F410056

General Info

Members Datasets Scaffolds Average Seq Length
330 156 660 175

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10344648|Ga0105245_103446483
Length 182
Sequence VAGVITLYDAERCPYCARVRIALAEKGIEHEVVAIDLSDRPAWLYEKNPLGKVPVIEEDTFVLPESAVIMDYLDERYPEPPLLPADPAARGLARLQVWRFDDLLGDDYYAYRRGDPNRLEERLAALDLGHQLFVDIAYIPWVIRAKHMLGVDLPAHLDAWLERALERPSVATELEIVAALAT

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 4.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 9.7
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10344648 3300009098 Bacteria 1474
2 Ga0070658_10001993 3300005327 Bacteria 17160
3 Ga0070658_10131675 3300005327 Bacteria 2084
4 Ga0070658_10198822 3300005327 Bacteria 1691
5 Ga0070658_10479654 3300005327 Bacteria 1073
6 Ga0070683_100005332 3300005329 Bacteria 10719
7 Ga0070683_100277361 3300005329 Bacteria 1595
8 Ga0070683_100292065 3300005329 Bacteria 1550
9 Ga0070683_100514475 3300005329 Bacteria 1144
10 Ga0070680_100026618 3300005336 Bacteria 4625
11 Ga0070680_100036017 3300005336 Bacteria 3997
12 Ga0070680_100390426 3300005336 Bacteria 1186
13 Ga0070680_100526644 3300005336 Bacteria 1012
14 Ga0070682_100078246 3300005337 Bacteria 2133
15 Ga0068868_100590578 3300005338 Bacteria 983
16 Ga0068868_100842028 3300005338 Bacteria 830
17 Ga0070660_100002630 3300005339 Bacteria 12341
18 Ga0070660_100050751 3300005339 Bacteria 3192
19 Ga0070660_100206680 3300005339 Bacteria 1593
20 Ga0070660_100421358 3300005339 Bacteria 1105
21 Ga0070691_10675586 3300005341 Bacteria 617
22 Ga0070661_100029707 3300005344 Bacteria 3946
23 Ga0070661_100048943 3300005344 Bacteria 3095
24 Ga0070661_100577943 3300005344 Bacteria 906
25 Ga0070709_10469385 3300005434 Bacteria 951
26 Ga0070714_100458894 3300005435 Bacteria 1211
27 Ga0070714_100766827 3300005435 Bacteria 933
28 Ga0070714_100944345 3300005435 Bacteria 838
29 Ga0070710_10646558 3300005437 Bacteria 741
30 Ga0070711_100065751 3300005439 Archaea 2537
31 Ga0070708_100039225 3300005445 Bacteria 4143
32 Ga0070708_100586293 3300005445 Bacteria 1051
33 Ga0070663_100212420 3300005455 Bacteria 1516
34 Ga0070663_100339733 3300005455 Bacteria 1213
35 Ga0070681_10001845 3300005458 Bacteria 19131
36 Ga0070681_10003441 3300005458 Bacteria 14822
37 Ga0070681_10004166 3300005458 Bacteria 13683
38 Ga0070681_10029404 3300005458 Bacteria 5518
39 Ga0070681_10044882 3300005458 Unclassified 4424
40 Ga0070681_10072091 3300005458 Unclassified 3417
41 Ga0070681_10470791 3300005458 Unclassified 1169
42 Ga0070706_100165916 3300005467 Unclassified 2062
43 Ga0070707_100288289 3300005468 Unclassified 1595
44 Ga0070699_100252444 3300005518 Bacteria 1576
45 Ga0070679_100003543 3300005530 Bacteria 14302
46 Ga0070679_100016975 3300005530 Bacteria 7037
47 Ga0070679_100037248 3300005530 Bacteria 4830
48 Ga0070679_100059039 3300005530 Bacteria 3823
49 Ga0070684_100000815 3300005535 Bacteria 21767
50 Ga0070684_100076587 3300005535 Bacteria 2952
51 Ga0070684_100253975 3300005535 Bacteria 1607
52 Ga0070684_100451947 3300005535 Bacteria 1187
53 Ga0068853_100204403 3300005539 Bacteria 1798
54 Ga0068853_100536581 3300005539 Bacteria 1107
55 Ga0070693_100245645 3300005547 Bacteria 1184
56 Ga0070665_100143886 3300005548 Unclassified 2387
57 Ga0068855_100015550 3300005563 Bacteria 9160
58 Ga0068855_100229303 3300005563 Bacteria 2080
59 Ga0068855_100684751 3300005563 Bacteria 1098
60 Ga0068855_100939074 3300005563 Bacteria 912
61 Ga0068857_100024020 3300005577 Bacteria 5365
62 Ga0068857_100055902 3300005577 Bacteria 3502
63 Ga0068856_100112728 3300005614 Bacteria 2717
64 Ga0068852_100242582 3300005616 Bacteria 1723
65 Ga0068852_100767738 3300005616 Bacteria 977
66 Ga0070717_10114266 3300006028 Bacteria 2306
67 Ga0075365_10775637 3300006038 Bacteria 677
68 Ga0070712_100884097 3300006175 Bacteria 770
69 Ga0070712_100918704 3300006175 Bacteria 755
70 Ga0068871_100201611 3300006358 Bacteria 1718
71 Ga0075434_101056818 3300006871 Bacteria 826
72 Ga0105240_10058989 3300009093 Bacteria 4790
73 Ga0105240_10216494 3300009093 Bacteria 2234
74 Ga0105240_10395710 3300009093 Bacteria 1557
75 Ga0105245_11137735 3300009098 Bacteria 827
76 Ga0105241_10172072 3300009174 Bacteria 1789
77 Ga0105237_10038253 3300009545 Bacteria 4845
78 Ga0105237_10053491 3300009545 Bacteria 4050
79 Ga0105237_10453160 3300009545 Bacteria 1289
80 Ga0105238_10092919 3300009551 Bacteria 3005
81 Ga0105238_10184153 3300009551 Bacteria 2065
82 Ga0105249_10561588 3300009553 Bacteria 1193
83 Ga0105239_11048650 3300010375 Bacteria 938
84 Ga0105239_11737126 3300010375 Bacteria 722
85 Ga0157373_10015383 3300013100 Bacteria 5592
86 Ga0157373_10634329 3300013100 Bacteria 779
87 Ga0157370_10051981 3300013104 Bacteria 3913
88 Ga0157370_10061869 3300013104 Bacteria 3552
89 Ga0157370_10067072 3300013104 Bacteria 3392
90 Ga0157370_10121221 3300013104 Bacteria 2441
91 Ga0157370_11529395 3300013104 Unclassified 600
92 Ga0157369_10135039 3300013105 Bacteria 2612
93 Ga0157369_10157520 3300013105 Bacteria 2398
94 Ga0157369_10207926 3300013105 Bacteria 2052
95 Ga0157374_10032244 3300013296 Bacteria 4769
96 Ga0157374_10148934 3300013296 Bacteria 2275
97 Ga0157372_10064310 3300013307 Bacteria 4116
98 Ga0157372_10076496 3300013307 Bacteria 3779
99 Ga0157372_10121353 3300013307 Unclassified 3002
100 Ga0157372_10294518 3300013307 Bacteria 1887
101 Ga0157372_10430303 3300013307 Bacteria 1538
102 Ga0157372_10676320 3300013307 Bacteria 1201
103 Ga0157372_10973361 3300013307 Bacteria 983
104 Ga0163163_11186379 3300014325 Unclassified 826
105 Ga0157376_11146327 3300014969 Bacteria 804
106 Ga0182007_10087217 3300015262 Bacteria 1026
107 Ga0197907_10336061 3300020069 Bacteria 1235
108 Ga0197907_11022059 3300020069 Bacteria 2947
109 Ga0206356_10575511 3300020070 Unclassified 626
110 Ga0206356_10659644 3300020070 Bacteria 2307
111 Ga0206356_11476314 3300020070 Unclassified 1279
112 Ga0206356_11910667 3300020070 Bacteria 901
113 Ga0206354_10141706 3300020081 Bacteria 3051
114 Ga0206354_10670230 3300020081 Bacteria 1593
115 Ga0206354_10764049 3300020081 Bacteria 2280
116 Ga0206354_11168277 3300020081 Bacteria 1735
117 Ga0206353_10021557 3300020082 Bacteria 2259
118 Ga0206353_10289713 3300020082 Bacteria 1843
119 Ga0206353_11476722 3300020082 Unclassified 2117
120 Ga0224712_10104449 3300022467 Bacteria 1206
121 Ga0224712_10157453 3300022467 Bacteria 1011
122 Ga0207699_10423197 3300025906 Bacteria 952
123 Ga0207705_10045651 3300025909 Bacteria 3148
124 Ga0207705_10123292 3300025909 Unclassified 1924
125 Ga0207705_10223465 3300025909 Bacteria 1431
126 Ga0207684_10141428 3300025910 Unclassified 2069
127 Ga0207654_10196917 3300025911 Bacteria 1324
128 Ga0207707_10027363 3300025912 Bacteria 4988
129 Ga0207707_10047556 3300025912 Unclassified 3736
130 Ga0207707_10151430 3300025912 Unclassified 2028
131 Ga0207707_10351905 3300025912 Bacteria 1269
132 Ga0207707_10496550 3300025912 Unclassified 1041
133 Ga0207695_10143849 3300025913 Unclassified 2331
134 Ga0207695_10573128 3300025913 Bacteria 1010
135 Ga0207671_10111519 3300025914 Unclassified 2081
136 Ga0207693_10191068 3300025915 Archaea 1611
137 Ga0207663_10026845 3300025916 Archaea 3347
138 Ga0207660_10025321 3300025917 Bacteria 4026
139 Ga0207660_10226783 3300025917 Bacteria 1468
140 Ga0207660_10431988 3300025917 Bacteria 1063
141 Ga0207660_10511399 3300025917 Bacteria 975
142 Ga0207657_10000433 3300025919 Bacteria 44551
143 Ga0207657_10008706 3300025919 Bacteria 10270
144 Ga0207657_10022487 3300025919 Bacteria 5896
145 Ga0207657_10032554 3300025919 Bacteria 4708
146 Ga0207657_10043615 3300025919 Bacteria 3949
147 Ga0207657_10068991 3300025919 Bacteria 3002
148 Ga0207657_10266125 3300025919 Unclassified 1363
149 Ga0207649_10327011 3300025920 Bacteria 1128
150 Ga0207652_10041073 3300025921 Bacteria 3930
151 Ga0207652_10043988 3300025921 Bacteria 3804
152 Ga0207652_10049714 3300025921 Bacteria 3590
153 Ga0207652_10054547 3300025921 Bacteria 3436
154 Ga0207652_10165778 3300025921 Bacteria 1981
155 Ga0207646_10286352 3300025922 Bacteria 1489
156 Ga0207694_10163876 3300025924 Bacteria 1797
157 Ga0207687_10101682 3300025927 Unclassified 2116
158 Ga0207664_10539132 3300025929 Bacteria 1046
159 Ga0207664_10590305 3300025929 Unclassified 997
160 Ga0207690_10578118 3300025932 Bacteria 915
161 Ga0207669_10147974 3300025937 Unclassified 1641
162 Ga0207661_10015842 3300025944 Bacteria 5554
163 Ga0207661_10110476 3300025944 Unclassified 2324
164 Ga0207661_10505677 3300025944 Bacteria 1104
165 Ga0207667_10020264 3300025949 Bacteria 7401
166 Ga0207667_10066448 3300025949 Bacteria 3759
167 Ga0207667_10202088 3300025949 Bacteria 2038
168 Ga0207667_10399162 3300025949 Unclassified 1400
169 Ga0207639_10149541 3300026041 Bacteria 1955
170 Ga0207639_10256364 3300026041 Unclassified 1528
171 Ga0207678_10338277 3300026067 Bacteria 1296
172 Ga0207702_10277447 3300026078 Bacteria 1583
173 Ga0207702_10334291 3300026078 Bacteria 1446
174 Ga0207674_10019411 3300026116 Bacteria 7362
175 Ga0207674_10071315 3300026116 Bacteria 3491
176 Ga0207674_10122568 3300026116 Bacteria 2566
177 Ga0207683_10111848 3300026121 Bacteria 2445
178 Ga0207698_10042010 3300026142 Bacteria 3412
179 Ga0207698_10229113 3300026142 Bacteria 1685
180 Ga0207698_10265808 3300026142 Unclassified 1578
181 Ga0207698_10564222 3300026142 Unclassified 1118
182 Ga0268266_10157082 3300028379 Bacteria 2055
183 Ga0268266_10519692 3300028379 Bacteria 1138
184 Ga0373955_0061219 3300035172 Archaea 2078
185 Ga0373931_0187468 3300035691 Bacteria 1229
186 Ga0373935_0410804 3300035692 Bacteria 973
187 Ga0373933_0092663 3300035724 Bacteria 1866
188 Ga0373947_0099939 3300035725 Bacteria 1822
189 Ga0373947_0282797 3300035725 Bacteria 1103
190 Ga0373937_0066338 3300036401 Archaea 3323
191 Ga0373937_0222708 3300036401 Bacteria 1776
192 Ga0373937_0427607 3300036401 Bacteria 1257
193 Ga0395899_0056669 3300037312 Unclassified 2896
194 Ga0395900_0057973 3300037418 Bacteria 3987
195 Ga0395905_0317070 3300037471 Bacteria 1448
196 Ga0395905_1305719 3300037471 Bacteria 629
197 Ga0436364_0631366 3300037853 Bacteria 3397
198 Ga0395901_0036309 3300038443 Bacteria 5093
199 Ga0395901_0079861 3300038443 Bacteria 3415
200 Ga0395901_0465112 3300038443 Bacteria 1292
201 Ga0395901_1250067 3300038443 Unclassified 706
202 Ga0436365_0904554 3300039437 Bacteria 2360
203 Ga0451853_2410209 3300041512 Unclassified 940
204 Ga0466966_0247348 3300044684 Bacteria 1074
205 Ga0466961_0021554 3300044693 Unclassified 4146
206 Ga0466961_0049740 3300044693 Bacteria 2678
207 Ga0466963_0001406 3300044694 Bacteria 12923
208 Ga0466963_0005162 3300044694 Bacteria 7624
209 Ga0466963_0008124 3300044694 Bacteria 6283
210 Ga0466963_0085604 3300044694 Bacteria 2140
211 Ga0466963_0178217 3300044694 Unclassified 1483
212 Ga0466963_0303242 3300044694 Unclassified 1123
213 Ga0466964_0010159 3300044706 Bacteria 3549
214 Ga0466964_0037562 3300044706 Unclassified 1945
215 Ga0466971_0000385 3300044719 Bacteria 16997
216 Ga0466971_0049831 3300044719 Bacteria 1884
217 Ga0466971_0183582 3300044719 Bacteria 984
218 Ga0466971_0313910 3300044719 Unclassified 754
219 Ga0466957_0000164 3300044842 Bacteria 29396
220 Ga0466957_0048782 3300044842 Bacteria 2573
221 Ga0466959_0055649 3300045049 Bacteria 2887
222 Ga0466959_0059409 3300045049 Bacteria 2784
223 Ga0466959_0065763 3300045049 Bacteria 2631
224 Ga0466958_0000218 3300045836 Bacteria 21642
225 Ga0466958_0270810 3300045836 Bacteria 1087
226 Ga0466958_0408506 3300045836 Bacteria 877
227 Ga0466967_0000911 3300045976 Bacteria 15866
228 Ga0466967_0016523 3300045976 Bacteria 5824
229 Ga0466967_0019021 3300045976 Bacteria 5512
230 Ga0466967_0029740 3300045976 Bacteria 4576
231 Ga0466967_0136075 3300045976 Unclassified 2285
232 Ga0466967_0189483 3300045976 Bacteria 1943
233 Ga0466967_0218783 3300045976 Unclassified 1809
234 Ga0466967_0291346 3300045976 Bacteria 1568
235 Ga0495592_0096135 3300046454 Archaea 2117
236 Ga0495592_0195804 3300046454 Bacteria 1367
237 Ga0495603_0010847 3300046455 Bacteria 5527
238 Ga0495629_0010575 3300046459 Bacteria 6712
239 Ga0495629_0093145 3300046459 Bacteria 2103
240 Ga0495651_0002813 3300046462 Bacteria 13492
241 Ga0495651_0027642 3300046462 Bacteria 4420
242 Ga0495653_0019618 3300046463 Bacteria 5483
243 Ga0495653_0080506 3300046463 Bacteria 2410
244 Ga0495605_0106824 3300046474 Bacteria 1281
245 Ga0495608_0001655 3300046511 Bacteria 16043
246 Ga0495608_0029738 3300046511 Archaea 3702
247 Ga0495608_0181410 3300046511 Bacteria 1331
248 Ga0495618_0287206 3300046514 Bacteria 1025
249 Ga0495628_0019109 3300046516 Bacteria 5668
250 Ga0495628_0029192 3300046516 Archaea 4475
251 Ga0495630_0056696 3300046517 Archaea 2935
252 Ga0495652_0022886 3300046529 Bacteria 5543
253 Ga0495652_0147525 3300046529 Bacteria 1842
254 Ga0495640_0183071 3300046533 Bacteria 1334
255 Ga0495586_0176392 3300046535 Bacteria 1208
256 Ga0495587_0014591 3300046536 Bacteria 4923
257 Ga0495645_0057474 3300046543 Archaea 2823
258 Ga0495645_0150887 3300046543 Bacteria 1615
259 Ga0495667_0028798 3300046559 Bacteria 3741
260 Ga0495667_0109977 3300046559 Bacteria 1780
261 Ga0495634_0156172 3300046642 Unclassified 1440
262 Ga0495635_0029741 3300046663 Archaea 3799
263 Ga0495659_0216321 3300046664 Bacteria 790
264 Ga0495657_0014444 3300046675 Bacteria 5797
265 Ga0495599_0019550 3300046678 Bacteria 4222
266 Ga0495599_0105749 3300046678 Bacteria 1753
267 Ga0495623_0014076 3300046679 Bacteria 5182
268 Ga0495658_0037610 3300046683 Bacteria 2676
269 Ga0495613_0084609 3300046689 Archaea 2303
270 Ga0495613_0095261 3300046689 Bacteria 2153
271 Ga0495624_0421729 3300046690 Unclassified 800
272 Ga0495600_0051578 3300046809 Archaea 2685
273 Ga0495604_0015929 3300047317 Bacteria 6003
274 Ga0495604_0097240 3300047317 Archaea 2171
275 Ga0495604_0510361 3300047317 Bacteria 779
276 Ga0495674_0042982 3300047319 Bacteria 4026
277 Ga0495674_0097172 3300047319 Bacteria 2509
278 Ga0495676_0037667 3300047321 Bacteria 4023
279 Ga0495676_0336620 3300047321 Bacteria 1011
280 Ga0495680_0017554 3300047322 Bacteria 6104
281 Ga0495680_0019721 3300047322 Bacteria 5688
282 Ga0495675_0011425 3300047444 Bacteria 5574
283 Ga0495684_0029794 3300047471 Archaea 4188
284 Ga0495684_0301314 3300047471 Bacteria 1151
285 Ga0495593_0263314 3300047673 Bacteria 863
286 Ga0495602_0060081 3300048088 Archaea 3314
287 Ga0495602_0275880 3300048088 Bacteria 1241
288 Ga0495602_0653202 3300048088 Unclassified 718
289 Ga0496100_0081921 3300048903 Bacteria 2181
290 Ga0496100_0098653 3300048903 Bacteria 2008
291 Ga0496101_0051823 3300048904 Bacteria 2958
292 Ga0496101_0180946 3300048904 Bacteria 1623
293 Ga0496101_0233039 3300048904 Bacteria 1431
294 Ga0496102_0092175 3300048905 Unclassified 2806
295 Ga0496102_0161770 3300048905 Bacteria 2106
296 Ga0496102_0374389 3300048905 Bacteria 1340
297 Ga0496102_1124153 3300048905 Unclassified 705
298 Ga0496104_1107294 3300048907 Bacteria 695
299 Ga0496105_0036086 3300048908 Bacteria 4071
300 Ga0496106_0006226 3300048909 Bacteria 8829
301 Ga0496106_0112159 3300048909 Bacteria 2124
302 Ga0496107_0147233 3300048910 Bacteria 1741
303 Ga0496108_0001081 3300048911 Bacteria 21249
304 Ga0496109_0006636 3300048912 Bacteria 9745
305 Ga0496109_0726491 3300048912 Bacteria 931
306 Ga0496110_0000469 3300048913 Bacteria 27430
307 Ga0496110_0826779 3300048913 Bacteria 831
308 Ga0496112_0005680 3300048915 Bacteria 10837
309 Ga0496112_0023132 3300048915 Bacteria 5932
310 Ga0496112_0147333 3300048915 Bacteria 2322
311 Ga0496112_0247762 3300048915 Bacteria 1733
312 Ga0496112_0254175 3300048915 Unclassified 1708
313 Ga0496113_0241217 3300048916 Bacteria 1442
314 Ga0496113_0301776 3300048916 Bacteria 1282
315 Ga0496114_0025071 3300048917 Bacteria 4871
316 Ga0496114_0051939 3300048917 Bacteria 3414
317 Ga0496114_0384677 3300048917 Bacteria 1242
318 Ga0496114_0841951 3300048917 Bacteria 797
319 Ga0496115_0057135 3300048918 Bacteria 3138
320 Ga0496115_0867593 3300048918 Bacteria 698
321 Ga0501067_0011365 3300049583 Bacteria 4930
322 Ga0501067_0215611 3300049583 Bacteria 1069
323 Ga0501069_0489677 3300049585 Bacteria 733
324 Ga0495601_0056500 3300053077 Bacteria 2486
325 Ga0495595_0004802 3300053084 Bacteria 5442
326 Ga0495619_0131676 3300053085 Unclassified 1719
327 Ga0495619_0285917 3300053085 Archaea 1142
328 Ga0466962_0000275 3300061719 Bacteria 21710
329 Ga0466962_0042529 3300061719 Bacteria 2175
330 Ga0466962_0128370 3300061719 Bacteria 1225
331 Ga0105245_10344648
332 Ga0070658_10001993
333 Ga0070658_10131675
334 Ga0070658_10198822
335 Ga0070658_10479654
336 Ga0070683_100005332
337 Ga0070683_100277361
338 Ga0070683_100292065
339 Ga0070683_100514475
340 Ga0070680_100026618
341 Ga0070680_100036017
342 Ga0070680_100390426
343 Ga0070680_100526644
344 Ga0070682_100078246
345 Ga0068868_100590578
346 Ga0068868_100842028
347 Ga0070660_100002630
348 Ga0070660_100050751
349 Ga0070660_100206680
350 Ga0070660_100421358
351 Ga0070691_10675586
352 Ga0070661_100029707
353 Ga0070661_100048943
354 Ga0070661_100577943
355 Ga0070709_10469385
356 Ga0070714_100458894
357 Ga0070714_100766827
358 Ga0070714_100944345
359 Ga0070710_10646558
360 Ga0070711_100065751
361 Ga0070708_100039225
362 Ga0070708_100586293
363 Ga0070663_100212420
364 Ga0070663_100339733
365 Ga0070681_10001845
366 Ga0070681_10003441
367 Ga0070681_10004166
368 Ga0070681_10029404
369 Ga0070681_10044882
370 Ga0070681_10072091
371 Ga0070681_10470791
372 Ga0070706_100165916
373 Ga0070707_100288289
374 Ga0070699_100252444
375 Ga0070679_100003543
376 Ga0070679_100016975
377 Ga0070679_100037248
378 Ga0070679_100059039
379 Ga0070684_100000815
380 Ga0070684_100076587
381 Ga0070684_100253975
382 Ga0070684_100451947
383 Ga0068853_100204403
384 Ga0068853_100536581
385 Ga0070693_100245645
386 Ga0070665_100143886
387 Ga0068855_100015550
388 Ga0068855_100229303
389 Ga0068855_100684751
390 Ga0068855_100939074
391 Ga0068857_100024020
392 Ga0068857_100055902
393 Ga0068856_100112728
394 Ga0068852_100242582
395 Ga0068852_100767738
396 Ga0070717_10114266
397 Ga0075365_10775637
398 Ga0070712_100884097
399 Ga0070712_100918704
400 Ga0068871_100201611
401 Ga0075434_101056818
402 Ga0105240_10058989
403 Ga0105240_10216494
404 Ga0105240_10395710
405 Ga0105245_11137735
406 Ga0105241_10172072
407 Ga0105237_10038253
408 Ga0105237_10053491
409 Ga0105237_10453160
410 Ga0105238_10092919
411 Ga0105238_10184153
412 Ga0105249_10561588
413 Ga0105239_11048650
414 Ga0105239_11737126
415 Ga0157373_10015383
416 Ga0157373_10634329
417 Ga0157370_10051981
418 Ga0157370_10061869
419 Ga0157370_10067072
420 Ga0157370_10121221
421 Ga0157370_11529395
422 Ga0157369_10135039
423 Ga0157369_10157520
424 Ga0157369_10207926
425 Ga0157374_10032244
426 Ga0157374_10148934
427 Ga0157372_10064310
428 Ga0157372_10076496
429 Ga0157372_10121353
430 Ga0157372_10294518
431 Ga0157372_10430303
432 Ga0157372_10676320
433 Ga0157372_10973361
434 Ga0163163_11186379
435 Ga0157376_11146327
436 Ga0182007_10087217
437 Ga0197907_10336061
438 Ga0197907_11022059
439 Ga0206356_10575511
440 Ga0206356_10659644
441 Ga0206356_11476314
442 Ga0206356_11910667
443 Ga0206354_10141706
444 Ga0206354_10670230
445 Ga0206354_10764049
446 Ga0206354_11168277
447 Ga0206353_10021557
448 Ga0206353_10289713
449 Ga0206353_11476722
450 Ga0224712_10104449
451 Ga0224712_10157453
452 Ga0207699_10423197
453 Ga0207705_10045651
454 Ga0207705_10123292
455 Ga0207705_10223465
456 Ga0207684_10141428
457 Ga0207654_10196917
458 Ga0207707_10027363
459 Ga0207707_10047556
460 Ga0207707_10151430
461 Ga0207707_10351905
462 Ga0207707_10496550
463 Ga0207695_10143849
464 Ga0207695_10573128
465 Ga0207671_10111519
466 Ga0207693_10191068
467 Ga0207663_10026845
468 Ga0207660_10025321
469 Ga0207660_10226783
470 Ga0207660_10431988
471 Ga0207660_10511399
472 Ga0207657_10000433
473 Ga0207657_10008706
474 Ga0207657_10022487
475 Ga0207657_10032554
476 Ga0207657_10043615
477 Ga0207657_10068991
478 Ga0207657_10266125
479 Ga0207649_10327011
480 Ga0207652_10041073
481 Ga0207652_10043988
482 Ga0207652_10049714
483 Ga0207652_10054547
484 Ga0207652_10165778
485 Ga0207646_10286352
486 Ga0207694_10163876
487 Ga0207687_10101682
488 Ga0207664_10539132
489 Ga0207664_10590305
490 Ga0207690_10578118
491 Ga0207669_10147974
492 Ga0207661_10015842
493 Ga0207661_10110476
494 Ga0207661_10505677
495 Ga0207667_10020264
496 Ga0207667_10066448
497 Ga0207667_10202088
498 Ga0207667_10399162
499 Ga0207639_10149541
500 Ga0207639_10256364
501 Ga0207678_10338277
502 Ga0207702_10277447
503 Ga0207702_10334291
504 Ga0207674_10019411
505 Ga0207674_10071315
506 Ga0207674_10122568
507 Ga0207683_10111848
508 Ga0207698_10042010
509 Ga0207698_10229113
510 Ga0207698_10265808
511 Ga0207698_10564222
512 Ga0268266_10157082
513 Ga0268266_10519692
514 Ga0373955_0061219
515 Ga0373931_0187468
516 Ga0373935_0410804
517 Ga0373933_0092663
518 Ga0373947_0099939
519 Ga0373947_0282797
520 Ga0373937_0066338
521 Ga0373937_0222708
522 Ga0373937_0427607
523 Ga0395899_0056669
524 Ga0395900_0057973
525 Ga0395905_0317070
526 Ga0395905_1305719
527 Ga0436364_0631366
528 Ga0395901_0036309
529 Ga0395901_0079861
530 Ga0395901_0465112
531 Ga0395901_1250067
532 Ga0436365_0904554
533 Ga0451853_2410209
534 Ga0466966_0247348
535 Ga0466961_0021554
536 Ga0466961_0049740
537 Ga0466963_0001406
538 Ga0466963_0005162
539 Ga0466963_0008124
540 Ga0466963_0085604
541 Ga0466963_0178217
542 Ga0466963_0303242
543 Ga0466964_0010159
544 Ga0466964_0037562
545 Ga0466971_0000385
546 Ga0466971_0049831
547 Ga0466971_0183582
548 Ga0466971_0313910
549 Ga0466957_0000164
550 Ga0466957_0048782
551 Ga0466959_0055649
552 Ga0466959_0059409
553 Ga0466959_0065763
554 Ga0466958_0000218
555 Ga0466958_0270810
556 Ga0466958_0408506
557 Ga0466967_0000911
558 Ga0466967_0016523
559 Ga0466967_0019021
560 Ga0466967_0029740
561 Ga0466967_0136075
562 Ga0466967_0189483
563 Ga0466967_0218783
564 Ga0466967_0291346
565 Ga0495592_0096135
566 Ga0495592_0195804
567 Ga0495603_0010847
568 Ga0495629_0010575
569 Ga0495629_0093145
570 Ga0495651_0002813
571 Ga0495651_0027642
572 Ga0495653_0019618
573 Ga0495653_0080506
574 Ga0495605_0106824
575 Ga0495608_0001655
576 Ga0495608_0029738
577 Ga0495608_0181410
578 Ga0495618_0287206
579 Ga0495628_0019109
580 Ga0495628_0029192
581 Ga0495630_0056696
582 Ga0495652_0022886
583 Ga0495652_0147525
584 Ga0495640_0183071
585 Ga0495586_0176392
586 Ga0495587_0014591
587 Ga0495645_0057474
588 Ga0495645_0150887
589 Ga0495667_0028798
590 Ga0495667_0109977
591 Ga0495634_0156172
592 Ga0495635_0029741
593 Ga0495659_0216321
594 Ga0495657_0014444
595 Ga0495599_0019550
596 Ga0495599_0105749
597 Ga0495623_0014076
598 Ga0495658_0037610
599 Ga0495613_0084609
600 Ga0495613_0095261
601 Ga0495624_0421729
602 Ga0495600_0051578
603 Ga0495604_0015929
604 Ga0495604_0097240
605 Ga0495604_0510361
606 Ga0495674_0042982
607 Ga0495674_0097172
608 Ga0495676_0037667
609 Ga0495676_0336620
610 Ga0495680_0017554
611 Ga0495680_0019721
612 Ga0495675_0011425
613 Ga0495684_0029794
614 Ga0495684_0301314
615 Ga0495593_0263314
616 Ga0495602_0060081
617 Ga0495602_0275880
618 Ga0495602_0653202
619 Ga0496100_0081921
620 Ga0496100_0098653
621 Ga0496101_0051823
622 Ga0496101_0180946
623 Ga0496101_0233039
624 Ga0496102_0092175
625 Ga0496102_0161770
626 Ga0496102_0374389
627 Ga0496102_1124153
628 Ga0496104_1107294
629 Ga0496105_0036086
630 Ga0496106_0006226
631 Ga0496106_0112159
632 Ga0496107_0147233
633 Ga0496108_0001081
634 Ga0496109_0006636
635 Ga0496109_0726491
636 Ga0496110_0000469
637 Ga0496110_0826779
638 Ga0496112_0005680
639 Ga0496112_0023132
640 Ga0496112_0147333
641 Ga0496112_0247762
642 Ga0496112_0254175
643 Ga0496113_0241217
644 Ga0496113_0301776
645 Ga0496114_0025071
646 Ga0496114_0051939
647 Ga0496114_0384677
648 Ga0496114_0841951
649 Ga0496115_0057135
650 Ga0496115_0867593
651 Ga0501067_0011365
652 Ga0501067_0215611
653 Ga0501069_0489677
654 Ga0495601_0056500
655 Ga0495595_0004802
656 Ga0495619_0131676
657 Ga0495619_0285917
658 Ga0466962_0000275
659 Ga0466962_0042529
660 Ga0466962_0128370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

7

81

0.99

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

3

75

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

12

76

0.95

PF00462

Glutaredoxin

Glutaredoxin

5

62

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hoj-assembly1.cif.gz_A-2 crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione 0.8645 1 170
6f05-assembly6.cif.gz_G arabidopsis thaliana gstf9, gso3 bound 0.8592 1 171
6f05-assembly6.cif.gz_H arabidopsis thaliana gstf9, gso3 bound 0.8552 2 171
4top-assembly1.cif.gz_A glycine max glutathione transferase 0.8538 2 175
6f05-assembly4.cif.gz_D arabidopsis thaliana gstf9, gso3 bound 0.8519 2 171
ID Description Score Start End Superfamily
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9445 2 70 3.80.10.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9343 3 74 3.40.30.10
af_Q9VSL6_6_114_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9177 2 88 3.40.30.10
3fhsB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9174 2 81 3.40.30.10
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9173 2 71 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W1N733-F1-model_v4 Glutathione S-transferase family protein 0.9834 1 176 GO:0005737
GO:0016740
AF-A0A7W1N733-F1-model_v4 Glutathione S-transferase family protein 0.9778 1 176 GO:0005737
GO:0016740
AF-A0A7Y5U6T8-F1-model_v4 Glutathione S-transferase family protein 0.9643 1 147 GO:0005737
GO:0016740
AF-A0A7Y5U6T8-F1-model_v4 Glutathione S-transferase family protein 0.958 1 147 GO:0005737
GO:0016740
AF-A0A3B1AS66-F1-model_v4 GST N-terminal domain-containing protein 0.9271 2 110 GO:0005737

Map