3300031901 Bacteria 3154
132 Ga0307409_100007098 3300031995 Bacteria 6669
133 Ga0307409_100367246 3300031995 Bacteria 1363
134 Ga0307416_100213707 3300032002 Bacteria 1842
135 Ga0307415_100103707 3300032126 Bacteria 2093
136 Ga0307510_10171384 3300033180 Bacteria 1749
137 Ga0316592_1022706 3300033524 Bacteria 1343
138 Ga0316586_1012998 3300033527 Bacteria 1298
139 Ga0373954_0003650 3300035118 Bacteria 6549
140 Ga0373955_0046660 3300035172 Bacteria 2343
141 Ga0373947_0172987 3300035725 Bacteria 1402
142 Ga0373937_0075436 3300036401 Bacteria 3113
143 Ga0316584_0013703 3300036712 Bacteria 5747
144 Ga0395905_0167996 3300037471 Bacteria 2061
145 Ga0436364_0815154 3300037853 Bacteria 1594
146 Ga0400483_231684 3300039062 Bacteria 27106
147 Ga0436360_0171584 3300039438 Bacteria 1054
148 Ga0436360_1030342 3300039438 Bacteria 1170
149 Ga0436361_0440245 3300039447 Bacteria 6044
150 Ga0436361_1157610 3300039447 Bacteria 4250
151 Ga0436363_0281915 3300039450 Bacteria 4344
152 Ga0439465_0023145 3300041413 Bacteria 1955
153 Ga0451807_0676874 3300041486 Bacteria 1667
154 Ga0466972_0037557 3300044658 Bacteria 2368
155 Ga0466963_0249478 3300044694 Bacteria 1246
156 Ga0466968_0012922 3300044735 Bacteria 3276
157 Ga0466957_0106786 3300044842 Bacteria 1771
158 Ga0451576_0012600 3300045051 Bacteria 9493
159 Ga0495651_0136634 3300046462 Bacteria 1782
160 Ga0495608_0048314 3300046511 Bacteria 2828
161 Ga0495610_0017643 3300046512 Bacteria 4063
162 Ga0495610_0028418 3300046512 Bacteria 2958
163 Ga0495643_0046322 3300046522 Bacteria 2358
164 Ga0495652_0065030 3300046529 Bacteria 3066
165 Ga0495645_0240034 3300046543 Bacteria 1210
166 Ga0495658_0039229 3300046683 Bacteria 2627
167 Ga0495600_0054107 3300046809 Bacteria 2622
168 Ga0495674_0038910 3300047319 Bacteria 4265
169 Ga0495680_0007421 3300047322 Bacteria 10056
170 Ga0496105_0049555 3300048908 Bacteria 3468
171 Ga0496108_0016920 3300048911 Bacteria 5959
172 Ga0496109_0017782 3300048912 Bacteria 6235
173 Ga0496110_0001321 3300048913 Bacteria 17806
174 Ga0496111_0002237 3300048914 Bacteria 11619
175 Ga0496112_0017718 3300048915 Bacteria 6702
176 Ga0496113_0331099 3300048916 Bacteria 1221
177 Ga0496115_0218174 3300048918 Bacteria 1574
178 Ga0496117_0041650 3300048920 Bacteria 3361
179 Ga0496117_0054888 3300048920 Bacteria 2788
180 Ga0496121_0169475 3300048924 Bacteria 1588
181 Ga0496122_0053652 3300048925 Bacteria 3036
182 Ga0496122_0063340 3300048925 Bacteria 2699
183 Ga0496122_0067909 3300048925 Bacteria 2564
184 Ga0496122_0078467 3300048925 Bacteria 2312
185 Ga0496122_0182271 3300048925 Bacteria 1251
186 Ga0496123_0015741 3300048926 Bacteria 6185
187 Ga0496123_0033346 3300048926 Bacteria 3708
188 Ga0496123_0045139 3300048926 Bacteria 3005
189 Ga0496123_0160916 3300048926 Bacteria 1197
190 Ga0496124_0141401 3300048927 Bacteria 1899
191 Ga0496125_0050770 3300048928 Bacteria 3430
192 Ga0496126_0120057 3300048929 Bacteria 2281
193 Ga0501032_0043338 3300049569 Bacteria 3049
194 Ga0501032_0050809 3300049569 Bacteria 2795
195 Ga0501032_0206728 3300049569 Bacteria 1280
196 Ga0501033_0020861 3300049570 Bacteria 4946
197 Ga0501033_0084941 3300049570 Bacteria 2319
198 Ga0501034_0000247 3300049571 Bacteria 99828
199 Ga0501034_0001519 3300049571 Bacteria 30483
200 Ga0501034_0134813 3300049571 Bacteria 2450
201 Ga0501034_0143170 3300049571 Bacteria 2369
202 Ga0501034_0144195 3300049571 Bacteria 2359
203 Ga0501036_0008853 3300049572 Bacteria 8263
204 Ga0501037_0013607 3300049573 Bacteria 5993
205 Ga0501037_0020329 3300049573 Bacteria 4901
206 Ga0501037_0038446 3300049573 Bacteria 3525
207 Ga0501038_0050438 3300049574 Bacteria 3595
208 Ga0501039_0100197 3300049575 Bacteria 2261
209 Ga0501042_0026000 3300049578 Bacteria 4114
210 Ga0501043_0000802 3300049579 Bacteria 27890
211 Ga0501043_0018562 3300049579 Bacteria 5457
212 Ga0501043_0045857 3300049579 Bacteria 3436
213 Ga0501046_0157886 3300049580 Bacteria 1707
214 Ga0501047_0000010 3300049581 Bacteria 429357
215 Ga0501047_0030607 3300049581 Bacteria 5188
216 Ga0501047_0180657 3300049581 Bacteria 1976
217 Ga0501047_0261722 3300049581 Bacteria 1577
218 Ga0501048_0115029 3300049582 Bacteria 1900
219 Ga0501068_0007815 3300049584 Bacteria 5924
220 Ga0501068_0017675 3300049584 Bacteria 4126
221 Ga0501069_0011989 3300049585 Bacteria 4600
222 Ga0501070_0010561 3300049586 Bacteria 7805
223 Ga0501070_0029893 3300049586 Bacteria 4564
224 Ga0501070_0234075 3300049586 Bacteria 1505
225 Ga0501072_0020389 3300049588 Bacteria 5136
226 Ga0501073_0032612 3300049589 Bacteria 3713
227 Ga0501073_0035449 3300049589 Bacteria 3547
228 Ga0501073_0081596 3300049589 Bacteria 2250
229 Ga0501073_0221303 3300049589 Bacteria 1308
230 Ga0501074_0016185 3300049590 Bacteria 5419
231 Ga0501074_0071918 3300049590 Bacteria 2486
232 Ga0501074_0102624 3300049590 Bacteria 2047
233 Ga0501075_0284672 3300049591 Bacteria 1259
234 Ga0501076_0065550 3300049592 Bacteria 2897
235 Ga0501077_0148630 3300049593 Bacteria 1487
236 Ga0501252_001370 3300049682 Bacteria 2230
237 Ga0501079_0025415 3300049741 Bacteria 4543
238 Ga0501079_0162485 3300049741 Bacteria 1742
239 Ga0501079_0253049 3300049741 Bacteria 1377
240 Ga0501080_0000100 3300049742 Bacteria 58925
241 Ga0501080_0174772 3300049742 Bacteria 1979
242 Ga0501081_0145526 3300049743 Bacteria 1700
243 Ga0501083_0007675 3300049744 Bacteria 7648
244 Ga0501083_0048508 3300049744 Bacteria 2866
245 Ga0501035_0002492 3300049822 Bacteria 17989
246 Ga0501035_0014656 3300049822 Bacteria 7237
247 Ga0501035_0068014 3300049822 Bacteria 3159
248 Ga0501044_0003158 3300049823 Bacteria 18625
249 Ga0501044_0101007 3300049823 Bacteria 2902
250 Ga0501044_0119019 3300049823 Bacteria 2644
251 Ga0501045_0009682 3300049824 Bacteria 6742
252 Ga0501212_004350 3300049851 Bacteria 1825
253 nmdc:mga03n38_62284_c1 3300050490 Bacteria 1701
254 nmdc:mga00v17_63938_c1 3300050491 Bacteria 2267
255 nmdc:mga0k408_28990_c1 3300050493 Bacteria 3149
256 nmdc:mga06z11_22723_c1 3300050494 Bacteria 2934
257 nmdc:mga04h51_22465_c1 3300050495 Bacteria 1909
258 nmdc:mga07m45_24927_c1 3300050496 Bacteria 3279
259 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
260 nmdc:mga09592_2220_c1 3300050508 Bacteria 15638
261 nmdc:mga0qj67_106336_c1 3300050509 Bacteria 2264
262 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
263 nmdc:mga08y16_426516_c1 3300050511 Bacteria 1355
264 nmdc:mga08y16_79_c1 3300050511 Bacteria 27781
265 Ga0495601_0025328 3300053077 Bacteria 3658
266 Ga0495612_0108145 3300053078 Bacteria 1188
267 Ga0495595_0006826 3300053084 Bacteria 4658
268 Ga0495619_0000271 3300053085 Bacteria 37662
269 Ga0500650_0063500 3300053098 Bacteria 1725
270 Ga0500562_039332 3300053108 Bacteria 1257
271 Ga0500608_093113 3300053122 Bacteria 1406
272 Ga0500642_0044682 3300053130 Bacteria 1930
273 Ga0500616_0014186 3300053153 Bacteria 4587
274 Ga0500616_0082874 3300053153 Bacteria 1608
275 Ga0500622_0009056 3300053156 Bacteria 5531
276 Ga0500622_0017584 3300053156 Bacteria 3806
277 Ga0500622_0055523 3300053156 Bacteria 2029
278 Ga0501084_0100925 3300054114 Bacteria 2423
279 Ga0501082_0059831 3300060353 Bacteria 3282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031711 Ga0265314_10004668 Ga0265314_100046688 291
2 3300049569 Ga0501032_0050809 Ga0501032_0050809_308_1324 291
3 3300049570 Ga0501033_0020861 Ga0501033_0020861_3472_4488 291
4 3300049571 Ga0501034_0144195 Ga0501034_0144195_1090_2106 291
5 3300049573 Ga0501037_0038446 Ga0501037_0038446_1981_2997 291
6 3300049579 Ga0501043_0018562 Ga0501043_0018562_4144_5160 291
7 3300049581 Ga0501047_0030607 Ga0501047_0030607_828_1844 291
8 3300049584 Ga0501068_0007815 Ga0501068_0007815_910_1926 291
9 3300049586 Ga0501070_0029893 Ga0501070_0029893_2101_3117 291
10 3300049589 Ga0501073_0081596 Ga0501073_0081596_432_1448 291
11 3300049590 Ga0501074_0016185 Ga0501074_0016185_933_1949 291
12 3300049741 Ga0501079_0025415 Ga0501079_0025415_3270_4286 291
13 3300049742 Ga0501080_0174772 Ga0501080_0174772_401_1417 291
14 3300049822 Ga0501035_0014656 Ga0501035_0014656_2064_3080 291
15 3300049823 Ga0501044_0101007 Ga0501044_0101007_1545_2561 291
16 3300035725 Ga0373947_0172987 Ga0373947_0172987_84_1094 292
17 3300005437 Ga0070710_10008546 Ga0070710_100085465 294
18 3300006028 Ga0070717_10112142 Ga0070717_101121422 294
19 3300006186 Ga0075369_10087834 Ga0075369_100878342 294
20 3300025898 Ga0207692_10093998 Ga0207692_100939982 294
21 3300025906 Ga0207699_10017773 Ga0207699_100177733 294
22 3300025939 Ga0207665_10029302 Ga0207665_100293023 294
23 3300028794 Ga0307515_10099321 Ga0307515_100993212 294
24 3300046512 Ga0495610_0028418 Ga0495610_0028418_975_1997 294
25 3300046522 Ga0495643_0046322 Ga0495643_0046322_1124_2146 294
26 3300053156 Ga0500622_0055523 Ga0500622_0055523_852_1874 294
27 3300005530 Ga0070679_100162756 Ga0070679_1001627562 295
28 3300025921 Ga0207652_10171317 Ga0207652_101713172 295
29 3300025929 Ga0207664_10037954 Ga0207664_100379541 295
30 3300044694 Ga0466963_0249478 Ga0466963_0249478_135_1229 296
31 3300049569 Ga0501032_0206728 Ga0501032_0206728_44_1060 296
32 3300049570 Ga0501033_0084941 Ga0501033_0084941_812_1828 296
33 3300049580 Ga0501046_0157886 Ga0501046_0157886_540_1556 296
34 3300049582 Ga0501048_0115029 Ga0501048_0115029_337_1353 296
35 3300049588 Ga0501072_0020389 Ga0501072_0020389_2629_3645 296
36 3300049589 Ga0501073_0032612 Ga0501073_0032612_1287_2303 296
37 3300049590 Ga0501074_0102624 Ga0501074_0102624_732_1748 296
38 3300049592 Ga0501076_0065550 Ga0501076_0065550_1319_2335 296
39 3300060353 Ga0501082_0059831 Ga0501082_0059831_873_1889 296
40 3300005458 Ga0070681_10073042 Ga0070681_100730422 297
41 3300044842 Ga0466957_0106786 Ga0466957_0106786_514_1527 297
42 3300049571 Ga0501034_0143170 Ga0501034_0143170_327_1352 297
43 3300048925 Ga0496122_0053652 Ga0496122_0053652_529_1554 298
44 3300048925 Ga0496122_0182271 Ga0496122_0182271_85_1107 298
45 3300049571 Ga0501034_0134813 Ga0501034_0134813_505_1629 298
46 3300049572 Ga0501036_0008853 Ga0501036_0008853_4059_5183 298
47 3300049573 Ga0501037_0020329 Ga0501037_0020329_2783_3907 298
48 3300049574 Ga0501038_0050438 Ga0501038_0050438_732_1856 298
49 3300049575 Ga0501039_0100197 Ga0501039_0100197_1118_2242 298
50 3300049579 Ga0501043_0045857 Ga0501043_0045857_1947_3071 298
51 3300049581 Ga0501047_0180657 Ga0501047_0180657_822_1946 298
52 3300049584 Ga0501068_0017675 Ga0501068_0017675_413_1537 298
53 3300049586 Ga0501070_0010561 Ga0501070_0010561_5130_6254 298
54 3300049822 Ga0501035_0068014 Ga0501035_0068014_500_1624 298
55 3300053108 Ga0500562_039332 Ga0500562_039332_97_1113 306
56 3300035172 Ga0373955_0046660 Ga0373955_0046660_1267_2277 307
57 3300036401 Ga0373937_0075436 Ga0373937_0075436_1044_2054 307
58 3300046462 Ga0495651_0136634 Ga0495651_0136634_228_1238 307
59 3300046511 Ga0495608_0048314 Ga0495608_0048314_1495_2505 307
60 3300046529 Ga0495652_0065030 Ga0495652_0065030_577_1587 307
61 3300046543 Ga0495645_0240034 Ga0495645_0240034_152_1162 307
62 3300046683 Ga0495658_0039229 Ga0495658_0039229_268_1278 307
63 3300046809 Ga0495600_0054107 Ga0495600_0054107_525_1535 307
64 3300047319 Ga0495674_0038910 Ga0495674_0038910_644_1654 307
65 3300047322 Ga0495680_0007421 Ga0495680_0007421_2143_3153 307
66 3300053077 Ga0495601_0025328 Ga0495601_0025328_1343_2353 307
67 3300053078 Ga0495612_0108145 Ga0495612_0108145_136_1146 307
68 3300053084 Ga0495595_0006826 Ga0495595_0006826_1343_2353 307
69 3300053085 Ga0495619_0000271 Ga0495619_0000271_9403_10413 307
70 3300005617 Ga0068859_100188020 Ga0068859_1001880202 308
71 3300006931 Ga0097620_100188026 Ga0097620_1001880262 308
72 3300009101 Ga0105247_10008826 Ga0105247_100088262 308
73 3300009174 Ga0105241_10036716 Ga0105241_100367161 308
74 3300011119 Ga0105246_10007656 Ga0105246_100076562 308
75 3300025900 Ga0207710_10033902 Ga0207710_100339022 308
76 3300025907 Ga0207645_10012166 Ga0207645_100121664 308
77 3300025908 Ga0207643_10054561 Ga0207643_100545612 308
78 3300025941 Ga0207711_10196276 Ga0207711_101962762 308
79 3300026116 Ga0207674_10014030 Ga0207674_100140303 308
80 3300028380 Ga0268265_10272317 Ga0268265_102723171 308
81 3300003187 JGI25151J46595_10000022 JGI25151J46595_10000022143 309
82 3300005329 Ga0070683_100076341 Ga0070683_1000763411 309
83 3300005435 Ga0070714_100123401 Ga0070714_1001234011 309
84 3300005547 Ga0070693_100016304 Ga0070693_1000163043 309
85 3300009551 Ga0105238_10098718 Ga0105238_100987183 309
86 3300013307 Ga0157372_10099521 Ga0157372_100995211 309
87 3300025294 Ga0209025_1000016 Ga0209025_1000016688 309
88 3300025924 Ga0207694_10127066 Ga0207694_101270662 309
89 3300025949 Ga0207667_10161485 Ga0207667_101614852 309
90 3300026078 Ga0207702_10158967 Ga0207702_101589672 309
91 3300048926 Ga0496123_0015741 Ga0496123_0015741_1139_2266 309
92 3300048928 Ga0496125_0050770 Ga0496125_0050770_28_1050 309
93 3300048929 Ga0496126_0120057 Ga0496126_0120057_915_1937 309
94 3300053122 Ga0500608_093113 Ga0500608_093113_141_1166 309
95 3300003771 Ga0055526_1000491 Ga0055526_10004914 310
96 3300003775 Ga0055524_1000055 Ga0055524_100005594 310
97 3300003784 Ga0055534_1015211 Ga0055534_10152111 310
98 3300009093 Ga0105240_10273318 Ga0105240_102733181 310
99 3300025273 Ga0209673_1010338 Ga0209673_10103382 310
100 3300025291 Ga0209675_1001083 Ga0209675_100108313 310
101 3300025295 Ga0209564_1000034 Ga0209564_1000034107 310
102 3300025299 Ga0209256_1000026 Ga0209256_100002695 310
103 3300037471 Ga0395905_0167996 Ga0395905_0167996_1119_2051 310
104 3300048926 Ga0496123_0160916 Ga0496123_0160916_67_1092 310
105 3300049569 Ga0501032_0043338 Ga0501032_0043338_631_1647 311
106 3300049571 Ga0501034_0001519 Ga0501034_0001519_13462_14478 311
107 3300049573 Ga0501037_0013607 Ga0501037_0013607_567_1583 311
108 3300049579 Ga0501043_0000802 Ga0501043_0000802_3860_4876 311
109 3300049581 Ga0501047_0000010 Ga0501047_0000010_184882_185898 311
110 3300049742 Ga0501080_0000100 Ga0501080_0000100_20005_21021 311
111 3300049744 Ga0501083_0007675 Ga0501083_0007675_4359_5375 311
112 3300049823 Ga0501044_0003158 Ga0501044_0003158_10464_11480 311
113 3300031250 Ga0265331_10040474 Ga0265331_100404742 312
114 3300005458 Ga0070681_10320534 Ga0070681_103205341 313
115 3300025299 Ga0209256_1000188 Ga0209256_100018885 313
116 3300025906 Ga0207699_10073387 Ga0207699_100733872 313
117 3300039438 Ga0436360_0171584 Ga0436360_0171584_59_1021 313
118 3300048916 Ga0496113_0331099 Ga0496113_0331099_140_1135 315
119 3300048920 Ga0496117_0054888 Ga0496117_0054888_1288_2283 315
120 3300025927 Ga0207687_10048401 Ga0207687_100484012 316
121 iso_pu_bacteria 643348564 643603963 316
122 3300003203 JGI25406J46586_10008828 JGI25406J46586_100088283 317
123 3300005985 Ga0081539_10001727 Ga0081539_1000172733 317
124 iso_pu_bacteria 2643221547 2643756552 317
125 iso_pu_bacteria 2818991467 2819717344 317
126 iso_pu_bacteria 2565956521 2566038103 318
127 iso_pu_bacteria 2939669807 2939670761 318
128 3300049744 Ga0501083_0048508 Ga0501083_0048508_1739_2740 319
129 iso_pu_bacteria 2508501050 2508728061 319
130 iso_pu_bacteria 2545555834 2545672998 319
131 iso_pu_bacteria 2643221734 2644733697 319
132 iso_pu_bacteria 2775506901 2776263568 319
133 iso_pu_bacteria 2775506901 2776264902 319
134 iso_pu_bacteria 2818991467 2819717035 319
135 iso_pu_bacteria 2835312727 2835319229 319
136 iso_pu_bacteria 2882456835 2882459776 319
137 iso_pu_bacteria 2884298095 2884300320 319
138 iso_pu_bacteria 2894232714 2894234063 319
139 iso_pu_bacteria 2917699015 2917701466 319
140 iso_pu_bacteria 3003665799 3003668536 319
141 iso_pu_bacteria 641522639 641645977 319
142 iso_pu_bacteria 2643221733 2644729268 320
143 iso_pu_bacteria 2643221734 2644733113 320
144 iso_pu_bacteria 2643221736 2644742163 320
145 iso_pu_bacteria 2818991467 2819717982 320
146 iso_pu_bacteria 2835312727 2835319415 320
147 iso_pu_bacteria 2841911363 2841911949 320
148 iso_pu_bacteria 2841911363 2841916680 320
149 iso_pu_bacteria 2841917233 2841917441 320
150 iso_pu_bacteria 2841917233 2841921402 320
151 iso_pu_bacteria 2917699015 2917700557 320
152 3300006048 Ga0075363_100019189 Ga0075363_1000191892 321
153 3300009093 Ga0105240_10069778 Ga0105240_100697784 321
154 3300013105 Ga0157369_10580260 Ga0157369_105802601 321
155 3300021361 Ga0213872_10098116 Ga0213872_100981162 321
156 3300025935 Ga0207709_10330089 Ga0207709_103300891 321
157 3300031235 Ga0265330_10057000 Ga0265330_100570002 321
158 3300031249 Ga0265339_10029436 Ga0265339_100294361 321
159 3300031616 Ga0307508_10028105 Ga0307508_100281054 321
160 3300031901 Ga0307406_10033288 Ga0307406_100332881 321
161 3300033180 Ga0307510_10171384 Ga0307510_101713842 321
162 3300037853 Ga0436364_0815154 Ga0436364_0815154_487_1500 321
163 3300039438 Ga0436360_1030342 Ga0436360_1030342_45_1055 321
164 3300039447 Ga0436361_0440245 Ga0436361_0440245_1969_2982 321
165 3300039447 Ga0436361_1157610 Ga0436361_1157610_1814_2824 321
166 3300041486 Ga0451807_0676874 Ga0451807_0676874_42_1046 321
167 3300048918 Ga0496115_0218174 Ga0496115_0218174_247_1260 321
168 3300048924 Ga0496121_0169475 Ga0496121_0169475_63_1076 321
169 3300048925 Ga0496122_0063340 Ga0496122_0063340_1030_2049 321
170 3300049590 Ga0501074_0071918 Ga0501074_0071918_1229_2248 321
171 3300049741 Ga0501079_0162485 Ga0501079_0162485_235_1254 321
172 iso_pu_bacteria 2643221736 2644746968 321
173 iso_pu_bacteria 2841760612 2841762293 321
174 iso_pu_bacteria 2841911363 2841911948 321
175 iso_pu_bacteria 2841917233 2841921401 321
176 iso_pu_bacteria 2844104063 2844109831 321
177 iso_pu_bacteria 2851182111 2851183319 321
178 iso_pu_bacteria 2851246043 2851248306 321
179 iso_pu_bacteria 8057529695 8057535551 321
180 3300005937 Ga0081455_10036140 Ga0081455_100361404 322
181 3300015265 Ga0182005_1006965 Ga0182005_10069652 322
182 3300025294 Ga0209025_1001935 Ga0209025_100193527 322
183 3300031241 Ga0265325_10000126 Ga0265325_1000012619 322
184 3300031247 Ga0265340_10024953 Ga0265340_100249532 322
185 3300031249 Ga0265339_10070482 Ga0265339_100704822 322
186 3300031344 Ga0265316_10110877 Ga0265316_101108772 322
187 3300031595 Ga0265313_10001517 Ga0265313_1000151711 322
188 3300031712 Ga0265342_10015013 Ga0265342_100150133 322
189 3300033524 Ga0316592_1022706 Ga0316592_10227061 322
190 3300033527 Ga0316586_1012998 Ga0316586_10129981 322
191 3300035118 Ga0373954_0003650 Ga0373954_0003650_706_1716 322
192 3300036712 Ga0316584_0013703 Ga0316584_0013703_3543_4565 322
193 3300039062 Ga0400483_231684 Ga0400483_231684_4632_5705 322
194 3300039450 Ga0436363_0281915 Ga0436363_0281915_2240_3253 322
195 3300045051 Ga0451576_0012600 Ga0451576_0012600_5729_6739 322
196 3300048908 Ga0496105_0049555 Ga0496105_0049555_488_1504 322
197 3300048911 Ga0496108_0016920 Ga0496108_0016920_3724_4740 322
198 3300048912 Ga0496109_0017782 Ga0496109_0017782_1648_2664 322
199 3300048913 Ga0496110_0001321 Ga0496110_0001321_9299_10315 322
200 3300048914 Ga0496111_0002237 Ga0496111_0002237_6982_7998 322
201 3300048915 Ga0496112_0017718 Ga0496112_0017718_5458_6474 322
202 3300049571 Ga0501034_0000247 Ga0501034_0000247_58864_59880 322
203 3300049585 Ga0501069_0011989 Ga0501069_0011989_2473_3492 322
204 3300049586 Ga0501070_0234075 Ga0501070_0234075_102_1118 322
205 3300049589 Ga0501073_0035449 Ga0501073_0035449_1832_2848 322
206 3300049593 Ga0501077_0148630 Ga0501077_0148630_66_1088 322
207 3300049822 Ga0501035_0002492 Ga0501035_0002492_1589_2608 322
208 3300053130 Ga0500642_0044682 Ga0500642_0044682_565_1575 322
209 3300053153 Ga0500616_0014186 Ga0500616_0014186_3316_4332 322
210 3300003544 Ga0007417J51691_1037981 Ga0007417J51691_10379811 323
211 3300003693 Ga0032354_1065742 Ga0032354_10657421 323
212 3300003771 Ga0055526_1000371 Ga0055526_10003715 323
213 3300003775 Ga0055524_1006102 Ga0055524_10061024 323
214 3300005338 Ga0068868_100112664 Ga0068868_1001126641 323
215 3300005347 Ga0070668_100234603 Ga0070668_1002346032 323
216 3300005356 Ga0070674_100094108 Ga0070674_1000941082 323
217 3300005441 Ga0070700_100132214 Ga0070700_1001322141 323
218 3300005616 Ga0068852_100208012 Ga0068852_1002080122 323
219 3300005937 Ga0081455_10000267 Ga0081455_1000026730 323
220 3300005981 Ga0081538_10032635 Ga0081538_100326354 323
221 3300005985 Ga0081539_10065431 Ga0081539_100654312 323
222 3300006051 Ga0075364_10015736 Ga0075364_100157365 323
223 3300006058 Ga0075432_10055757 Ga0075432_100557572 323
224 3300006178 Ga0075367_10002825 Ga0075367_100028257 323
225 3300006353 Ga0075370_10024534 Ga0075370_100245342 323
226 3300009094 Ga0111539_10222831 Ga0111539_102228313 323
227 3300009101 Ga0105247_10130190 Ga0105247_101301901 323
228 3300009148 Ga0105243_10061057 Ga0105243_100610572 323
229 3300009553 Ga0105249_10171487 Ga0105249_101714871 323
230 3300009553 Ga0105249_10492783 Ga0105249_104927831 323
231 3300011119 Ga0105246_10193984 Ga0105246_101939842 323
232 3300013250 Ga0171462_1009 Ga0171462_1009198 323
233 3300013250 Ga0171462_1011 Ga0171462_10114 323
234 3300013296 Ga0157374_10250277 Ga0157374_102502771 323
235 3300013308 Ga0157375_10238272 Ga0157375_102382721 323
236 3300014968 Ga0157379_10194004 Ga0157379_101940042 323
237 3300017792 Ga0163161_10153226 Ga0163161_101532261 323
238 3300025294 Ga0209025_1032705 Ga0209025_10327052 323
239 3300025295 Ga0209564_1000023 Ga0209564_10000235 323
240 3300025299 Ga0209256_1000338 Ga0209256_10003387 323
241 3300025900 Ga0207710_10116371 Ga0207710_101163711 323
242 3300025901 Ga0207688_10017395 Ga0207688_100173953 323
243 3300025901 Ga0207688_10149923 Ga0207688_101499232 323
244 3300025933 Ga0207706_10132193 Ga0207706_101321931 323
245 3300026075 Ga0207708_10135009 Ga0207708_101350091 323
246 3300026121 Ga0207683_10121478 Ga0207683_101214781 323
247 3300027907 Ga0207428_10190529 Ga0207428_101905291 323
248 3300031852 Ga0307410_10021608 Ga0307410_100216082 323
249 3300031995 Ga0307409_100007098 Ga0307409_1000070982 323
250 3300031995 Ga0307409_100367246 Ga0307409_1003672462 323
251 3300032002 Ga0307416_100213707 Ga0307416_1002137073 323
252 3300032126 Ga0307415_100103707 Ga0307415_1001037072 323
253 3300041413 Ga0439465_0023145 Ga0439465_0023145_238_1257 323
254 3300044658 Ga0466972_0037557 Ga0466972_0037557_1301_2320 323
255 3300048925 Ga0496122_0067909 Ga0496122_0067909_537_1559 323
256 3300049578 Ga0501042_0026000 Ga0501042_0026000_1376_2440 323
257 3300049581 Ga0501047_0261722 Ga0501047_0261722_453_1475 323
258 3300049589 Ga0501073_0221303 Ga0501073_0221303_73_1092 323
259 3300049591 Ga0501075_0284672 Ga0501075_0284672_142_1206 323
260 3300049682 Ga0501252_001370 Ga0501252_001370_629_1648 323
261 3300049741 Ga0501079_0253049 Ga0501079_0253049_187_1209 323
262 3300049743 Ga0501081_0145526 Ga0501081_0145526_478_1542 323
263 3300049824 Ga0501045_0009682 Ga0501045_0009682_1240_2304 323
264 3300049851 Ga0501212_004350 Ga0501212_004350_531_1550 323
265 3300050490 nmdc:mga03n38_62284_c1 nmdc:mga03n38_62284_c1_238_1263 323
266 3300050491 nmdc:mga00v17_63938_c1 nmdc:mga00v17_63938_c1_732_1757 323
267 3300050493 nmdc:mga0k408_28990_c1 nmdc:mga0k408_28990_c1_562_1587 323
268 3300050494 nmdc:mga06z11_22723_c1 nmdc:mga06z11_22723_c1_434_1459 323
269 3300050495 nmdc:mga04h51_22465_c1 nmdc:mga04h51_22465_c1_732_1757 323
270 3300050496 nmdc:mga07m45_24927_c1 nmdc:mga07m45_24927_c1_769_1794 323
271 3300050511 nmdc:mga08y16_426516_c1 nmdc:mga08y16_426516_c1_137_1240 323
272 3300053098 Ga0500650_0063500 Ga0500650_0063500_528_1550 323
273 3300053153 Ga0500616_0082874 Ga0500616_0082874_236_1261 323
274 3300053156 Ga0500622_0009056 Ga0500622_0009056_2326_3351 323
275 3300054114 Ga0501084_0100925 Ga0501084_0100925_747_1811 323
276 iso_pu_bacteria 2508501114 2509078784 323
277 iso_pu_bacteria 2773857925 2774869942 323
278 iso_pu_bacteria 2775506901 2776260064 323
279 iso_pu_bacteria 2775506901 2776264794 323
280 iso_pu_bacteria 2841760612 2841763582 323
281 iso_pu_bacteria 2844104063 2844109514 323
282 iso_pu_bacteria 2851246043 2851251621 323
283 3300002987 JGI25159J45721_1010754 JGI25159J45721_10107542 324
284 3300003187 JGI25151J46595_10000086 JGI25151J46595_10000086115 324
285 3300003187 JGI25151J46595_10028663 JGI25151J46595_100286632 324
286 3300003578 Ga0006562J51391_1012277 Ga0006562J51391_10122772 324
287 3300003771 Ga0055526_1000371 Ga0055526_10003714 324
288 3300003771 Ga0055526_1002950 Ga0055526_10029504 324
289 3300003775 Ga0055524_1000515 Ga0055524_100051527 324
290 3300003775 Ga0055524_1006102 Ga0055524_10061023 324
291 3300005262 Ga0065165_1000605 Ga0065165_100060521 324
292 3300005262 Ga0065165_1000605 Ga0065165_100060528 324
293 3300005347 Ga0070668_100216209 Ga0070668_1002162092 324
294 3300006844 Ga0075428_100000557 Ga0075428_10000055726 324
295 3300006846 Ga0075430_100067442 Ga0075430_1000674423 324
296 3300006847 Ga0075431_100000469 Ga0075431_1000004698 324
297 3300006880 Ga0075429_100001672 Ga0075429_10000167210 324
298 3300009094 Ga0111539_10000072 Ga0111539_1000007235 324
299 3300009098 Ga0105245_10506872 Ga0105245_105068722 324
300 3300009147 Ga0114129_10000134 Ga0114129_1000013435 324
301 3300025284 Ga0209130_1000182 Ga0209130_100018263 324
302 3300025284 Ga0209130_1000182 Ga0209130_100018270 324
303 3300025291 Ga0209675_1000514 Ga0209675_10005147 324
304 3300025294 Ga0209025_1000016 Ga0209025_100001627 324
305 3300025294 Ga0209025_1001097 Ga0209025_100109721 324
306 3300025295 Ga0209564_1000023 Ga0209564_10000234 324
307 3300025295 Ga0209564_1000035 Ga0209564_1000035441 324
308 3300025299 Ga0209256_1000025 Ga0209256_10000255 324
309 3300025299 Ga0209256_1000338 Ga0209256_10003388 324
310 3300025302 Ga0207426_1008639 Ga0207426_10086392 324
311 3300025302 Ga0207426_1019319 Ga0207426_10193192 324
312 3300027907 Ga0207428_10048427 Ga0207428_100484271 324
313 3300044735 Ga0466968_0012922 Ga0466968_0012922_729_1766 324
314 3300046512 Ga0495610_0017643 Ga0495610_0017643_36_1058 324
315 3300048920 Ga0496117_0041650 Ga0496117_0041650_1175_2296 324
316 3300048925 Ga0496122_0078467 Ga0496122_0078467_686_1708 324
317 3300048926 Ga0496123_0033346 Ga0496123_0033346_1221_2342 324
318 3300048926 Ga0496123_0045139 Ga0496123_0045139_1298_2320 324
319 3300048927 Ga0496124_0141401 Ga0496124_0141401_841_1863 324
320 3300049823 Ga0501044_0119019 Ga0501044_0119019_657_1679 324
321 3300050507 nmdc:mga05p37_51_c1 nmdc:mga05p37_51_c1_68226_69332 324
322 3300050508 nmdc:mga09592_2220_c1 nmdc:mga09592_2220_c1_6623_7729 324
323 3300050509 nmdc:mga0qj67_106336_c1 nmdc:mga0qj67_106336_c1_462_1568 324
324 3300050510 nmdc:mga06r32_16_c1 nmdc:mga06r32_16_c1_21370_22476 324
325 3300050511 nmdc:mga08y16_79_c1 nmdc:mga08y16_79_c1_22683_23789 324
326 3300053156 Ga0500622_0017584 Ga0500622_0017584_2696_3718 324
327 3300002987 JGI25159J45721_1001222 JGI25159J45721_100122211 325
328 3300005262 Ga0065165_1000240 Ga0065165_100024072 325
329 3300025284 Ga0209130_1000061 Ga0209130_100006196 325
330 iso_pu_bacteria 2643221733 2644729267 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

75

300

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9894 12 325
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.968 12 325
2v25-assembly2.cif.gz_B structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate 0.9087 12 228
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.8977 13 109
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.8956 13 230
ID Description Score Start End Superfamily
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9314 12 97 3.40.190.10
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9273 13 111 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9145 109 213 3.40.190.10
2ia4B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9044 114 208 3.40.190.10
2q89A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9001 16 104 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537MQQ0-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9977 11 88 GO:0006865
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9958 15 325 GO:0006865
AF-A0A7S7Q2N8-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9956 12 325 GO:0006865
AF-F2IXB3-F1-model_v4 Amino acid ABC transporter, periplasmic amino acid-binding protein 0.9928 27 325 GO:0006865
AF-A0A2T9UUK1-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9907 83 223 GO:0006865

Feature Viewer

pLDDT pTM Quality
93.74 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map