F409983

General Info

Members Datasets Scaffolds Average Seq Length
330 157 660 351

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10004072|Ga0070701_100040725
Length 365
Sequence VIPLRILILEAQVPFVHGGAEILVRELAAALTARGHDAQIVSIPFTDHPKDELLAGAEAWRLVDVTKSAGGDVDLVIPTKFPTYFAKHPRKVLWLVHQHRAAYELAGTRFSDYTHTARDVALRRRLIDTDTRMLRECVGHFTIARTVSDRMLKYNGIASEALYNPPKLASRLHSGPYGDYVLTVTRLEHVKRVDLTIDAFEKTASSVRLLIAGDGSIRHELAEYIERRGLRDRVTLLGRVDDERLIELYAGCRAVLFAPYEEDYGYVTLEAFLSRKPVITARDSGGTLEFVADGVNGYVCEPTPDALAEAVNRLAADPALAASLGERGHGVAANITWDHVVDRLIDAGSRSPRVNAAAGESRAAV

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 0.61
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10004072 3300005438 Bacteria 5866
2 Ga0065704_10071765 3300005289 Bacteria 9984
3 Ga0065715_10096663 3300005293 Bacteria 3843
4 Ga0065715_10137995 3300005293 Bacteria 1898
5 Ga0065707_10001235 3300005295 Bacteria 9850
6 Ga0070690_100041842 3300005330 Bacteria 2901
7 Ga0070690_100051405 3300005330 Bacteria 2631
8 Ga0070670_100172954 3300005331 Bacteria 1874
9 Ga0068869_100030881 3300005334 Bacteria 3765
10 Ga0068869_100087296 3300005334 Unclassified 2340
11 Ga0070680_100358890 3300005336 Bacteria 1240
12 Ga0068868_100018194 3300005338 Bacteria 5249
13 Ga0068868_100298339 3300005338 Bacteria 1368
14 Ga0070689_100013091 3300005340 Bacteria 5995
15 Ga0070689_100128611 3300005340 Unclassified 2029
16 Ga0070689_100167545 3300005340 Bacteria 1779
17 Ga0070692_10065261 3300005345 Bacteria 1927
18 Ga0070668_100016115 3300005347 Bacteria 5593
19 Ga0070669_100001131 3300005353 Bacteria 19486
20 Ga0070669_100031468 3300005353 Bacteria 3832
21 Ga0070675_100004474 3300005354 Bacteria 10664
22 Ga0070675_100028566 3300005354 Bacteria 4489
23 Ga0070675_100108040 3300005354 Bacteria 2350
24 Ga0070675_100153733 3300005354 Bacteria 1974
25 Ga0070671_100002291 3300005355 Bacteria 14774
26 Ga0070674_100131634 3300005356 Bacteria 1865
27 Ga0070673_100013454 3300005364 Bacteria 5661
28 Ga0070673_100202288 3300005364 Bacteria 1711
29 Ga0070673_100416734 3300005364 Bacteria 1203
30 Ga0070688_100089052 3300005365 Bacteria 2013
31 Ga0070688_100178281 3300005365 Bacteria 1472
32 Ga0070703_10002479 3300005406 Bacteria 5307
33 Ga0070701_10011973 3300005438 Bacteria 3896
34 Ga0070701_10033451 3300005438 Bacteria 2569
35 Ga0070705_100000578 3300005440 Bacteria 21273
36 Ga0070705_100018952 3300005440 Bacteria 3614
37 Ga0070705_100106749 3300005440 Unclassified 1781
38 Ga0070694_100000424 3300005444 Bacteria 23025
39 Ga0070694_100018559 3300005444 Bacteria 4415
40 Ga0070694_100055701 3300005444 Bacteria 2683
41 Ga0070694_100085713 3300005444 Unclassified 2200
42 Ga0070694_100213464 3300005444 Bacteria 1444
43 Ga0070708_100009000 3300005445 Bacteria 8046
44 Ga0070708_100105716 3300005445 Bacteria 2583
45 Ga0070708_100112197 3300005445 Unclassified 2507
46 Ga0070708_100313473 3300005445 Bacteria 1478
47 Ga0070678_100083678 3300005456 Bacteria 2426
48 Ga0070662_100018620 3300005457 Bacteria 4701
49 Ga0070662_100054174 3300005457 Bacteria 2906
50 Ga0068867_100011968 3300005459 Bacteria 6128
51 Ga0068867_100023086 3300005459 Bacteria 4452
52 Ga0070685_10029661 3300005466 Bacteria 3041
53 Ga0070706_100010063 3300005467 Bacteria 8785
54 Ga0070706_100017778 3300005467 Bacteria 6561
55 Ga0070706_100091290 3300005467 Bacteria 2824
56 Ga0070706_100411238 3300005467 Unclassified 1259
57 Ga0070707_100009245 3300005468 Bacteria 9146
58 Ga0070707_100085844 3300005468 Bacteria 3043
59 Ga0070698_100000681 3300005471 Bacteria 36301
60 Ga0070698_100002994 3300005471 Bacteria 18609
61 Ga0070698_100013608 3300005471 Bacteria 8612
62 Ga0070699_100000346 3300005518 Bacteria 44833
63 Ga0070699_100000833 3300005518 Bacteria 28579
64 Ga0070699_100001918 3300005518 Bacteria 18790
65 Ga0070699_100004733 3300005518 Bacteria 12029
66 Ga0070699_100043664 3300005518 Bacteria 3880
67 Ga0070699_100104115 3300005518 Bacteria 2489
68 Ga0070699_100180143 3300005518 Bacteria 1875
69 Ga0070684_100086807 3300005535 Bacteria 2777
70 Ga0070697_100031078 3300005536 Bacteria 4293
71 Ga0070697_100068753 3300005536 Bacteria 2899
72 Ga0070697_100139338 3300005536 Bacteria 2039
73 Ga0070672_100037964 3300005543 Bacteria 3678
74 Ga0070672_100041502 3300005543 Bacteria 3537
75 Ga0070686_100086202 3300005544 Bacteria 2090
76 Ga0070695_100000155 3300005545 Bacteria 32258
77 Ga0070696_100000499 3300005546 Bacteria 24777
78 Ga0070696_100064720 3300005546 Bacteria 2562
79 Ga0070696_100082527 3300005546 Bacteria 2279
80 Ga0070696_100146131 3300005546 Unclassified 1732
81 Ga0070704_100004806 3300005549 Bacteria 7827
82 Ga0070704_100005803 3300005549 Bacteria 7223
83 Ga0070704_100047929 3300005549 Bacteria 2989
84 Ga0070664_100018344 3300005564 Bacteria 5747
85 Ga0070664_100141049 3300005564 Bacteria 2122
86 Ga0070702_100020154 3300005615 Bacteria 3488
87 Ga0068859_100013062 3300005617 Bacteria 8344
88 Ga0068859_100014194 3300005617 Bacteria 7988
89 Ga0068859_100021478 3300005617 Bacteria 6480
90 Ga0068864_100028492 3300005618 Bacteria 4722
91 Ga0068864_100043301 3300005618 Bacteria 3854
92 Ga0068866_10013089 3300005718 Bacteria 3630
93 Ga0068861_100002974 3300005719 Bacteria 11182
94 Ga0068861_100022779 3300005719 Bacteria 4516
95 Ga0068861_100148240 3300005719 Bacteria 1922
96 Ga0068870_10004036 3300005840 Bacteria 6271
97 Ga0068870_10057055 3300005840 Bacteria 2087
98 Ga0068863_100009139 3300005841 Bacteria 9678
99 Ga0068858_100042400 3300005842 Bacteria 4219
100 Ga0068860_100037937 3300005843 Bacteria 4611
101 Ga0068860_100069217 3300005843 Bacteria 3354
102 Ga0068860_100459847 3300005843 Bacteria 1266
103 Ga0068862_100006870 3300005844 Bacteria 9437
104 Ga0075365_10011999 3300006038 Bacteria 5122
105 Ga0075363_100042244 3300006048 Bacteria 2408
106 Ga0075364_10105472 3300006051 Unclassified 1878
107 Ga0075367_10003272 3300006178 Bacteria 7673
108 Ga0075367_10099004 3300006178 Bacteria 1780
109 Ga0075366_10002766 3300006195 Bacteria 9077
110 Ga0097621_100157248 3300006237 Bacteria 1952
111 Ga0068871_100024480 3300006358 Bacteria 4683
112 Ga0075428_100032926 3300006844 Bacteria 5723
113 Ga0075428_100055976 3300006844 Bacteria 4321
114 Ga0075428_100067967 3300006844 Bacteria 3899
115 Ga0075428_100112451 3300006844 Bacteria 2966
116 Ga0075428_100243635 3300006844 Bacteria 1939
117 Ga0075431_100004477 3300006847 Bacteria 13711
118 Ga0075431_100154573 3300006847 Bacteria 2361
119 Ga0075431_100159985 3300006847 Unclassified 2316
120 Ga0075433_10002985 3300006852 Bacteria 12993
121 Ga0075433_10023626 3300006852 Bacteria 5177
122 Ga0075433_10045898 3300006852 Bacteria 3799
123 Ga0075433_10096644 3300006852 Bacteria 2614
124 Ga0075433_10123802 3300006852 Bacteria 2297
125 Ga0075433_10348017 3300006852 Bacteria 1310
126 Ga0075434_100002621 3300006871 Bacteria 15861
127 Ga0075434_100015195 3300006871 Bacteria 7376
128 Ga0075434_100018881 3300006871 Bacteria 6665
129 Ga0075434_100030277 3300006871 Bacteria 5328
130 Ga0075434_100030925 3300006871 Bacteria 5276
131 Ga0075434_100054690 3300006871 Bacteria 3965
132 Ga0075434_100058655 3300006871 Bacteria 3825
133 Ga0075434_100197397 3300006871 Unclassified 2032
134 Ga0075429_100006199 3300006880 Bacteria 10344
135 Ga0075429_100007976 3300006880 Bacteria 9197
136 Ga0075429_100076832 3300006880 Bacteria 2908
137 Ga0068865_100004538 3300006881 Bacteria 8375
138 Ga0097620_100013062 3300006931 Bacteria 8344
139 Ga0097620_100014195 3300006931 Bacteria 7988
140 Ga0097620_100021477 3300006931 Bacteria 6480
141 Ga0075435_100007636 3300007076 Bacteria 7722
142 Ga0075435_100027757 3300007076 Bacteria 4432
143 Ga0075435_100181273 3300007076 Bacteria 1780
144 Ga0111539_10000156 3300009094 Bacteria 77946
145 Ga0111539_10001815 3300009094 Bacteria 28417
146 Ga0111539_10037461 3300009094 Bacteria 5855
147 Ga0111539_10069760 3300009094 Bacteria 4150
148 Ga0111539_10117837 3300009094 Bacteria 3112
149 Ga0105245_10017335 3300009098 Bacteria 6282
150 Ga0114129_10000307 3300009147 Bacteria 57086
151 Ga0114129_10002178 3300009147 Bacteria 26967
152 Ga0114129_10002512 3300009147 Bacteria 25458
153 Ga0114129_10005105 3300009147 Bacteria 18486
154 Ga0114129_10022596 3300009147 Bacteria 8922
155 Ga0114129_10029022 3300009147 Bacteria 7836
156 Ga0114129_10032252 3300009147 Bacteria 7403
157 Ga0114129_10073581 3300009147 Bacteria 4761
158 Ga0114129_10079431 3300009147 Bacteria 4562
159 Ga0114129_10696710 3300009147 Unclassified 1306
160 Ga0105243_10001209 3300009148 Bacteria 23242
161 Ga0105243_10095004 3300009148 Bacteria 2463
162 Ga0105242_10009260 3300009176 Bacteria 7559
163 Ga0105249_10061560 3300009553 Bacteria 3445
164 Ga0157375_10016504 3300013308 Bacteria 6637
165 Ga0157375_10207067 3300013308 Bacteria 2118
166 Ga0157375_10290080 3300013308 Bacteria 1799
167 Ga0163163_10004494 3300014325 Bacteria 11905
168 Ga0163163_10405060 3300014325 Bacteria 1422
169 Ga0157380_10001241 3300014326 Bacteria 16558
170 Ga0157380_10024731 3300014326 Bacteria 4549
171 Ga0157380_10030826 3300014326 Bacteria 4110
172 Ga0157377_10226791 3300014745 Bacteria 1199
173 Ga0157379_10045289 3300014968 Bacteria 3927
174 Ga0163161_10118447 3300017792 Bacteria 1987
175 Ga0207645_10045955 3300025907 Bacteria 2790
176 Ga0207643_10006771 3300025908 Bacteria 6147
177 Ga0207643_10013212 3300025908 Bacteria 4467
178 Ga0207643_10205892 3300025908 Bacteria 1199
179 Ga0207684_10002830 3300025910 Bacteria 17241
180 Ga0207662_10001095 3300025918 Bacteria 12747
181 Ga0207646_10006694 3300025922 Bacteria 11877
182 Ga0207646_10027857 3300025922 Bacteria 5150
183 Ga0207681_10000808 3300025923 Bacteria 20616
184 Ga0207681_10135578 3300025923 Bacteria 1826
185 Ga0207650_10003830 3300025925 Bacteria 10286
186 Ga0207659_10002812 3300025926 Bacteria 10376
187 Ga0207659_10010099 3300025926 Bacteria 5917
188 Ga0207659_10017305 3300025926 Bacteria 4708
189 Ga0207706_10011236 3300025933 Bacteria 8165
190 Ga0207706_10020352 3300025933 Bacteria 5964
191 Ga0207706_10172151 3300025933 Bacteria 1902
192 Ga0207709_10035313 3300025935 Bacteria 2954
193 Ga0207670_10001732 3300025936 Bacteria 11390
194 Ga0207670_10086606 3300025936 Unclassified 2205
195 Ga0207669_10004404 3300025937 Bacteria 6195
196 Ga0207669_10054519 3300025937 Bacteria 2415
197 Ga0207691_10007922 3300025940 Bacteria 10227
198 Ga0207711_10200717 3300025941 Bacteria 1820
199 Ga0207689_10022279 3300025942 Bacteria 5327
200 Ga0207689_10025035 3300025942 Bacteria 5003
201 Ga0207661_10093734 3300025944 Bacteria 2507
202 Ga0207679_10010589 3300025945 Bacteria 5941
203 Ga0207651_10054426 3300025960 Bacteria 2742
204 Ga0207651_10138991 3300025960 Unclassified 1873
205 Ga0207651_10144336 3300025960 Bacteria 1843
206 Ga0207712_10026547 3300025961 Bacteria 3860
207 Ga0207668_10327493 3300025972 Bacteria 1273
208 Ga0207677_10021509 3300026023 Bacteria 3943
209 Ga0207703_10044024 3300026035 Bacteria 3585
210 Ga0207708_10005103 3300026075 Bacteria 9688
211 Ga0207708_10017237 3300026075 Bacteria 5436
212 Ga0207641_10104961 3300026088 Bacteria 2495
213 Ga0207648_10000455 3300026089 Bacteria 45441
214 Ga0207648_10023522 3300026089 Bacteria 5517
215 Ga0207676_10025460 3300026095 Bacteria 4390
216 Ga0207674_10065206 3300026116 Unclassified 3672
217 Ga0207674_10220435 3300026116 Bacteria 1845
218 Ga0207675_100004831 3300026118 Bacteria 12978
219 Ga0207675_100036578 3300026118 Bacteria 4579
220 Ga0207675_100064565 3300026118 Bacteria 3422
221 Ga0207675_100304155 3300026118 Unclassified 1554
222 Ga0207683_10014607 3300026121 Bacteria 6687
223 Ga0207428_10000070 3300027907 Bacteria 147650
224 Ga0207428_10000481 3300027907 Bacteria 48194
225 Ga0207428_10245942 3300027907 Bacteria 1335
226 Ga0268265_10001312 3300028380 Bacteria 21329
227 Ga0268265_10045277 3300028380 Bacteria 3282
228 Ga0268264_10006226 3300028381 Bacteria 10069
229 Ga0268264_10024102 3300028381 Bacteria 4967
230 Ga0268264_10100861 3300028381 Unclassified 2508
231 Ga0268264_10194229 3300028381 Bacteria 1852
232 Ga0316576_10010620 3300031727 Bacteria 5995
233 Ga0316576_10057863 3300031727 Bacteria 2834
234 Ga0316576_10282061 3300031727 Unclassified 1244
235 Ga0316578_10033658 3300031728 Bacteria 2938
236 Ga0316577_10000462 3300031733 Bacteria 15960
237 Ga0373961_0004769 3300035241 Bacteria 3262
238 Ga0316574_0058433 3300035398 Unclassified 2416
239 Ga0316574_0176545 3300035398 Bacteria 1375
240 Ga0316584_0080618 3300036712 Unclassified 2438
241 Ga0451577_0079426 3300042876 Bacteria 2925
242 Ga0451577_0202932 3300042876 Bacteria 1790
243 Ga0453683_0166707 3300044673 Bacteria 1395
244 Ga0453684_0364075 3300044712 Unclassified 1627
245 Ga0451576_0009932 3300045051 Bacteria 10983
246 Ga0451576_0025664 3300045051 Bacteria 6348
247 Ga0451576_0083437 3300045051 Bacteria 3324
248 Ga0451576_0084007 3300045051 Bacteria 3312
249 Ga0451576_0214239 3300045051 Bacteria 2011
250 Ga0495603_0058312 3300046455 Bacteria 2283
251 Ga0495629_0006203 3300046459 Bacteria 8872
252 Ga0495584_0020522 3300046491 Bacteria 3355
253 Ga0495594_0003971 3300046499 Bacteria 7607
254 Ga0495594_0026141 3300046499 Unclassified 3139
255 Ga0495663_0024474 3300046525 Bacteria 1755
256 Ga0495621_0002188 3300046539 Bacteria 5205
257 Ga0495621_0013868 3300046539 Bacteria 2541
258 Ga0495621_0024807 3300046539 Bacteria 2007
259 Ga0495656_0033976 3300046615 Bacteria 2085
260 Ga0495659_0008552 3300046664 Bacteria 3259
261 Ga0495659_0036774 3300046664 Bacteria 1731
262 Ga0495588_0002942 3300046674 Bacteria 7359
263 Ga0495669_0049242 3300046684 Bacteria 1886
264 Ga0495670_0060310 3300046691 Bacteria 1906
265 Ga0495636_0008778 3300047318 Bacteria 3985
266 Ga0495672_0030107 3300047320 Bacteria 3410
267 Ga0495677_0044332 3300047445 Bacteria 1631
268 Ga0495685_015242 3300047447 Bacteria 2621
269 Ga0496106_0183446 3300048909 Bacteria 1662
270 Ga0496112_0430371 3300048915 Unclassified 1258
271 Ga0501042_0061454 3300049578 Bacteria 2684
272 Ga0501048_0124492 3300049582 Bacteria 1823
273 Ga0501071_0010570 3300049587 Bacteria 6191
274 Ga0501071_0360747 3300049587 Bacteria 1107
275 Ga0501072_0303023 3300049588 Unclassified 1270
276 Ga0501075_0136496 3300049591 Bacteria 1869
277 Ga0501076_0136915 3300049592 Bacteria 1988
278 Ga0501076_0150254 3300049592 Bacteria 1895
279 Ga0501076_0275212 3300049592 Bacteria 1379
280 Ga0501079_0384542 3300049741 Unclassified 1100
281 Ga0501081_0005957 3300049743 Bacteria 7891
282 nmdc:mga03683_42109_c1 3300050489 Bacteria 1878
283 nmdc:mga00v17_89717_c1 3300050491 Unclassified 1929
284 nmdc:mga0k408_1955_c1 3300050493 Bacteria 11042
285 nmdc:mga06z11_1116_c1 3300050494 Bacteria 9769
286 nmdc:mga07m45_65729_c1 3300050496 Bacteria 2059
287 nmdc:mga05p37_153976_c1 3300050507 Unclassified 2810
288 nmdc:mga05p37_188775_c1 3300050507 Bacteria 2504
289 nmdc:mga05p37_189923_c1 3300050507 Unclassified 2495
290 nmdc:mga05p37_209591_c1 3300050507 Bacteria 2356
291 nmdc:mga05p37_25291_c1 3300050507 Bacteria 5454
292 nmdc:mga05p37_26985_c1 3300050507 Bacteria 6988
293 nmdc:mga05p37_35180_c1 3300050507 Bacteria 4795
294 nmdc:mga05p37_400513_c1 3300050507 Bacteria 1603
295 nmdc:mga05p37_9445_c1 3300050507 Bacteria 11548
296 nmdc:mga09592_140807_c1 3300050508 Bacteria 2079
297 nmdc:mga09592_204966_c1 3300050508 Unclassified 1708
298 nmdc:mga09592_235332_c1 3300050508 Bacteria 1587
299 nmdc:mga09592_27779_c1 3300050508 Bacteria 4696
300 nmdc:mga09592_421_c1 3300050508 Bacteria 31137
301 nmdc:mga09592_75964_c1 3300050508 Bacteria 2857
302 nmdc:mga0qj67_124759_c1 3300050509 Bacteria 2083
303 nmdc:mga0qj67_917_c1 3300050509 Bacteria 20299
304 nmdc:mga06r32_1144_c1 3300050510 Bacteria 23831
305 nmdc:mga08y16_1097_c1 3300050511 Bacteria 26674
306 nmdc:mga08y16_217531_c1 3300050511 Unclassified 1978
307 nmdc:mga08y16_24345_c2 3300050511 Bacteria 3160
308 nmdc:mga08y16_44003_c2 3300050511 Bacteria 3063
309 nmdc:mga08y16_4788_c1 3300050511 Bacteria 14118
310 nmdc:mga0n895_109319_c1 3300050512 Bacteria 2780
311 nmdc:mga0n895_109965_c1 3300050512 Unclassified 2771
312 nmdc:mga0n895_117427_c1 3300050512 Unclassified 2680
313 nmdc:mga0n895_178482_c1 3300050512 Bacteria 2155
314 nmdc:mga0n895_25543_c1 3300050512 Bacteria 5582
315 nmdc:mga0n895_31089_c1 3300050512 Bacteria 5109
316 nmdc:mga0n895_338569_c1 3300050512 Unclassified 1524
317 nmdc:mga0rr50_17884_c1 3300050513 Bacteria 4747
318 nmdc:mga0rr50_204068_c1 3300050513 Bacteria 1626
319 nmdc:mga0rr50_272935_c1 3300050513 Bacteria 1410
320 nmdc:mga0rr50_6360_c1 3300050513 Bacteria 7180
321 nmdc:mga0rr50_97682_c1 3300050513 Bacteria 2300
322 nmdc:mga0a205_141370_c1 3300050515 Bacteria 2307
323 nmdc:mga0a205_143949_c1 3300050515 Bacteria 2284
324 nmdc:mga0a205_17108_c1 3300050515 Bacteria 6789
325 nmdc:mga0a205_17674_c1 3300050515 Bacteria 6693
326 nmdc:mga0a205_35244_c1 3300050515 Bacteria 4805
327 nmdc:mga0a205_364745_c1 3300050515 Bacteria 1311
328 nmdc:mga0a205_38690_c1 3300050515 Bacteria 4589
329 Ga0500645_002766 3300053730 Bacteria 7591
330 Ga0501082_0142289 3300060353 Bacteria 2082
331 Ga0070701_10004072
332 Ga0065704_10071765
333 Ga0065715_10096663
334 Ga0065715_10137995
335 Ga0065707_10001235
336 Ga0070690_100041842
337 Ga0070690_100051405
338 Ga0070670_100172954
339 Ga0068869_100030881
340 Ga0068869_100087296
341 Ga0070680_100358890
342 Ga0068868_100018194
343 Ga0068868_100298339
344 Ga0070689_100013091
345 Ga0070689_100128611
346 Ga0070689_100167545
347 Ga0070692_10065261
348 Ga0070668_100016115
349 Ga0070669_100001131
350 Ga0070669_100031468
351 Ga0070675_100004474
352 Ga0070675_100028566
353 Ga0070675_100108040
354 Ga0070675_100153733
355 Ga0070671_100002291
356 Ga0070674_100131634
357 Ga0070673_100013454
358 Ga0070673_100202288
359 Ga0070673_100416734
360 Ga0070688_100089052
361 Ga0070688_100178281
362 Ga0070703_10002479
363 Ga0070701_10011973
364 Ga0070701_10033451
365 Ga0070705_100000578
366 Ga0070705_100018952
367 Ga0070705_100106749
368 Ga0070694_100000424
369 Ga0070694_100018559
370 Ga0070694_100055701
371 Ga0070694_100085713
372 Ga0070694_100213464
373 Ga0070708_100009000
374 Ga0070708_100105716
375 Ga0070708_100112197
376 Ga0070708_100313473
377 Ga0070678_100083678
378 Ga0070662_100018620
379 Ga0070662_100054174
380 Ga0068867_100011968
381 Ga0068867_100023086
382 Ga0070685_10029661
383 Ga0070706_100010063
384 Ga0070706_100017778
385 Ga0070706_100091290
386 Ga0070706_100411238
387 Ga0070707_100009245
388 Ga0070707_100085844
389 Ga0070698_100000681
390 Ga0070698_100002994
391 Ga0070698_100013608
392 Ga0070699_100000346
393 Ga0070699_100000833
394 Ga0070699_100001918
395 Ga0070699_100004733
396 Ga0070699_100043664
397 Ga0070699_100104115
398 Ga0070699_100180143
399 Ga0070684_100086807
400 Ga0070697_100031078
401 Ga0070697_100068753
402 Ga0070697_100139338
403 Ga0070672_100037964
404 Ga0070672_100041502
405 Ga0070686_100086202
406 Ga0070695_100000155
407 Ga0070696_100000499
408 Ga0070696_100064720
409 Ga0070696_100082527
410 Ga0070696_100146131
411 Ga0070704_100004806
412 Ga0070704_100005803
413 Ga0070704_100047929
414 Ga0070664_100018344
415 Ga0070664_100141049
416 Ga0070702_100020154
417 Ga0068859_100013062
418 Ga0068859_100014194
419 Ga0068859_100021478
420 Ga0068864_100028492
421 Ga0068864_100043301
422 Ga0068866_10013089
423 Ga0068861_100002974
424 Ga0068861_100022779
425 Ga0068861_100148240
426 Ga0068870_10004036
427 Ga0068870_10057055
428 Ga0068863_100009139
429 Ga0068858_100042400
430 Ga0068860_100037937
431 Ga0068860_100069217
432 Ga0068860_100459847
433 Ga0068862_100006870
434 Ga0075365_10011999
435 Ga0075363_100042244
436 Ga0075364_10105472
437 Ga0075367_10003272
438 Ga0075367_10099004
439 Ga0075366_10002766
440 Ga0097621_100157248
441 Ga0068871_100024480
442 Ga0075428_100032926
443 Ga0075428_100055976
444 Ga0075428_100067967
445 Ga0075428_100112451
446 Ga0075428_100243635
447 Ga0075431_100004477
448 Ga0075431_100154573
449 Ga0075431_100159985
450 Ga0075433_10002985
451 Ga0075433_10023626
452 Ga0075433_10045898
453 Ga0075433_10096644
454 Ga0075433_10123802
455 Ga0075433_10348017
456 Ga0075434_100002621
457 Ga0075434_100015195
458 Ga0075434_100018881
459 Ga0075434_100030277
460 Ga0075434_100030925
461 Ga0075434_100054690
462 Ga0075434_100058655
463 Ga0075434_100197397
464 Ga0075429_100006199
465 Ga0075429_100007976
466 Ga0075429_100076832
467 Ga0068865_100004538
468 Ga0097620_100013062
469 Ga0097620_100014195
470 Ga0097620_100021477
471 Ga0075435_100007636
472 Ga0075435_100027757
473 Ga0075435_100181273
474 Ga0111539_10000156
475 Ga0111539_10001815
476 Ga0111539_10037461
477 Ga0111539_10069760
478 Ga0111539_10117837
479 Ga0105245_10017335
480 Ga0114129_10000307
481 Ga0114129_10002178
482 Ga0114129_10002512
483 Ga0114129_10005105
484 Ga0114129_10022596
485 Ga0114129_10029022
486 Ga0114129_10032252
487 Ga0114129_10073581
488 Ga0114129_10079431
489 Ga0114129_10696710
490 Ga0105243_10001209
491 Ga0105243_10095004
492 Ga0105242_10009260
493 Ga0105249_10061560
494 Ga0157375_10016504
495 Ga0157375_10207067
496 Ga0157375_10290080
497 Ga0163163_10004494
498 Ga0163163_10405060
499 Ga0157380_10001241
500 Ga0157380_10024731
501 Ga0157380_10030826
502 Ga0157377_10226791
503 Ga0157379_10045289
504 Ga0163161_10118447
505 Ga0207645_10045955
506 Ga0207643_10006771
507 Ga0207643_10013212
508 Ga0207643_10205892
509 Ga0207684_10002830
510 Ga0207662_10001095
511 Ga0207646_10006694
512 Ga0207646_10027857
513 Ga0207681_10000808
514 Ga0207681_10135578
515 Ga0207650_10003830
516 Ga0207659_10002812
517 Ga0207659_10010099
518 Ga0207659_10017305
519 Ga0207706_10011236
520 Ga0207706_10020352
521 Ga0207706_10172151
522 Ga0207709_10035313
523 Ga0207670_10001732
524 Ga0207670_10086606
525 Ga0207669_10004404
526 Ga0207669_10054519
527 Ga0207691_10007922
528 Ga0207711_10200717
529 Ga0207689_10022279
530 Ga0207689_10025035
531 Ga0207661_10093734
532 Ga0207679_10010589
533 Ga0207651_10054426
534 Ga0207651_10138991
535 Ga0207651_10144336
536 Ga0207712_10026547
537 Ga0207668_10327493
538 Ga0207677_10021509
539 Ga0207703_10044024
540 Ga0207708_10005103
541 Ga0207708_10017237
542 Ga0207641_10104961
543 Ga0207648_10000455
544 Ga0207648_10023522
545 Ga0207676_10025460
546 Ga0207674_10065206
547 Ga0207674_10220435
548 Ga0207675_100004831
549 Ga0207675_100036578
550 Ga0207675_100064565
551 Ga0207675_100304155
552 Ga0207683_10014607
553 Ga0207428_10000070
554 Ga0207428_10000481
555 Ga0207428_10245942
556 Ga0268265_10001312
557 Ga0268265_10045277
558 Ga0268264_10006226
559 Ga0268264_10024102
560 Ga0268264_10100861
561 Ga0268264_10194229
562 Ga0316576_10010620
563 Ga0316576_10057863
564 Ga0316576_10282061
565 Ga0316578_10033658
566 Ga0316577_10000462
567 Ga0373961_0004769
568 Ga0316574_0058433
569 Ga0316574_0176545
570 Ga0316584_0080618
571 Ga0451577_0079426
572 Ga0451577_0202932
573 Ga0453683_0166707
574 Ga0453684_0364075
575 Ga0451576_0009932
576 Ga0451576_0025664
577 Ga0451576_0083437
578 Ga0451576_0084007
579 Ga0451576_0214239
580 Ga0495603_0058312
581 Ga0495629_0006203
582 Ga0495584_0020522
583 Ga0495594_0003971
584 Ga0495594_0026141
585 Ga0495663_0024474
586 Ga0495621_0002188
587 Ga0495621_0013868
588 Ga0495621_0024807
589 Ga0495656_0033976
590 Ga0495659_0008552
591 Ga0495659_0036774
592 Ga0495588_0002942
593 Ga0495669_0049242
594 Ga0495670_0060310
595 Ga0495636_0008778
596 Ga0495672_0030107
597 Ga0495677_0044332
598 Ga0495685_015242
599 Ga0496106_0183446
600 Ga0496112_0430371
601 Ga0501042_0061454
602 Ga0501048_0124492
603 Ga0501071_0010570
604 Ga0501071_0360747
605 Ga0501072_0303023
606 Ga0501075_0136496
607 Ga0501076_0136915
608 Ga0501076_0150254
609 Ga0501076_0275212
610 Ga0501079_0384542
611 Ga0501081_0005957
612 nmdc:mga03683_42109_c1
613 nmdc:mga00v17_89717_c1
614 nmdc:mga0k408_1955_c1
615 nmdc:mga06z11_1116_c1
616 nmdc:mga07m45_65729_c1
617 nmdc:mga05p37_153976_c1
618 nmdc:mga05p37_188775_c1
619 nmdc:mga05p37_189923_c1
620 nmdc:mga05p37_209591_c1
621 nmdc:mga05p37_25291_c1
622 nmdc:mga05p37_26985_c1
623 nmdc:mga05p37_35180_c1
624 nmdc:mga05p37_400513_c1
625 nmdc:mga05p37_9445_c1
626 nmdc:mga09592_140807_c1
627 nmdc:mga09592_204966_c1
628 nmdc:mga09592_235332_c1
629 nmdc:mga09592_27779_c1
630 nmdc:mga09592_421_c1
631 nmdc:mga09592_75964_c1
632 nmdc:mga0qj67_124759_c1
633 nmdc:mga0qj67_917_c1
634 nmdc:mga06r32_1144_c1
635 nmdc:mga08y16_1097_c1
636 nmdc:mga08y16_217531_c1
637 nmdc:mga08y16_24345_c2
638 nmdc:mga08y16_44003_c2
639 nmdc:mga08y16_4788_c1
640 nmdc:mga0n895_109319_c1
641 nmdc:mga0n895_109965_c1
642 nmdc:mga0n895_117427_c1
643 nmdc:mga0n895_178482_c1
644 nmdc:mga0n895_25543_c1
645 nmdc:mga0n895_31089_c1
646 nmdc:mga0n895_338569_c1
647 nmdc:mga0rr50_17884_c1
648 nmdc:mga0rr50_204068_c1
649 nmdc:mga0rr50_272935_c1
650 nmdc:mga0rr50_6360_c1
651 nmdc:mga0rr50_97682_c1
652 nmdc:mga0a205_141370_c1
653 nmdc:mga0a205_143949_c1
654 nmdc:mga0a205_17108_c1
655 nmdc:mga0a205_17674_c1
656 nmdc:mga0a205_35244_c1
657 nmdc:mga0a205_364745_c1
658 nmdc:mga0a205_38690_c1
659 Ga0500645_002766
660 Ga0501082_0142289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

174

331

0.97

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

178

317

0.92

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

192

346

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8652 176 333
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8575 169 328
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.856 176 336
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8464 176 334
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8461 176 336
ID Description Score Start End Superfamily
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9451 179 333 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9333 178 334 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.927 183 332 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9228 178 333 3.40.50.2000
af_F4IBV4_205_380_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.922 176 333 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9729 121 345 GO:0016758
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9711 170 323 GO:0016757
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9603 121 345 GO:0016758
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9528 170 323 GO:0016757
AF-A0A538LKC2-F1-model_v4 Glycosyltransferase 0.9363 190 347 GO:0016757

Map