F410059

General Info

Members Datasets Scaffolds Average Seq Length
330 178 660 102

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10327960|Ga0114129_103279603
Length 114
Sequence LFIDLILCKISEMAHDDIVTLPGKERLILELLASVGPMYGLQLVEHSEGVLKRGTVYVTLGRMEAKGLVESQQEPVPPGGIGLPRRIYRPTALGERMLRAWTAFARELAWEMKP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
162 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 2.73
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 43.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10327960 3300009147 Unclassified 2033
2 MBSR1b_contig_11720052 2162886012 Unclassified 839
3 rootL2_10283028 3300003322 Bacteria 1836
4 Ga0065712_10072373 3300005290 Bacteria 4781
5 Ga0065715_10320515 3300005293 Unclassified 1003
6 Ga0070676_10022635 3300005328 Bacteria 3526
7 Ga0070676_11081857 3300005328 Unclassified 605
8 Ga0070683_100065134 3300005329 Bacteria 3393
9 Ga0068869_100101465 3300005334 Bacteria 2177
10 Ga0068869_100166103 3300005334 Bacteria 1721
11 Ga0068869_100817085 3300005334 Unclassified 802
12 Ga0068869_101361715 3300005334 Unclassified 627
13 Ga0070666_10095612 3300005335 Bacteria 2045
14 Ga0070666_10513743 3300005335 Bacteria 869
15 Ga0070682_101657078 3300005337 Unclassified 554
16 Ga0068868_100028137 3300005338 Bacteria 4295
17 Ga0068868_100240039 3300005338 Bacteria 1522
18 Ga0068868_101352252 3300005338 Bacteria 663
19 Ga0070689_100215320 3300005340 Bacteria 1574
20 Ga0070689_101413306 3300005340 Unclassified 629
21 Ga0070691_10702625 3300005341 Bacteria 607
22 Ga0070668_100339750 3300005347 Bacteria 1268
23 Ga0070668_100436964 3300005347 Unclassified 1123
24 Ga0070669_100087658 3300005353 Bacteria 2328
25 Ga0070669_101598544 3300005353 Bacteria 567
26 Ga0070675_100158082 3300005354 Bacteria 1947
27 Ga0070675_100243332 3300005354 Bacteria 1572
28 Ga0070688_100138323 3300005365 Bacteria 1651
29 Ga0070659_100121498 3300005366 Bacteria 2116
30 Ga0070667_102065734 3300005367 Unclassified 537
31 Ga0070709_10063972 3300005434 Bacteria 2351
32 Ga0070713_100007628 3300005436 Bacteria 7615
33 Ga0070701_10769966 3300005438 Bacteria 654
34 Ga0070705_100343543 3300005440 Archaea 1086
35 Ga0070705_100658130 3300005440 Unclassified 818
36 Ga0070705_100715909 3300005440 Unclassified 788
37 Ga0070705_100717534 3300005440 Bacteria 787
38 Ga0070700_100326326 3300005441 Bacteria 1129
39 Ga0070694_100323164 3300005444 Bacteria 1188
40 Ga0070694_100431582 3300005444 Bacteria 1037
41 Ga0070663_100763752 3300005455 Unclassified 826
42 Ga0070678_100835270 3300005456 Unclassified 838
43 Ga0070678_101536619 3300005456 Bacteria 624
44 Ga0070662_100293392 3300005457 Unclassified 1319
45 Ga0068867_100195034 3300005459 Bacteria 1618
46 Ga0068867_100239337 3300005459 Bacteria 1471
47 Ga0068867_101222495 3300005459 Unclassified 691
48 Ga0068867_101402515 3300005459 Unclassified 648
49 Ga0070685_10776958 3300005466 Unclassified 704
50 Ga0070706_100500248 3300005467 Unclassified 1131
51 Ga0070706_101719793 3300005467 Unclassified 571
52 Ga0070698_100686656 3300005471 Bacteria 965
53 Ga0070698_101319960 3300005471 Bacteria 672
54 Ga0070699_100251275 3300005518 Unclassified 1580
55 Ga0070699_101097481 3300005518 Unclassified 730
56 Ga0070679_101045311 3300005530 Bacteria 761
57 Ga0070679_101704126 3300005530 Unclassified 578
58 Ga0070684_100083266 3300005535 Bacteria 2834
59 Ga0070684_100509311 3300005535 Unclassified 1115
60 Ga0070672_101141737 3300005543 Unclassified 693
61 Ga0070672_101684821 3300005543 Unclassified 569
62 Ga0070686_100382649 3300005544 Bacteria 1066
63 Ga0070695_100531989 3300005545 Bacteria 914
64 Ga0070695_100606752 3300005545 Unclassified 860
65 Ga0070696_100715592 3300005546 Unclassified 817
66 Ga0070696_100739190 3300005546 Unclassified 805
67 Ga0070696_101647052 3300005546 Unclassified 552
68 Ga0070693_100101502 3300005547 Bacteria 1753
69 Ga0070665_100245273 3300005548 Bacteria 1792
70 Ga0070704_100997430 3300005549 Unclassified 757
71 Ga0070704_102279752 3300005549 Bacteria 504
72 Ga0068855_100631496 3300005563 Bacteria 1152
73 Ga0068857_102449673 3300005577 Unclassified 512
74 Ga0068854_100541255 3300005578 Bacteria 986
75 Ga0070702_101668877 3300005615 Unclassified 529
76 Ga0068852_101530589 3300005616 Unclassified 689
77 Ga0068859_100017099 3300005617 Bacteria 7282
78 Ga0068859_100099197 3300005617 Bacteria 2968
79 Ga0068859_100646642 3300005617 Bacteria 1149
80 Ga0068859_102092415 3300005617 Unclassified 625
81 Ga0068864_100001667 3300005618 Bacteria 18294
82 Ga0068864_102097283 3300005618 Unclassified 572
83 Ga0068861_100215403 3300005719 Bacteria 1620
84 Ga0068863_100075340 3300005841 Bacteria 3193
85 Ga0068863_100088264 3300005841 Bacteria 2939
86 Ga0068858_100003869 3300005842 Bacteria 14793
87 Ga0068858_100006698 3300005842 Bacteria 11207
88 Ga0068858_100175206 3300005842 Archaea 2024
89 Ga0068858_100220038 3300005842 Bacteria 1798
90 Ga0068858_100659079 3300005842 Bacteria 1017
91 Ga0068860_100133339 3300005843 Bacteria 2385
92 Ga0068862_100177569 3300005844 Bacteria 1910
93 Ga0068862_100285449 3300005844 Bacteria 1514
94 Ga0068862_101150904 3300005844 Bacteria 773
95 Ga0070717_10126987 3300006028 Bacteria 2190
96 Ga0075367_10155215 3300006178 Bacteria 1422
97 Ga0075369_10581392 3300006186 Unclassified 536
98 Ga0097621_100724933 3300006237 Unclassified 917
99 Ga0075370_10070602 3300006353 Bacteria 1997
100 Ga0075370_10993567 3300006353 Bacteria 514
101 Ga0068871_100694273 3300006358 Unclassified 932
102 Ga0075428_100083810 3300006844 Unclassified 3478
103 Ga0075428_100102565 3300006844 Unclassified 3119
104 Ga0075430_101384566 3300006846 Unclassified 578
105 Ga0075430_101416618 3300006846 Unclassified 571
106 Ga0075431_100017122 3300006847 Bacteria 7366
107 Ga0075431_100459894 3300006847 Bacteria 1267
108 Ga0075431_101067624 3300006847 Unclassified 773
109 Ga0075433_10169651 3300006852 Bacteria 1942
110 Ga0075433_10842310 3300006852 Bacteria 800
111 Ga0075433_11473687 3300006852 Unclassified 588
112 Ga0075434_100335239 3300006871 Bacteria 1533
113 Ga0075434_100535546 3300006871 Bacteria 1191
114 Ga0075434_100539653 3300006871 Bacteria 1186
115 Ga0075434_100608413 3300006871 Bacteria 1112
116 Ga0075429_100289620 3300006880 Bacteria 1434
117 Ga0075429_100367558 3300006880 Bacteria 1259
118 Ga0075429_100369987 3300006880 Unclassified 1255
119 Ga0075429_100907850 3300006880 Unclassified 771
120 Ga0068865_100041987 3300006881 Unclassified 3116
121 Ga0075436_100336788 3300006914 Unclassified 1086
122 Ga0097620_100017098 3300006931 Bacteria 7282
123 Ga0097620_100099199 3300006931 Bacteria 2968
124 Ga0097620_100324070 3300006931 Bacteria 1635
125 Ga0097620_100646615 3300006931 Bacteria 1149
126 Ga0097620_102091771 3300006931 Unclassified 625
127 Ga0105240_10545515 3300009093 Unclassified 1283
128 Ga0111539_10006795 3300009094 Bacteria 14720
129 Ga0111539_10148687 3300009094 Bacteria 2742
130 Ga0111539_10716154 3300009094 Bacteria 1165
131 Ga0111539_11755483 3300009094 Bacteria 720
132 Ga0111539_12228457 3300009094 Unclassified 636
133 Ga0111539_13178221 3300009094 Bacteria 530
134 Ga0105245_10037401 3300009098 Bacteria 4315
135 Ga0105245_10410475 3300009098 Bacteria 1355
136 Ga0105245_13044404 3300009098 Unclassified 520
137 Ga0105247_10009886 3300009101 Bacteria 5779
138 Ga0105247_10029119 3300009101 Bacteria 3344
139 Ga0105247_10050621 3300009101 Unclassified 2556
140 Ga0105247_10518103 3300009101 Unclassified 871
141 Ga0114129_10206143 3300009147 Bacteria 2660
142 Ga0114129_10645607 3300009147 Bacteria 1367
143 Ga0114129_10825804 3300009147 Bacteria 1180
144 Ga0114129_11502956 3300009147 Unclassified 827
145 Ga0114129_11528609 3300009147 Unclassified 819
146 Ga0105243_11437651 3300009148 Unclassified 711
147 Ga0105243_11610332 3300009148 Bacteria 676
148 Ga0105241_10484323 3300009174 Bacteria 1100
149 Ga0105242_10005776 3300009176 Bacteria 9534
150 Ga0105242_10806818 3300009176 Unclassified 930
151 Ga0105248_10128472 3300009177 Unclassified 2859
152 Ga0105248_10335048 3300009177 Bacteria 1704
153 Ga0105248_11635830 3300009177 Unclassified 730
154 Ga0105248_11772109 3300009177 Bacteria 700
155 Ga0105249_10357831 3300009553 Bacteria 1480
156 Ga0105249_11053138 3300009553 Bacteria 883
157 Ga0105249_11198784 3300009553 Unclassified 830
158 Ga0105249_12122761 3300009553 Unclassified 635
159 Ga0105246_10406357 3300011119 Unclassified 1132
160 Ga0157374_10314851 3300013296 Unclassified 1550
161 Ga0157374_12200291 3300013296 Unclassified 578
162 Ga0157378_12986670 3300013297 Unclassified 525
163 Ga0163163_10240253 3300014325 Unclassified 1861
164 Ga0163163_12294103 3300014325 Unclassified 599
165 Ga0157380_10193580 3300014326 Bacteria 1797
166 Ga0157380_10837165 3300014326 Unclassified 940
167 Ga0157380_11714229 3300014326 Unclassified 686
168 Ga0157379_10033900 3300014968 Unclassified 4552
169 Ga0157379_10040312 3300014968 Unclassified 4167
170 Ga0157379_10046834 3300014968 Bacteria 3858
171 Ga0157379_11325008 3300014968 Bacteria 696
172 Ga0163161_10716050 3300017792 Unclassified 835
173 Ga0207682_10183212 3300025893 Unclassified 957
174 Ga0207642_10577710 3300025899 Unclassified 697
175 Ga0207710_10112387 3300025900 Bacteria 1294
176 Ga0207680_10099638 3300025903 Bacteria 1864
177 Ga0207680_10455833 3300025903 Bacteria 908
178 Ga0207699_10082483 3300025906 Unclassified 1997
179 Ga0207645_10088046 3300025907 Bacteria 1996
180 Ga0207645_10248196 3300025907 Bacteria 1177
181 Ga0207645_11195308 3300025907 Unclassified 511
182 Ga0207643_10970382 3300025908 Unclassified 550
183 Ga0207684_10420990 3300025910 Unclassified 1148
184 Ga0207684_11276739 3300025910 Unclassified 605
185 Ga0207695_10350200 3300025913 Unclassified 1364
186 Ga0207646_11463995 3300025922 Bacteria 592
187 Ga0207681_10065942 3300025923 Unclassified 2505
188 Ga0207681_10994270 3300025923 Unclassified 704
189 Ga0207659_10013775 3300025926 Bacteria 5194
190 Ga0207700_10011497 3300025928 Bacteria 5647
191 Ga0207644_11302196 3300025931 Unclassified 611
192 Ga0207690_10105837 3300025932 Bacteria 2018
193 Ga0207706_10410357 3300025933 Unclassified 1174
194 Ga0207686_10006191 3300025934 Bacteria 6431
195 Ga0207686_10909540 3300025934 Unclassified 710
196 Ga0207686_11208744 3300025934 Unclassified 619
197 Ga0207670_10118892 3300025936 Bacteria 1917
198 Ga0207669_11212945 3300025937 Unclassified 639
199 Ga0207704_10289150 3300025938 Unclassified 1250
200 Ga0207691_10314336 3300025940 Unclassified 1344
201 Ga0207711_10244809 3300025941 Bacteria 1645
202 Ga0207711_10752679 3300025941 Unclassified 908
203 Ga0207689_10273978 3300025942 Bacteria 1397
204 Ga0207689_10460599 3300025942 Bacteria 1063
205 Ga0207689_10732801 3300025942 Bacteria 834
206 Ga0207661_10019488 3300025944 Bacteria 5059
207 Ga0207712_11082903 3300025961 Unclassified 713
208 Ga0207668_10302158 3300025972 Bacteria 1321
209 Ga0207668_10469338 3300025972 Unclassified 1077
210 Ga0207640_11326779 3300025981 Unclassified 643
211 Ga0207658_11116179 3300025986 Bacteria 720
212 Ga0207677_10354675 3300026023 Unclassified 1230
213 Ga0207677_10664130 3300026023 Bacteria 921
214 Ga0207703_10022504 3300026035 Bacteria 4944
215 Ga0207703_10295271 3300026035 Archaea 1476
216 Ga0207703_10393157 3300026035 Bacteria 1285
217 Ga0207703_10477716 3300026035 Bacteria 1167
218 Ga0207703_12321288 3300026035 Unclassified 512
219 Ga0207708_10038746 3300026075 Bacteria 3631
220 Ga0207641_10273376 3300026088 Unclassified 1586
221 Ga0207648_10749106 3300026089 Bacteria 907
222 Ga0207648_10964673 3300026089 Bacteria 798
223 Ga0207648_11022791 3300026089 Bacteria 774
224 Ga0207648_11137819 3300026089 Unclassified 732
225 Ga0207676_10135341 3300026095 Bacteria 2101
226 Ga0207675_100736514 3300026118 Bacteria 996
227 Ga0207683_10863443 3300026121 Unclassified 840
228 Ga0207683_11338428 3300026121 Bacteria 663
229 Ga0207428_10122337 3300027907 Unclassified 1995
230 Ga0268266_10203879 3300028379 Bacteria 1811
231 Ga0268266_11057085 3300028379 Bacteria 786
232 Ga0268265_10188715 3300028380 Unclassified 1778
233 Ga0268265_10329900 3300028380 Unclassified 1385
234 Ga0268265_10586158 3300028380 Bacteria 1064
235 Ga0268265_11000288 3300028380 Bacteria 826
236 Ga0268264_10080554 3300028381 Bacteria 2781
237 Ga0268264_10342578 3300028381 Bacteria 1420
238 Ga0265316_10571001 3300031344 Bacteria 804
239 Ga0307408_100146992 3300031548 Unclassified 1857
240 Ga0307405_11026768 3300031731 Bacteria 705
241 Ga0307413_10158761 3300031824 Bacteria 1586
242 Ga0307413_10205374 3300031824 Bacteria 1426
243 Ga0307413_10962718 3300031824 Bacteria 729
244 Ga0307410_10055814 3300031852 Unclassified 2683
245 Ga0307410_10114010 3300031852 Bacteria 1960
246 Ga0307410_10212615 3300031852 Bacteria 1483
247 Ga0307410_10822724 3300031852 Bacteria 791
248 Ga0307406_11925245 3300031901 Unclassified 527
249 Ga0307407_10093333 3300031903 Bacteria 1850
250 Ga0307407_10191638 3300031903 Bacteria 1363
251 Ga0307407_10627169 3300031903 Bacteria 803
252 Ga0307412_10127868 3300031911 Bacteria 1840
253 Ga0307409_100004412 3300031995 Bacteria 7900
254 Ga0307409_100027239 3300031995 Bacteria 4047
255 Ga0307409_100305931 3300031995 Bacteria 1481
256 Ga0307409_101262827 3300031995 Bacteria 763
257 Ga0307409_102416470 3300031995 Bacteria 554
258 Ga0307416_100018960 3300032002 Bacteria 4863
259 Ga0307416_101467974 3300032002 Unclassified 788
260 Ga0307416_102117538 3300032002 Bacteria 664
261 Ga0307414_10053882 3300032004 Bacteria 2808
262 Ga0307411_10013939 3300032005 Bacteria 4456
263 Ga0307415_100018373 3300032126 Bacteria 4221
264 Ga0307415_102306362 3300032126 Unclassified 528
265 Ga0373939_0539201 3300035114 Bacteria 503
266 Ga0373927_0924390 3300035695 Unclassified 576
267 Ga0451800_1568648 3300041459 Unclassified 849
268 Ga0451851_1132061 3300041507 Unclassified 937
269 Ga0451853_0493180 3300041512 Bacteria 1323
270 Ga0451853_3682173 3300041512 Bacteria 1625
271 Ga0451853_4071057 3300041512 Bacteria 1023
272 Ga0451577_1374006 3300042876 Unclassified 627
273 Ga0439440_0197087 3300042993 Bacteria 596
274 Ga0453683_0412949 3300044673 Unclassified 871
275 Ga0495643_0002446 3300046522 Bacteria 14706
276 Ga0495644_0153337 3300046523 Unclassified 882
277 Ga0495667_0228473 3300046559 Bacteria 1187
278 Ga0495656_0295250 3300046615 Bacteria 829
279 Ga0495656_0598678 3300046615 Unclassified 590
280 Ga0495659_0008809 3300046664 Bacteria 3212
281 Ga0495659_0280924 3300046664 Unclassified 700
282 Ga0495599_0507244 3300046678 Bacteria 709
283 Ga0495671_0519164 3300046692 Unclassified 568
284 Ga0495676_0407895 3300047321 Bacteria 901
285 Ga0496104_1393649 3300048907 Unclassified 604
286 Ga0496105_0412926 3300048908 Unclassified 1070
287 Ga0496105_0692347 3300048908 Unclassified 783
288 Ga0496106_0309734 3300048909 Archaea 1267
289 Ga0496106_0709749 3300048909 Bacteria 801
290 Ga0496114_0091914 3300048917 Bacteria 2578
291 Ga0496114_0619879 3300048917 Bacteria 953
292 Ga0496114_1138854 3300048917 Unclassified 665
293 Ga0501298_114206 3300049521 Bacteria 629
294 Ga0501075_0698708 3300049591 Unclassified 773
295 Ga0501206_048116 3300049653 Bacteria 673
296 Ga0501261_125166 3300049690 Unclassified 513
297 Ga0501225_0220243 3300049705 Bacteria 611
298 nmdc:mga07m45_157222_c1 3300050496 Bacteria 1319
299 nmdc:mga05p37_1039080_c1 3300050507 Bacteria 866
300 nmdc:mga05p37_1157584_c1 3300050507 Unclassified 804
301 nmdc:mga05p37_1352465_c1 3300050507 Unclassified 721
302 nmdc:mga05p37_149512_c1 3300050507 Unclassified 2858
303 nmdc:mga05p37_2024651_c1 3300050507 Unclassified 543
304 nmdc:mga09592_1374024_c1 3300050508 Unclassified 578
305 nmdc:mga09592_173802_c1 3300050508 Bacteria 1863
306 nmdc:mga09592_229487_c1 3300050508 Unclassified 1608
307 nmdc:mga09592_541744_c1 3300050508 Unclassified 1000
308 nmdc:mga0qj67_1245232_c1 3300050509 Unclassified 578
309 nmdc:mga06r32_1307240_c1 3300050510 Unclassified 669
310 nmdc:mga06r32_40944_c1 3300050510 Bacteria 4400
311 nmdc:mga06r32_750220_c1 3300050510 Unclassified 939
312 nmdc:mga08y16_1245818_c1 3300050511 Unclassified 713
313 nmdc:mga08y16_160211_c1 3300050511 Unclassified 2338
314 nmdc:mga08y16_2009279_c1 3300050511 Unclassified 527
315 nmdc:mga08y16_70147_c1 3300050511 Unclassified 3653
316 nmdc:mga0n895_1460338_c1 3300050512 Unclassified 651
317 nmdc:mga0n895_468787_c1 3300050512 Unclassified 1270
318 nmdc:mga0n895_489546_c1 3300050512 Bacteria 1240
319 nmdc:mga0n895_569057_c1 3300050512 Bacteria 1138
320 nmdc:mga0rr50_196202_c1 3300050513 Unclassified 1657
321 nmdc:mga08x19_20888_c1 3300050514 Bacteria 4036
322 nmdc:mga08x19_23688_c1 3300050514 Unclassified 3810
323 nmdc:mga0a205_1260620_c1 3300050515 Bacteria 587
324 nmdc:mga0a205_625373_c1 3300050515 Unclassified 929
325 nmdc:mga0a205_809551_c1 3300050515 Bacteria 784
326 Ga0495601_0120338 3300053077 Unclassified 1705
327 Ga0590071_000758 3300059421 Bacteria 9033
328 Ga0590074_000602 3300059423 Bacteria 5420
329 Ga0590075_000883 3300059424 Bacteria 7864
330 Ga0590077_000904 3300059426 Bacteria 7574
331 Ga0114129_10327960
332 MBSR1b_contig_11720052
333 rootL2_10283028
334 Ga0065712_10072373
335 Ga0065715_10320515
336 Ga0070676_10022635
337 Ga0070676_11081857
338 Ga0070683_100065134
339 Ga0068869_100101465
340 Ga0068869_100166103
341 Ga0068869_100817085
342 Ga0068869_101361715
343 Ga0070666_10095612
344 Ga0070666_10513743
345 Ga0070682_101657078
346 Ga0068868_100028137
347 Ga0068868_100240039
348 Ga0068868_101352252
349 Ga0070689_100215320
350 Ga0070689_101413306
351 Ga0070691_10702625
352 Ga0070668_100339750
353 Ga0070668_100436964
354 Ga0070669_100087658
355 Ga0070669_101598544
356 Ga0070675_100158082
357 Ga0070675_100243332
358 Ga0070688_100138323
359 Ga0070659_100121498
360 Ga0070667_102065734
361 Ga0070709_10063972
362 Ga0070713_100007628
363 Ga0070701_10769966
364 Ga0070705_100343543
365 Ga0070705_100658130
366 Ga0070705_100715909
367 Ga0070705_100717534
368 Ga0070700_100326326
369 Ga0070694_100323164
370 Ga0070694_100431582
371 Ga0070663_100763752
372 Ga0070678_100835270
373 Ga0070678_101536619
374 Ga0070662_100293392
375 Ga0068867_100195034
376 Ga0068867_100239337
377 Ga0068867_101222495
378 Ga0068867_101402515
379 Ga0070685_10776958
380 Ga0070706_100500248
381 Ga0070706_101719793
382 Ga0070698_100686656
383 Ga0070698_101319960
384 Ga0070699_100251275
385 Ga0070699_101097481
386 Ga0070679_101045311
387 Ga0070679_101704126
388 Ga0070684_100083266
389 Ga0070684_100509311
390 Ga0070672_101141737
391 Ga0070672_101684821
392 Ga0070686_100382649
393 Ga0070695_100531989
394 Ga0070695_100606752
395 Ga0070696_100715592
396 Ga0070696_100739190
397 Ga0070696_101647052
398 Ga0070693_100101502
399 Ga0070665_100245273
400 Ga0070704_100997430
401 Ga0070704_102279752
402 Ga0068855_100631496
403 Ga0068857_102449673
404 Ga0068854_100541255
405 Ga0070702_101668877
406 Ga0068852_101530589
407 Ga0068859_100017099
408 Ga0068859_100099197
409 Ga0068859_100646642
410 Ga0068859_102092415
411 Ga0068864_100001667
412 Ga0068864_102097283
413 Ga0068861_100215403
414 Ga0068863_100075340
415 Ga0068863_100088264
416 Ga0068858_100003869
417 Ga0068858_100006698
418 Ga0068858_100175206
419 Ga0068858_100220038
420 Ga0068858_100659079
421 Ga0068860_100133339
422 Ga0068862_100177569
423 Ga0068862_100285449
424 Ga0068862_101150904
425 Ga0070717_10126987
426 Ga0075367_10155215
427 Ga0075369_10581392
428 Ga0097621_100724933
429 Ga0075370_10070602
430 Ga0075370_10993567
431 Ga0068871_100694273
432 Ga0075428_100083810
433 Ga0075428_100102565
434 Ga0075430_101384566
435 Ga0075430_101416618
436 Ga0075431_100017122
437 Ga0075431_100459894
438 Ga0075431_101067624
439 Ga0075433_10169651
440 Ga0075433_10842310
441 Ga0075433_11473687
442 Ga0075434_100335239
443 Ga0075434_100535546
444 Ga0075434_100539653
445 Ga0075434_100608413
446 Ga0075429_100289620
447 Ga0075429_100367558
448 Ga0075429_100369987
449 Ga0075429_100907850
450 Ga0068865_100041987
451 Ga0075436_100336788
452 Ga0097620_100017098
453 Ga0097620_100099199
454 Ga0097620_100324070
455 Ga0097620_100646615
456 Ga0097620_102091771
457 Ga0105240_10545515
458 Ga0111539_10006795
459 Ga0111539_10148687
460 Ga0111539_10716154
461 Ga0111539_11755483
462 Ga0111539_12228457
463 Ga0111539_13178221
464 Ga0105245_10037401
465 Ga0105245_10410475
466 Ga0105245_13044404
467 Ga0105247_10009886
468 Ga0105247_10029119
469 Ga0105247_10050621
470 Ga0105247_10518103
471 Ga0114129_10206143
472 Ga0114129_10645607
473 Ga0114129_10825804
474 Ga0114129_11502956
475 Ga0114129_11528609
476 Ga0105243_11437651
477 Ga0105243_11610332
478 Ga0105241_10484323
479 Ga0105242_10005776
480 Ga0105242_10806818
481 Ga0105248_10128472
482 Ga0105248_10335048
483 Ga0105248_11635830
484 Ga0105248_11772109
485 Ga0105249_10357831
486 Ga0105249_11053138
487 Ga0105249_11198784
488 Ga0105249_12122761
489 Ga0105246_10406357
490 Ga0157374_10314851
491 Ga0157374_12200291
492 Ga0157378_12986670
493 Ga0163163_10240253
494 Ga0163163_12294103
495 Ga0157380_10193580
496 Ga0157380_10837165
497 Ga0157380_11714229
498 Ga0157379_10033900
499 Ga0157379_10040312
500 Ga0157379_10046834
501 Ga0157379_11325008
502 Ga0163161_10716050
503 Ga0207682_10183212
504 Ga0207642_10577710
505 Ga0207710_10112387
506 Ga0207680_10099638
507 Ga0207680_10455833
508 Ga0207699_10082483
509 Ga0207645_10088046
510 Ga0207645_10248196
511 Ga0207645_11195308
512 Ga0207643_10970382
513 Ga0207684_10420990
514 Ga0207684_11276739
515 Ga0207695_10350200
516 Ga0207646_11463995
517 Ga0207681_10065942
518 Ga0207681_10994270
519 Ga0207659_10013775
520 Ga0207700_10011497
521 Ga0207644_11302196
522 Ga0207690_10105837
523 Ga0207706_10410357
524 Ga0207686_10006191
525 Ga0207686_10909540
526 Ga0207686_11208744
527 Ga0207670_10118892
528 Ga0207669_11212945
529 Ga0207704_10289150
530 Ga0207691_10314336
531 Ga0207711_10244809
532 Ga0207711_10752679
533 Ga0207689_10273978
534 Ga0207689_10460599
535 Ga0207689_10732801
536 Ga0207661_10019488
537 Ga0207712_11082903
538 Ga0207668_10302158
539 Ga0207668_10469338
540 Ga0207640_11326779
541 Ga0207658_11116179
542 Ga0207677_10354675
543 Ga0207677_10664130
544 Ga0207703_10022504
545 Ga0207703_10295271
546 Ga0207703_10393157
547 Ga0207703_10477716
548 Ga0207703_12321288
549 Ga0207708_10038746
550 Ga0207641_10273376
551 Ga0207648_10749106
552 Ga0207648_10964673
553 Ga0207648_11022791
554 Ga0207648_11137819
555 Ga0207676_10135341
556 Ga0207675_100736514
557 Ga0207683_10863443
558 Ga0207683_11338428
559 Ga0207428_10122337
560 Ga0268266_10203879
561 Ga0268266_11057085
562 Ga0268265_10188715
563 Ga0268265_10329900
564 Ga0268265_10586158
565 Ga0268265_11000288
566 Ga0268264_10080554
567 Ga0268264_10342578
568 Ga0265316_10571001
569 Ga0307408_100146992
570 Ga0307405_11026768
571 Ga0307413_10158761
572 Ga0307413_10205374
573 Ga0307413_10962718
574 Ga0307410_10055814
575 Ga0307410_10114010
576 Ga0307410_10212615
577 Ga0307410_10822724
578 Ga0307406_11925245
579 Ga0307407_10093333
580 Ga0307407_10191638
581 Ga0307407_10627169
582 Ga0307412_10127868
583 Ga0307409_100004412
584 Ga0307409_100027239
585 Ga0307409_100305931
586 Ga0307409_101262827
587 Ga0307409_102416470
588 Ga0307416_100018960
589 Ga0307416_101467974
590 Ga0307416_102117538
591 Ga0307414_10053882
592 Ga0307411_10013939
593 Ga0307415_100018373
594 Ga0307415_102306362
595 Ga0373939_0539201
596 Ga0373927_0924390
597 Ga0451800_1568648
598 Ga0451851_1132061
599 Ga0451853_0493180
600 Ga0451853_3682173
601 Ga0451853_4071057
602 Ga0451577_1374006
603 Ga0439440_0197087
604 Ga0453683_0412949
605 Ga0495643_0002446
606 Ga0495644_0153337
607 Ga0495667_0228473
608 Ga0495656_0295250
609 Ga0495656_0598678
610 Ga0495659_0008809
611 Ga0495659_0280924
612 Ga0495599_0507244
613 Ga0495671_0519164
614 Ga0495676_0407895
615 Ga0496104_1393649
616 Ga0496105_0412926
617 Ga0496105_0692347
618 Ga0496106_0309734
619 Ga0496106_0709749
620 Ga0496114_0091914
621 Ga0496114_0619879
622 Ga0496114_1138854
623 Ga0501298_114206
624 Ga0501075_0698708
625 Ga0501206_048116
626 Ga0501261_125166
627 Ga0501225_0220243
628 nmdc:mga07m45_157222_c1
629 nmdc:mga05p37_1039080_c1
630 nmdc:mga05p37_1157584_c1
631 nmdc:mga05p37_1352465_c1
632 nmdc:mga05p37_149512_c1
633 nmdc:mga05p37_2024651_c1
634 nmdc:mga09592_1374024_c1
635 nmdc:mga09592_173802_c1
636 nmdc:mga09592_229487_c1
637 nmdc:mga09592_541744_c1
638 nmdc:mga0qj67_1245232_c1
639 nmdc:mga06r32_1307240_c1
640 nmdc:mga06r32_40944_c1
641 nmdc:mga06r32_750220_c1
642 nmdc:mga08y16_1245818_c1
643 nmdc:mga08y16_160211_c1
644 nmdc:mga08y16_2009279_c1
645 nmdc:mga08y16_70147_c1
646 nmdc:mga0n895_1460338_c1
647 nmdc:mga0n895_468787_c1
648 nmdc:mga0n895_489546_c1
649 nmdc:mga0n895_569057_c1
650 nmdc:mga0rr50_196202_c1
651 nmdc:mga08x19_20888_c1
652 nmdc:mga08x19_23688_c1
653 nmdc:mga0a205_1260620_c1
654 nmdc:mga0a205_625373_c1
655 nmdc:mga0a205_809551_c1
656 Ga0495601_0120338
657 Ga0590071_000758
658 Ga0590074_000602
659 Ga0590075_000883
660 Ga0590077_000904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

28

100

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9018 12 77
5hs8-assembly1.cif.gz_A crystal structure of the diamide-treated yodb from b. subtilis 0.8883 15 93
5x11-assembly3.cif.gz_C crystal structure of bacillus subtilis padr in complex with operator dna 0.8809 10 88
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.8808 10 78
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8794 10 88
ID Description Score Start End Superfamily
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9018 12 77 1.10.10.10
af_Q57807_1_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8956 10 98 1.10.10.10
af_O53921_2_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8938 10 97 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.879 10 78 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8783 10 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A454THX2-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9672 7 96
AF-A0A1F2VAE1-F1-model_v4 Uncharacterized protein 0.955 3 94
AF-A0A2V8EWH2-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9443 8 99
AF-A0A1F2VKR1-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9432 1 103
AF-A0A2D9T159-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9386 7 96

Map