F409825

General Info

Members Datasets Scaffolds Average Seq Length
329 211 329 196

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0006677|Ga0495599_0006677_1104_1817
Length 227
Sequence MFSGIIAAVGRISLIERDRNGLRLAIDAGKLGLRDVSVGDSITVNGACLTVVKRGKKRFSVDVSRETLRVTAGLDREGEVNLEKALRLSDKLDGHLVLGHVDGVGEVTKVERRGANRLLRVRAPASLSRYIARKGSIAVDGVSLTVNAVRGAEFEVNLIPHTLAVTTLRDRRAGDRVNLEVDPLARYAERLLRRCWGFRPKRPSAAARSRRARSFPKSCGRSRRTRW

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10115630 3300003323 Bacteria 2202
2 JGI25407J50210_10002058 3300003373 Bacteria 4691
3 Ga0070658_10980293 3300005327 Bacteria 735
4 Ga0070690_100003498 3300005330 Bacteria 8594
5 Ga0068869_100000176 3300005334 Bacteria 32501
6 Ga0070680_100055441 3300005336 Bacteria 3239
7 Ga0070682_100041542 3300005337 Bacteria 2835
8 Ga0068868_100158199 3300005338 Bacteria 1870
9 Ga0070689_100005065 3300005340 Bacteria 8962
10 Ga0070691_10022057 3300005341 Bacteria 2952
11 Ga0070692_10016455 3300005345 Bacteria 3517
12 Ga0070714_100011388 3300005435 Bacteria 7056
13 Ga0070714_100121098 3300005435 Bacteria 2328
14 Ga0070701_10009047 3300005438 Bacteria 4346
15 Ga0070701_10453930 3300005438 Bacteria 823
16 Ga0070705_100231906 3300005440 Bacteria 1285
17 Ga0070700_100002000 3300005441 Bacteria 10349
18 Ga0070678_100007261 3300005456 Bacteria 6559
19 Ga0068867_100017282 3300005459 Bacteria 5123
20 Ga0070685_10023640 3300005466 Bacteria 3367
21 Ga0070685_10182500 3300005466 Bacteria 1352
22 Ga0070706_100047713 3300005467 Bacteria 3953
23 Ga0070707_100134600 3300005468 Bacteria 2404
24 Ga0070699_100054688 3300005518 Bacteria 3455
25 Ga0070699_100066480 3300005518 Bacteria 3129
26 Ga0070699_100235503 3300005518 Bacteria 1633
27 Ga0070699_100756116 3300005518 Bacteria 889
28 Ga0070697_100005115 3300005536 Bacteria 10071
29 Ga0070697_100407150 3300005536 Bacteria 1181
30 Ga0070686_100003775 3300005544 Bacteria 8331
31 Ga0070695_100088031 3300005545 Bacteria 2067
32 Ga0070696_100021635 3300005546 Bacteria 4362
33 Ga0070696_100027417 3300005546 Bacteria 3881
34 Ga0070696_100636705 3300005546 Bacteria 863
35 Ga0070693_100004955 3300005547 Bacteria 6357
36 Ga0070665_100138671 3300005548 Bacteria 2435
37 Ga0070704_100023967 3300005549 Bacteria 3997
38 Ga0070704_100339427 3300005549 Unclassified 1265
39 Ga0068855_101145104 3300005563 Bacteria 811
40 Ga0068856_100609412 3300005614 Bacteria 1113
41 Ga0070702_100029902 3300005615 Unclassified 2966
42 Ga0068859_100009073 3300005617 Bacteria 10044
43 Ga0068866_10006970 3300005718 Bacteria 4723
44 Ga0068861_100000213 3300005719 Bacteria 31324
45 Ga0068858_100000722 3300005842 Bacteria 34440
46 Ga0068858_100009972 3300005842 Bacteria 9021
47 Ga0068860_100024448 3300005843 Bacteria 5836
48 Ga0068862_100011631 3300005844 Bacteria 7262
49 Ga0081455_10021125 3300005937 Bacteria 6113
50 Ga0081538_10000085 3300005981 Bacteria 89830
51 Ga0070716_100029124 3300006173 Bacteria 2982
52 Ga0097621_100000825 3300006237 Bacteria 21908
53 Ga0068871_100005358 3300006358 Bacteria 8988
54 Ga0075428_100397633 3300006844 Bacteria 1477
55 Ga0075431_100077982 3300006847 Bacteria 3420
56 Ga0075433_10013732 3300006852 Bacteria 6597
57 Ga0075433_10344461 3300006852 Bacteria 1317
58 Ga0075433_10897153 3300006852 Bacteria 773
59 Ga0075434_100285485 3300006871 Bacteria 1670
60 Ga0068865_100003004 3300006881 Bacteria 10074
61 Ga0075436_100036598 3300006914 Bacteria 3388
62 Ga0075436_100109777 3300006914 Bacteria 1925
63 Ga0075436_100159780 3300006914 Bacteria 1588
64 Ga0075436_100170724 3300006914 Bacteria 1536
65 Ga0097620_100009073 3300006931 Bacteria 10044
66 Ga0099794_10016351 3300007265 Bacteria 3287
67 Ga0099794_10089020 3300007265 Bacteria 1530
68 Ga0099794_10135179 3300007265 Bacteria 1247
69 Ga0099795_10120161 3300007788 Bacteria 1050
70 Ga0111539_10665191 3300009094 Bacteria 1213
71 Ga0105245_10006905 3300009098 Bacteria 9954
72 Ga0105243_10036059 3300009148 Unclassified 3836
73 Ga0105242_10006126 3300009176 Bacteria 9268
74 Ga0105248_10319861 3300009177 Unclassified 1748
75 Ga0105249_10020021 3300009553 Bacteria 5975
76 Ga0099796_10015888 3300010159 Bacteria 2211
77 Ga0105246_10338700 3300011119 Bacteria 1228
78 Ga0157378_10013293 3300013297 Bacteria 7198
79 Ga0157378_10035309 3300013297 Bacteria 4421
80 Ga0157372_10794428 3300013307 Bacteria 1100
81 Ga0157375_10026459 3300013308 Bacteria 5407
82 Ga0163163_10046275 3300014325 Bacteria 4274
83 Ga0157380_10006095 3300014326 Bacteria 8450
84 Ga0157379_10032623 3300014968 Bacteria 4643
85 Ga0157379_10136718 3300014968 Bacteria 2208
86 Ga0157379_10503082 3300014968 Bacteria 1123
87 Ga0157376_10053757 3300014969 Bacteria 3355
88 Ga0163161_10633747 3300017792 Bacteria 884
89 Ga0213873_10069696 3300021358 Unclassified 967
90 Ga0207642_10001477 3300025899 Bacteria 7272
91 Ga0207645_10192106 3300025907 Unclassified 1342
92 Ga0207684_10261359 3300025910 Bacteria 1494
93 Ga0207695_10587353 3300025913 Bacteria 995
94 Ga0207660_10137276 3300025917 Bacteria 1867
95 Ga0207662_10007996 3300025918 Bacteria 5767
96 Ga0207646_10110852 3300025922 Bacteria 2462
97 Ga0207687_10004609 3300025927 Bacteria 9174
98 Ga0207664_10002436 3300025929 Bacteria 12309
99 Ga0207686_10016538 3300025934 Bacteria 4140
100 Ga0207709_10039950 3300025935 Unclassified 2806
101 Ga0207670_10017594 3300025936 Bacteria 4323
102 Ga0207704_10011061 3300025938 Bacteria 4428
103 Ga0207665_10030496 3300025939 Bacteria 3564
104 Ga0207689_10000088 3300025942 Bacteria 74315
105 Ga0207667_10189470 3300025949 Bacteria 2111
106 Ga0207712_10070951 3300025961 Bacteria 2504
107 Ga0207677_10054198 3300026023 Bacteria 2735
108 Ga0207703_10025872 3300026035 Bacteria 4618
109 Ga0207703_10030819 3300026035 Bacteria 4239
110 Ga0207708_10002477 3300026075 Bacteria 13579
111 Ga0207648_10000202 3300026089 Bacteria 63315
112 Ga0207675_100000417 3300026118 Bacteria 41022
113 Ga0207675_100263021 3300026118 Bacteria 1672
114 Ga0207683_10011479 3300026121 Bacteria 7561
115 Ga0209588_1001248 3300027671 Bacteria 6583
116 Ga0209588_1006905 3300027671 Bacteria 3322
117 Ga0268265_10018459 3300028380 Bacteria 4834
118 Ga0268264_10021435 3300028381 Bacteria 5276
119 Ga0307509_10000032 3300031507 Bacteria 202919
120 Ga0307408_100649350 3300031548 Unclassified 943
121 Ga0307405_10062015 3300031731 Bacteria 2366
122 Ga0307406_10713522 3300031901 Unclassified 838
123 Ga0307412_10105573 3300031911 Unclassified 2001
124 Ga0373958_0103728 3300034819 Bacteria 670
125 Ga0373926_0024370 3300035083 Bacteria 2107
126 Ga0373934_0001988 3300035086 Bacteria 7504
127 Ga0373934_0078512 3300035086 Bacteria 1324
128 Ga0373944_0133861 3300035089 Archaea 863
129 Ga0373923_0014173 3300035111 Bacteria 2989
130 Ga0373923_0121525 3300035111 Bacteria 1167
131 Ga0373936_0022911 3300035113 Bacteria 2431
132 Ga0373945_0019691 3300035116 Bacteria 2305
133 Ga0373953_0010102 3300035117 Bacteria 3273
134 Ga0373954_0000036 3300035118 Bacteria 50537
135 Ga0373954_0000501 3300035118 Bacteria 14681
136 Ga0373954_0118795 3300035118 Bacteria 1282
137 Ga0373956_0008514 3300035119 Bacteria 4151
138 Ga0373956_0020251 3300035119 Bacteria 2828
139 Ga0373956_0110076 3300035119 Bacteria 1282
140 Ga0373957_0000539 3300035120 Bacteria 9569
141 Ga0373957_0029744 3300035120 Bacteria 1997
142 Ga0373946_0026544 3300035171 Bacteria 2286
143 Ga0373955_0004210 3300035172 Bacteria 6347
144 Ga0373955_0014232 3300035172 Bacteria 3864
145 Ga0373955_0077022 3300035172 Bacteria 1877
146 Ga0373942_0088923 3300035207 Bacteria 928
147 Ga0316574_0111343 3300035398 Bacteria 1755
148 Ga0373924_0018300 3300035410 Bacteria 2697
149 Ga0373924_0034510 3300035410 Bacteria 2047
150 Ga0373931_0039692 3300035691 Bacteria 2467
151 Ga0373935_0042119 3300035692 Bacteria 2870
152 Ga0373933_0018445 3300035724 Bacteria 3924
153 Ga0373933_0030245 3300035724 Bacteria 3135
154 Ga0373933_0031354 3300035724 Bacteria 3083
155 Ga0373933_0151065 3300035724 Bacteria 1471
156 Ga0373947_0193828 3300035725 Bacteria 1327
157 Ga0373937_0002406 3300036401 Bacteria 15565
158 Ga0373937_0003924 3300036401 Bacteria 12582
159 Ga0373937_0028558 3300036401 Bacteria 5048
160 Ga0373937_0142531 3300036401 Bacteria 2242
161 Ga0373937_0152533 3300036401 Bacteria 2164
162 Ga0373937_0314485 3300036401 Bacteria 1481
163 Ga0373925_0036807 3300037068 Bacteria 3611
164 Ga0395899_0003084 3300037312 Bacteria 13276
165 Ga0395898_0092772 3300037466 Bacteria 2903
166 Ga0395905_0038936 3300037471 Bacteria 4460
167 Ga0395901_0273505 3300038443 Bacteria 1756
168 Ga0436365_1644860 3300039437 Unclassified 705
169 Ga0436363_0168471 3300039450 Bacteria 618
170 Ga0436363_0834181 3300039450 Unclassified 1816
171 Ga0436362_0388224 3300039453 Unclassified 970
172 Ga0439456_048101 3300042013 Bacteria 931
173 Ga0451577_0044190 3300042876 Bacteria 3989
174 Ga0466966_0216642 3300044684 Unclassified 1156
175 Ga0453684_0016855 3300044712 Bacteria 11373
176 Ga0453684_0045206 3300044712 Bacteria 5878
177 Ga0466957_0025245 3300044842 Bacteria 3521
178 Ga0451576_0598822 3300045051 Bacteria 1158
179 Ga0451576_0691069 3300045051 Bacteria 1072
180 Ga0451576_0924113 3300045051 Bacteria 915
181 Ga0466958_0009610 3300045836 Bacteria 5393
182 Ga0466958_0037287 3300045836 Bacteria 2913
183 Ga0466967_0002146 3300045976 Bacteria 12102
184 Ga0466967_0554730 3300045976 Bacteria 1131
185 Ga0495592_0026446 3300046454 Bacteria 4400
186 Ga0495592_0050455 3300046454 Bacteria 3091
187 Ga0495603_0371120 3300046455 Bacteria 821
188 Ga0495629_0042818 3300046459 Bacteria 3181
189 Ga0495651_0007117 3300046462 Bacteria 8556
190 Ga0495653_0075569 3300046463 Bacteria 2506
191 Ga0495580_0081419 3300046472 Bacteria 2256
192 Ga0495582_0018039 3300046473 Bacteria 3859
193 Ga0495662_0085543 3300046476 Bacteria 1535
194 Ga0495664_0049773 3300046477 Bacteria 2487
195 Ga0495594_0035257 3300046499 Bacteria 2725
196 Ga0495608_0088893 3300046511 Bacteria 1999
197 Ga0495618_0221125 3300046514 Bacteria 1194
198 Ga0495628_0002373 3300046516 Bacteria 16994
199 Ga0495628_0013205 3300046516 Bacteria 6945
200 Ga0495628_0017850 3300046516 Bacteria 5889
201 Ga0495630_0001060 3300046517 Bacteria 18968
202 Ga0495630_0125231 3300046517 Bacteria 1950
203 Ga0495630_0154705 3300046517 Bacteria 1745
204 Ga0495666_0005368 3300046526 Bacteria 6455
205 Ga0495652_0009241 3300046529 Bacteria 8961
206 Ga0495652_0038556 3300046529 Bacteria 4139
207 Ga0495665_0037271 3300046531 Bacteria 2595
208 Ga0495640_0053128 3300046533 Bacteria 2778
209 Ga0495586_0002409 3300046535 Bacteria 10150
210 Ga0495645_0000439 3300046543 Bacteria 28650
211 Ga0495667_0061618 3300046559 Bacteria 2459
212 Ga0495667_0065810 3300046559 Bacteria 2370
213 Ga0495667_0478960 3300046559 Bacteria 780
214 Ga0495634_0004301 3300046642 Bacteria 11224
215 Ga0495657_0060603 3300046675 Bacteria 2506
216 Ga0495599_0000258 3300046678 Bacteria 33541
217 Ga0495599_0006677 3300046678 Bacteria 6967
218 Ga0495599_0008950 3300046678 Bacteria 6097
219 Ga0495646_0157791 3300046680 Bacteria 1258
220 Ga0495647_0001887 3300046681 Bacteria 6521
221 Ga0495613_0006634 3300046689 Bacteria 8645
222 Ga0495624_0016513 3300046690 Bacteria 4969
223 Ga0495600_0000915 3300046809 Bacteria 15809
224 Ga0495581_0185962 3300047315 Bacteria 1215
225 Ga0495604_0027415 3300047317 Bacteria 4531
226 Ga0495604_0483549 3300047317 Bacteria 805
227 Ga0495636_0010177 3300047318 Bacteria 3710
228 Ga0495674_0017351 3300047319 Bacteria 6698
229 Ga0495680_0032180 3300047322 Bacteria 4261
230 Ga0495675_0209998 3300047444 Bacteria 1182
231 Ga0495675_0216855 3300047444 Bacteria 1159
232 Ga0495675_0320885 3300047444 Bacteria 916
233 Ga0495684_0038537 3300047471 Bacteria 3664
234 Ga0501033_0005095 3300049570 Bacteria 10454
235 Ga0501033_0073948 3300049570 Bacteria 2502
236 Ga0501034_0062143 3300049571 Bacteria 3750
237 Ga0501034_1001858 3300049571 Bacteria 719
238 Ga0501036_0003156 3300049572 Bacteria 13146
239 Ga0501036_0022675 3300049572 Bacteria 5284
240 Ga0501036_0102016 3300049572 Bacteria 2427
241 Ga0501037_0058738 3300049573 Bacteria 2806
242 Ga0501038_0003952 3300049574 Bacteria 13778
243 Ga0501039_0000686 3300049575 Bacteria 24376
244 Ga0501039_0020487 3300049575 Bacteria 5068
245 Ga0501039_0027369 3300049575 Bacteria 4384
246 Ga0501039_0258587 3300049575 Bacteria 1369
247 Ga0501040_0004484 3300049576 Bacteria 9067
248 Ga0501040_0006828 3300049576 Bacteria 7400
249 Ga0501041_0000061 3300049577 Bacteria 40487
250 Ga0501041_0012135 3300049577 Bacteria 5102
251 Ga0501041_0020954 3300049577 Bacteria 3914
252 Ga0501041_0406920 3300049577 Bacteria 862
253 Ga0501042_0000680 3300049578 Bacteria 18368
254 Ga0501042_0029061 3300049578 Bacteria 3899
255 Ga0501043_0577307 3300049579 Unclassified 833
256 Ga0501046_0005797 3300049580 Bacteria 11022
257 Ga0501046_0049113 3300049580 Bacteria 3339
258 Ga0501046_0338146 3300049580 Bacteria 1094
259 Ga0501047_0064810 3300049581 Bacteria 3524
260 Ga0501048_0000204 3300049582 Bacteria 38757
261 Ga0501048_0039961 3300049582 Bacteria 3363
262 Ga0501048_0095514 3300049582 Bacteria 2096
263 Ga0501067_0267172 3300049583 Bacteria 952
264 Ga0501068_0002146 3300049584 Bacteria 10497
265 Ga0501068_0034614 3300049584 Bacteria 3012
266 Ga0501070_0015151 3300049586 Bacteria 6489
267 Ga0501070_0028882 3300049586 Bacteria 4650
268 Ga0501071_0000332 3300049587 Bacteria 22804
269 Ga0501071_0049632 3300049587 Bacteria 3021
270 Ga0501071_0279624 3300049587 Bacteria 1263
271 Ga0501071_0373952 3300049587 Bacteria 1086
272 Ga0501072_0002645 3300049588 Bacteria 13427
273 Ga0501072_0002784 3300049588 Bacteria 13146
274 Ga0501072_0008326 3300049588 Bacteria 7878
275 Ga0501072_0104351 3300049588 Bacteria 2254
276 Ga0501073_0001679 3300049589 Bacteria 16410
277 Ga0501074_0037763 3300049590 Bacteria 3500
278 Ga0501074_0050280 3300049590 Bacteria 3009
279 Ga0501074_0444607 3300049590 Bacteria 919
280 Ga0501075_0000017 3300049591 Bacteria 68452
281 Ga0501075_0000818 3300049591 Bacteria 19511
282 Ga0501075_0047052 3300049591 Bacteria 3241
283 Ga0501075_0440184 3300049591 Bacteria 994
284 Ga0501076_0000219 3300049592 Bacteria 34516
285 Ga0501076_0000301 3300049592 Bacteria 30794
286 Ga0501076_0204610 3300049592 Bacteria 1612
287 Ga0501077_0000664 3300049593 Bacteria 20826
288 Ga0501077_0031487 3300049593 Bacteria 3375
289 Ga0501077_0326739 3300049593 Bacteria 978
290 Ga0501079_0006038 3300049741 Bacteria 9075
291 Ga0501079_0033755 3300049741 Bacteria 3937
292 Ga0501079_0330141 3300049741 Unclassified 1194
293 Ga0501079_0417992 3300049741 Bacteria 1052
294 Ga0501080_0003151 3300049742 Bacteria 14526
295 Ga0501080_0006269 3300049742 Bacteria 10674
296 Ga0501080_0138176 3300049742 Bacteria 2254
297 Ga0501080_0228629 3300049742 Bacteria 1701
298 Ga0501080_0589622 3300049742 Bacteria 987
299 Ga0501081_0000061 3300049743 Bacteria 42076
300 Ga0501081_0017407 3300049743 Bacteria 4756
301 Ga0501081_0036890 3300049743 Bacteria 3334
302 Ga0501083_0103156 3300049744 Bacteria 1880
303 Ga0501083_0178242 3300049744 Bacteria 1388
304 Ga0501083_0307290 3300049744 Bacteria 1031
305 Ga0501035_0054075 3300049822 Bacteria 3588
306 Ga0501035_0096352 3300049822 Bacteria 2600
307 Ga0501045_0001049 3300049824 Bacteria 18186
308 Ga0501045_0157902 3300049824 Bacteria 1687
309 Ga0501045_0411302 3300049824 Bacteria 1006
310 nmdc:mga08y16_527497_c1 3300050511 Bacteria 1197
311 nmdc:mga08x19_172467_c1 3300050514 Bacteria 1473
312 nmdc:mga08x19_4398_c1 3300050514 Bacteria 8355
313 nmdc:mga08x19_732628_c1 3300050514 Bacteria 702
314 nmdc:mga0a205_373362_c1 3300050515 Bacteria 1292
315 nmdc:mga0a205_60564_c1 3300050515 Bacteria 3655
316 nmdc:mga0a205_828145_c1 3300050515 Bacteria 773
317 Ga0495601_0023483 3300053077 Bacteria 3789
318 Ga0495601_0127939 3300053077 Bacteria 1653
319 Ga0495595_0212431 3300053084 Bacteria 964
320 Ga0495619_0007646 3300053085 Bacteria 6841
321 Ga0500641_0048953 3300053096 Bacteria 1732
322 Ga0501084_0000706 3300054114 Bacteria 25545
323 Ga0501084_0031887 3300054114 Bacteria 4407
324 Ga0501084_0135495 3300054114 Bacteria 2073
325 Ga0501082_0001451 3300060353 Bacteria 20822
326 Ga0501082_0044671 3300060353 Bacteria 3821
327 Ga0530510_0000006 3300061734 Bacteria 180585
328 Ga0530510_0000887 3300061734 Bacteria 19738
329 Ga0530510_0215794 3300061734 Bacteria 1425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0010102 Ga0373953_0010102_2306_2866 168
2 3300035118 Ga0373954_0000036 Ga0373954_0000036_26050_26610 168
3 3300035172 Ga0373955_0077022 Ga0373955_0077022_568_1128 168
4 3300036401 Ga0373937_0003924 Ga0373937_0003924_8401_8961 168
5 3300039450 Ga0436363_0168471 Ga0436363_0168471_46_558 170
6 3300049590 Ga0501074_0444607 Ga0501074_0444607_12_581 174
7 3300003373 JGI25407J50210_10002058 JGI25407J50210_100020587 183
8 3300005937 Ga0081455_10021125 Ga0081455_100211259 183
9 3300005981 Ga0081538_10000085 Ga0081538_1000008561 183
10 3300035410 Ga0373924_0034510 Ga0373924_0034510_268_828 183
11 3300035724 Ga0373933_0018445 Ga0373933_0018445_2664_3224 183
12 3300006852 Ga0075433_10013732 Ga0075433_100137323 184
13 3300006914 Ga0075436_100109777 Ga0075436_1001097771 184
14 3300006914 Ga0075436_100170724 Ga0075436_1001707242 184
15 3300035207 Ga0373942_0088923 Ga0373942_0088923_212_778 184
16 3300035691 Ga0373931_0039692 Ga0373931_0039692_1389_1943 184
17 3300049570 Ga0501033_0005095 Ga0501033_0005095_555_1115 184
18 3300049571 Ga0501034_1001858 Ga0501034_1001858_66_626 184
19 3300049572 Ga0501036_0003156 Ga0501036_0003156_1312_1872 184
20 3300049573 Ga0501037_0058738 Ga0501037_0058738_1998_2558 184
21 3300049574 Ga0501038_0003952 Ga0501038_0003952_1312_1872 184
22 3300049575 Ga0501039_0000686 Ga0501039_0000686_4723_5283 184
23 3300049576 Ga0501040_0004484 Ga0501040_0004484_7196_7756 184
24 3300049577 Ga0501041_0000061 Ga0501041_0000061_31660_32220 184
25 3300049578 Ga0501042_0000680 Ga0501042_0000680_12018_12578 184
26 3300049580 Ga0501046_0005797 Ga0501046_0005797_10114_10674 184
27 3300049581 Ga0501047_0064810 Ga0501047_0064810_134_694 184
28 3300049582 Ga0501048_0000204 Ga0501048_0000204_13278_13838 184
29 3300049584 Ga0501068_0034614 Ga0501068_0034614_2019_2579 184
30 3300049586 Ga0501070_0028882 Ga0501070_0028882_45_605 184
31 3300049587 Ga0501071_0000332 Ga0501071_0000332_5181_5741 184
32 3300049588 Ga0501072_0002784 Ga0501072_0002784_11275_11835 184
33 3300049590 Ga0501074_0037763 Ga0501074_0037763_1901_2461 184
34 3300049591 Ga0501075_0000818 Ga0501075_0000818_7172_7732 184
35 3300049592 Ga0501076_0000301 Ga0501076_0000301_5231_5791 184
36 3300049593 Ga0501077_0000664 Ga0501077_0000664_1999_2559 184
37 3300049741 Ga0501079_0006038 Ga0501079_0006038_4111_4671 184
38 3300049742 Ga0501080_0006269 Ga0501080_0006269_9481_10041 184
39 3300049743 Ga0501081_0000061 Ga0501081_0000061_5769_6329 184
40 3300049744 Ga0501083_0307290 Ga0501083_0307290_349_909 184
41 3300049822 Ga0501035_0054075 Ga0501035_0054075_2793_3353 184
42 3300049824 Ga0501045_0001049 Ga0501045_0001049_9653_10213 184
43 3300050514 nmdc:mga08x19_172467_c1 nmdc:mga08x19_172467_c1_286_867 184
44 3300054114 Ga0501084_0000706 Ga0501084_0000706_8100_8660 184
45 3300060353 Ga0501082_0001451 Ga0501082_0001451_19_579 184
46 3300061734 Ga0530510_0000887 Ga0530510_0000887_13159_13719 184
47 3300037471 Ga0395905_0038936 Ga0395905_0038936_3490_4077 189
48 3300049591 Ga0501075_0440184 Ga0501075_0440184_204_776 189
49 3300005438 Ga0070701_10453930 Ga0070701_104539302 190
50 3300049579 Ga0501043_0577307 Ga0501043_0577307_55_648 191
51 3300005435 Ga0070714_100121098 Ga0070714_1001210982 193
52 3300005468 Ga0070707_100134600 Ga0070707_1001346002 193
53 3300014325 Ga0163163_10046275 Ga0163163_100462754 193
54 3300025922 Ga0207646_10110852 Ga0207646_101108522 193
55 3300005330 Ga0070690_100003498 Ga0070690_1000034985 194
56 3300005334 Ga0068869_100000176 Ga0068869_10000017638 194
57 3300005336 Ga0070680_100055441 Ga0070680_1000554416 194
58 3300005337 Ga0070682_100041542 Ga0070682_1000415424 194
59 3300005338 Ga0068868_100158199 Ga0068868_1001581992 194
60 3300005340 Ga0070689_100005065 Ga0070689_1000050658 194
61 3300005341 Ga0070691_10022057 Ga0070691_100220574 194
62 3300005345 Ga0070692_10016455 Ga0070692_100164554 194
63 3300005438 Ga0070701_10009047 Ga0070701_100090473 194
64 3300005440 Ga0070705_100231906 Ga0070705_1002319062 194
65 3300005441 Ga0070700_100002000 Ga0070700_1000020004 194
66 3300005456 Ga0070678_100007261 Ga0070678_10000726111 194
67 3300005459 Ga0068867_100017282 Ga0068867_10001728211 194
68 3300005466 Ga0070685_10023640 Ga0070685_100236404 194
69 3300005467 Ga0070706_100047713 Ga0070706_1000477135 194
70 3300005518 Ga0070699_100235503 Ga0070699_1002355032 194
71 3300005518 Ga0070699_100756116 Ga0070699_1007561161 194
72 3300005536 Ga0070697_100005115 Ga0070697_10000511511 194
73 3300005536 Ga0070697_100407150 Ga0070697_1004071502 194
74 3300005544 Ga0070686_100003775 Ga0070686_10000377511 194
75 3300005545 Ga0070695_100088031 Ga0070695_1000880312 194
76 3300005546 Ga0070696_100021635 Ga0070696_1000216355 194
77 3300005546 Ga0070696_100636705 Ga0070696_1006367051 194
78 3300005547 Ga0070693_100004955 Ga0070693_1000049555 194
79 3300005549 Ga0070704_100023967 Ga0070704_1000239674 194
80 3300005549 Ga0070704_100339427 Ga0070704_1003394271 194
81 3300005615 Ga0070702_100029902 Ga0070702_1000299022 194
82 3300005617 Ga0068859_100009073 Ga0068859_1000090735 194
83 3300005718 Ga0068866_10006970 Ga0068866_100069705 194
84 3300005719 Ga0068861_100000213 Ga0068861_10000021321 194
85 3300005842 Ga0068858_100000722 Ga0068858_1000007225 194
86 3300005843 Ga0068860_100024448 Ga0068860_1000244484 194
87 3300005844 Ga0068862_100011631 Ga0068862_1000116314 194
88 3300006173 Ga0070716_100029124 Ga0070716_1000291243 194
89 3300006237 Ga0097621_100000825 Ga0097621_10000082511 194
90 3300006358 Ga0068871_100005358 Ga0068871_1000053589 194
91 3300006844 Ga0075428_100397633 Ga0075428_1003976332 194
92 3300006847 Ga0075431_100077982 Ga0075431_1000779822 194
93 3300006852 Ga0075433_10344461 Ga0075433_103444611 194
94 3300006852 Ga0075433_10897153 Ga0075433_108971531 194
95 3300006871 Ga0075434_100285485 Ga0075434_1002854852 194
96 3300006881 Ga0068865_100003004 Ga0068865_1000030045 194
97 3300006914 Ga0075436_100036598 Ga0075436_1000365984 194
98 3300006931 Ga0097620_100009073 Ga0097620_1000090735 194
99 3300007265 Ga0099794_10016351 Ga0099794_100163515 194
100 3300007265 Ga0099794_10089020 Ga0099794_100890202 194
101 3300007265 Ga0099794_10135179 Ga0099794_101351791 194
102 3300007788 Ga0099795_10120161 Ga0099795_101201612 194
103 3300009094 Ga0111539_10665191 Ga0111539_106651912 194
104 3300009098 Ga0105245_10006905 Ga0105245_100069055 194
105 3300009148 Ga0105243_10036059 Ga0105243_100360594 194
106 3300009176 Ga0105242_10006126 Ga0105242_100061265 194
107 3300009177 Ga0105248_10319861 Ga0105248_103198612 194
108 3300009553 Ga0105249_10020021 Ga0105249_100200218 194
109 3300010159 Ga0099796_10015888 Ga0099796_100158882 194
110 3300011119 Ga0105246_10338700 Ga0105246_103387002 194
111 3300013297 Ga0157378_10013293 Ga0157378_100132933 194
112 3300013308 Ga0157375_10026459 Ga0157375_100264597 194
113 3300014326 Ga0157380_10006095 Ga0157380_100060955 194
114 3300014968 Ga0157379_10032623 Ga0157379_100326235 194
115 3300017792 Ga0163161_10633747 Ga0163161_106337472 194
116 3300025899 Ga0207642_10001477 Ga0207642_100014775 194
117 3300025907 Ga0207645_10192106 Ga0207645_101921061 194
118 3300025910 Ga0207684_10261359 Ga0207684_102613592 194
119 3300025917 Ga0207660_10137276 Ga0207660_101372762 194
120 3300025918 Ga0207662_10007996 Ga0207662_100079962 194
121 3300025927 Ga0207687_10004609 Ga0207687_100046097 194
122 3300025934 Ga0207686_10016538 Ga0207686_100165381 194
123 3300025935 Ga0207709_10039950 Ga0207709_100399505 194
124 3300025936 Ga0207670_10017594 Ga0207670_100175945 194
125 3300025938 Ga0207704_10011061 Ga0207704_100110615 194
126 3300025939 Ga0207665_10030496 Ga0207665_100304963 194
127 3300025942 Ga0207689_10000088 Ga0207689_100000886 194
128 3300025961 Ga0207712_10070951 Ga0207712_100709512 194
129 3300026023 Ga0207677_10054198 Ga0207677_100541982 194
130 3300026035 Ga0207703_10025872 Ga0207703_100258725 194
131 3300026075 Ga0207708_10002477 Ga0207708_100024777 194
132 3300026089 Ga0207648_10000202 Ga0207648_1000020255 194
133 3300026118 Ga0207675_100000417 Ga0207675_10000041730 194
134 3300026121 Ga0207683_10011479 Ga0207683_100114795 194
135 3300027671 Ga0209588_1001248 Ga0209588_10012485 194
136 3300027671 Ga0209588_1006905 Ga0209588_10069053 194
137 3300028380 Ga0268265_10018459 Ga0268265_100184595 194
138 3300028381 Ga0268264_10021435 Ga0268264_100214353 194
139 3300031507 Ga0307509_10000032 Ga0307509_1000003248 194
140 3300035083 Ga0373926_0024370 Ga0373926_0024370_162_746 194
141 3300035086 Ga0373934_0001988 Ga0373934_0001988_5898_6482 194
142 3300035086 Ga0373934_0078512 Ga0373934_0078512_211_795 194
143 3300035089 Ga0373944_0133861 Ga0373944_0133861_151_735 194
144 3300035111 Ga0373923_0014173 Ga0373923_0014173_1906_2490 194
145 3300035111 Ga0373923_0121525 Ga0373923_0121525_84_668 194
146 3300035113 Ga0373936_0022911 Ga0373936_0022911_1528_2112 194
147 3300035116 Ga0373945_0019691 Ga0373945_0019691_90_674 194
148 3300035118 Ga0373954_0000501 Ga0373954_0000501_11194_11778 194
149 3300035118 Ga0373954_0118795 Ga0373954_0118795_200_784 194
150 3300035119 Ga0373956_0008514 Ga0373956_0008514_320_904 194
151 3300035119 Ga0373956_0020251 Ga0373956_0020251_1935_2519 194
152 3300035120 Ga0373957_0000539 Ga0373957_0000539_8305_8889 194
153 3300035120 Ga0373957_0029744 Ga0373957_0029744_872_1456 194
154 3300035171 Ga0373946_0026544 Ga0373946_0026544_793_1377 194
155 3300035172 Ga0373955_0004210 Ga0373955_0004210_328_912 194
156 3300035172 Ga0373955_0014232 Ga0373955_0014232_2628_3212 194
157 3300035410 Ga0373924_0018300 Ga0373924_0018300_1536_2120 194
158 3300035692 Ga0373935_0042119 Ga0373935_0042119_744_1328 194
159 3300035724 Ga0373933_0030245 Ga0373933_0030245_2112_2696 194
160 3300035724 Ga0373933_0031354 Ga0373933_0031354_405_989 194
161 3300035725 Ga0373947_0193828 Ga0373947_0193828_413_997 194
162 3300036401 Ga0373937_0002406 Ga0373937_0002406_10885_11469 194
163 3300036401 Ga0373937_0142531 Ga0373937_0142531_1159_1743 194
164 3300036401 Ga0373937_0152533 Ga0373937_0152533_500_1084 194
165 3300036401 Ga0373937_0314485 Ga0373937_0314485_297_884 194
166 3300037068 Ga0373925_0036807 Ga0373925_0036807_1505_2089 194
167 3300039450 Ga0436363_0834181 Ga0436363_0834181_693_1280 194
168 3300042013 Ga0439456_048101 Ga0439456_048101_23_607 194
169 3300042876 Ga0451577_0044190 Ga0451577_0044190_653_1249 194
170 3300044712 Ga0453684_0016855 Ga0453684_0016855_1444_2040 194
171 3300044712 Ga0453684_0045206 Ga0453684_0045206_4277_4870 194
172 3300045051 Ga0451576_0598822 Ga0451576_0598822_348_953 194
173 3300045051 Ga0451576_0924113 Ga0451576_0924113_185_775 194
174 3300046454 Ga0495592_0026446 Ga0495592_0026446_2955_3539 194
175 3300046454 Ga0495592_0050455 Ga0495592_0050455_2405_2989 194
176 3300046455 Ga0495603_0371120 Ga0495603_0371120_36_620 194
177 3300046459 Ga0495629_0042818 Ga0495629_0042818_652_1236 194
178 3300046462 Ga0495651_0007117 Ga0495651_0007117_75_659 194
179 3300046463 Ga0495653_0075569 Ga0495653_0075569_328_912 194
180 3300046472 Ga0495580_0081419 Ga0495580_0081419_1345_1929 194
181 3300046473 Ga0495582_0018039 Ga0495582_0018039_201_785 194
182 3300046476 Ga0495662_0085543 Ga0495662_0085543_744_1328 194
183 3300046477 Ga0495664_0049773 Ga0495664_0049773_1132_1716 194
184 3300046499 Ga0495594_0035257 Ga0495594_0035257_1155_1739 194
185 3300046511 Ga0495608_0088893 Ga0495608_0088893_260_844 194
186 3300046514 Ga0495618_0221125 Ga0495618_0221125_438_1022 194
187 3300046516 Ga0495628_0002373 Ga0495628_0002373_11642_12226 194
188 3300046516 Ga0495628_0013205 Ga0495628_0013205_1893_2477 194
189 3300046516 Ga0495628_0017850 Ga0495628_0017850_5034_5618 194
190 3300046517 Ga0495630_0001060 Ga0495630_0001060_6421_7005 194
191 3300046517 Ga0495630_0125231 Ga0495630_0125231_417_1004 194
192 3300046517 Ga0495630_0154705 Ga0495630_0154705_992_1576 194
193 3300046526 Ga0495666_0005368 Ga0495666_0005368_4160_4744 194
194 3300046529 Ga0495652_0009241 Ga0495652_0009241_3165_3749 194
195 3300046529 Ga0495652_0038556 Ga0495652_0038556_1535_2119 194
196 3300046531 Ga0495665_0037271 Ga0495665_0037271_288_872 194
197 3300046533 Ga0495640_0053128 Ga0495640_0053128_1595_2179 194
198 3300046535 Ga0495586_0002409 Ga0495586_0002409_24_608 194
199 3300046543 Ga0495645_0000439 Ga0495645_0000439_15075_15659 194
200 3300046559 Ga0495667_0061618 Ga0495667_0061618_1018_1605 194
201 3300046559 Ga0495667_0065810 Ga0495667_0065810_1776_2360 194
202 3300046559 Ga0495667_0478960 Ga0495667_0478960_24_608 194
203 3300046642 Ga0495634_0004301 Ga0495634_0004301_5759_6343 194
204 3300046675 Ga0495657_0060603 Ga0495657_0060603_200_784 194
205 3300046678 Ga0495599_0000258 Ga0495599_0000258_2632_3216 194
206 3300046678 Ga0495599_0008950 Ga0495599_0008950_2003_2587 194
207 3300046680 Ga0495646_0157791 Ga0495646_0157791_607_1191 194
208 3300046681 Ga0495647_0001887 Ga0495647_0001887_206_790 194
209 3300046689 Ga0495613_0006634 Ga0495613_0006634_1532_2116 194
210 3300046690 Ga0495624_0016513 Ga0495624_0016513_387_971 194
211 3300046809 Ga0495600_0000915 Ga0495600_0000915_12786_13370 194
212 3300047315 Ga0495581_0185962 Ga0495581_0185962_285_869 194
213 3300047317 Ga0495604_0027415 Ga0495604_0027415_2225_2809 194
214 3300047317 Ga0495604_0483549 Ga0495604_0483549_65_652 194
215 3300047318 Ga0495636_0010177 Ga0495636_0010177_3051_3635 194
216 3300047319 Ga0495674_0017351 Ga0495674_0017351_4467_5051 194
217 3300047322 Ga0495680_0032180 Ga0495680_0032180_3526_4110 194
218 3300047444 Ga0495675_0209998 Ga0495675_0209998_268_852 194
219 3300047444 Ga0495675_0216855 Ga0495675_0216855_76_660 194
220 3300047444 Ga0495675_0320885 Ga0495675_0320885_275_859 194
221 3300047471 Ga0495684_0038537 Ga0495684_0038537_1538_2122 194
222 3300049571 Ga0501034_0062143 Ga0501034_0062143_1164_1757 194
223 3300049575 Ga0501039_0258587 Ga0501039_0258587_99_686 194
224 3300049577 Ga0501041_0406920 Ga0501041_0406920_250_837 194
225 3300049583 Ga0501067_0267172 Ga0501067_0267172_221_811 194
226 3300049584 Ga0501068_0002146 Ga0501068_0002146_8287_8877 194
227 3300049586 Ga0501070_0015151 Ga0501070_0015151_2833_3423 194
228 3300049587 Ga0501071_0373952 Ga0501071_0373952_267_854 194
229 3300049588 Ga0501072_0008326 Ga0501072_0008326_3942_4535 194
230 3300049589 Ga0501073_0001679 Ga0501073_0001679_1837_2427 194
231 3300049590 Ga0501074_0050280 Ga0501074_0050280_2212_2802 194
232 3300049593 Ga0501077_0326739 Ga0501077_0326739_294_884 194
233 3300049741 Ga0501079_0417992 Ga0501079_0417992_175_762 194
234 3300049742 Ga0501080_0003151 Ga0501080_0003151_11529_12119 194
235 3300049742 Ga0501080_0228629 Ga0501080_0228629_991_1584 194
236 3300049744 Ga0501083_0178242 Ga0501083_0178242_432_1022 194
237 3300050511 nmdc:mga08y16_527497_c1 nmdc:mga08y16_527497_c1_498_1082 194
238 3300050514 nmdc:mga08x19_4398_c1 nmdc:mga08x19_4398_c1_6908_7495 194
239 3300050514 nmdc:mga08x19_732628_c1 nmdc:mga08x19_732628_c1_41_628 194
240 3300050515 nmdc:mga0a205_373362_c1 nmdc:mga0a205_373362_c1_225_812 194
241 3300050515 nmdc:mga0a205_828145_c1 nmdc:mga0a205_828145_c1_82_672 194
242 3300053077 Ga0495601_0023483 Ga0495601_0023483_1827_2411 194
243 3300053077 Ga0495601_0127939 Ga0495601_0127939_580_1164 194
244 3300053084 Ga0495595_0212431 Ga0495595_0212431_80_664 194
245 3300053085 Ga0495619_0007646 Ga0495619_0007646_1543_2127 194
246 3300005435 Ga0070714_100011388 Ga0070714_1000113887 195
247 3300005518 Ga0070699_100054688 Ga0070699_1000546884 195
248 3300005546 Ga0070696_100027417 Ga0070696_1000274175 195
249 3300006914 Ga0075436_100159780 Ga0075436_1001597802 195
250 3300013297 Ga0157378_10035309 Ga0157378_100353093 195
251 3300021358 Ga0213873_10069696 Ga0213873_100696962 195
252 3300025929 Ga0207664_10002436 Ga0207664_1000243611 195
253 3300031548 Ga0307408_100649350 Ga0307408_1006493502 195
254 3300031731 Ga0307405_10062015 Ga0307405_100620153 195
255 3300031901 Ga0307406_10713522 Ga0307406_107135222 195
256 3300031911 Ga0307412_10105573 Ga0307412_101055732 195
257 3300035119 Ga0373956_0110076 Ga0373956_0110076_75_668 195
258 3300035724 Ga0373933_0151065 Ga0373933_0151065_159_752 195
259 3300036401 Ga0373937_0028558 Ga0373937_0028558_1657_2250 195
260 3300039453 Ga0436362_0388224 Ga0436362_0388224_149_739 195
261 3300044684 Ga0466966_0216642 Ga0466966_0216642_371_967 195
262 3300044842 Ga0466957_0025245 Ga0466957_0025245_1497_2087 195
263 3300045051 Ga0451576_0691069 Ga0451576_0691069_413_1051 195
264 3300045836 Ga0466958_0009610 Ga0466958_0009610_1949_2539 195
265 3300045836 Ga0466958_0037287 Ga0466958_0037287_828_1418 195
266 3300045976 Ga0466967_0554730 Ga0466967_0554730_272_862 195
267 3300050515 nmdc:mga0a205_60564_c1 nmdc:mga0a205_60564_c1_667_1260 195
268 3300005466 Ga0070685_10182500 Ga0070685_101825002 196
269 3300005518 Ga0070699_100066480 Ga0070699_1000664802 196
270 3300005548 Ga0070665_100138671 Ga0070665_1001386712 196
271 3300013307 Ga0157372_10794428 Ga0157372_107944282 196
272 3300014968 Ga0157379_10503082 Ga0157379_105030822 196
273 3300014969 Ga0157376_10053757 Ga0157376_100537573 196
274 3300025949 Ga0207667_10189470 Ga0207667_101894701 196
275 3300026118 Ga0207675_100263021 Ga0207675_1002630212 196
276 3300034819 Ga0373958_0103728 Ga0373958_0103728_15_617 196
277 3300037312 Ga0395899_0003084 Ga0395899_0003084_4527_5126 196
278 3300037466 Ga0395898_0092772 Ga0395898_0092772_542_1141 196
279 3300038443 Ga0395901_0273505 Ga0395901_0273505_479_1078 196
280 3300039437 Ga0436365_1644860 Ga0436365_1644860_26_658 196
281 3300045976 Ga0466967_0002146 Ga0466967_0002146_1975_2577 196
282 3300053096 Ga0500641_0048953 Ga0500641_0048953_776_1378 196
283 3300005327 Ga0070658_10980293 Ga0070658_109802931 198
284 3300005563 Ga0068855_101145104 Ga0068855_1011451042 198
285 3300005614 Ga0068856_100609412 Ga0068856_1006094122 198
286 3300005842 Ga0068858_100009972 Ga0068858_1000099728 198
287 3300014968 Ga0157379_10136718 Ga0157379_101367182 198
288 3300025913 Ga0207695_10587353 Ga0207695_105873531 198
289 3300026035 Ga0207703_10030819 Ga0207703_100308192 198
290 3300046678 Ga0495599_0006677 Ga0495599_0006677_1104_1817 198
291 3300035398 Ga0316574_0111343 Ga0316574_0111343_234_902 199
292 3300049570 Ga0501033_0073948 Ga0501033_0073948_1554_2171 199
293 3300049572 Ga0501036_0022675 Ga0501036_0022675_2391_3008 199
294 3300049572 Ga0501036_0102016 Ga0501036_0102016_109_756 199
295 3300049575 Ga0501039_0020487 Ga0501039_0020487_2472_3089 199
296 3300049575 Ga0501039_0027369 Ga0501039_0027369_798_1445 199
297 3300049576 Ga0501040_0006828 Ga0501040_0006828_3189_3806 199
298 3300049577 Ga0501041_0012135 Ga0501041_0012135_4403_5050 199
299 3300049577 Ga0501041_0020954 Ga0501041_0020954_1331_1948 199
300 3300049578 Ga0501042_0029061 Ga0501042_0029061_821_1468 199
301 3300049580 Ga0501046_0049113 Ga0501046_0049113_1144_1761 199
302 3300049580 Ga0501046_0338146 Ga0501046_0338146_338_985 199
303 3300049582 Ga0501048_0039961 Ga0501048_0039961_924_1541 199
304 3300049582 Ga0501048_0095514 Ga0501048_0095514_1067_1714 199
305 3300049587 Ga0501071_0049632 Ga0501071_0049632_912_1529 199
306 3300049587 Ga0501071_0279624 Ga0501071_0279624_539_1186 199
307 3300049588 Ga0501072_0002645 Ga0501072_0002645_5525_6142 199
308 3300049588 Ga0501072_0104351 Ga0501072_0104351_640_1287 199
309 3300049591 Ga0501075_0000017 Ga0501075_0000017_5144_5761 199
310 3300049591 Ga0501075_0047052 Ga0501075_0047052_360_1007 199
311 3300049592 Ga0501076_0000219 Ga0501076_0000219_2495_3112 199
312 3300049592 Ga0501076_0204610 Ga0501076_0204610_509_1156 199
313 3300049593 Ga0501077_0031487 Ga0501077_0031487_83_730 199
314 3300049741 Ga0501079_0033755 Ga0501079_0033755_2863_3480 199
315 3300049741 Ga0501079_0330141 Ga0501079_0330141_109_756 199
316 3300049742 Ga0501080_0138176 Ga0501080_0138176_496_1143 199
317 3300049742 Ga0501080_0589622 Ga0501080_0589622_37_654 199
318 3300049743 Ga0501081_0017407 Ga0501081_0017407_2112_2729 199
319 3300049743 Ga0501081_0036890 Ga0501081_0036890_247_894 199
320 3300049744 Ga0501083_0103156 Ga0501083_0103156_596_1243 199
321 3300049822 Ga0501035_0096352 Ga0501035_0096352_204_821 199
322 3300049824 Ga0501045_0157902 Ga0501045_0157902_967_1584 199
323 3300049824 Ga0501045_0411302 Ga0501045_0411302_90_737 199
324 3300054114 Ga0501084_0031887 Ga0501084_0031887_712_1329 199
325 3300054114 Ga0501084_0135495 Ga0501084_0135495_899_1546 199
326 3300060353 Ga0501082_0044671 Ga0501082_0044671_2016_2663 199
327 3300061734 Ga0530510_0000006 Ga0530510_0000006_129410_130027 199
328 3300061734 Ga0530510_0215794 Ga0530510_0215794_686_1333 199
329 3300003323 rootH1_10115630 rootH1_101156302 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

98

182

0.98

PF00677

Lum_binding

Lumazine binding domain

3

85

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9752 1 87
1i8d-assembly1.cif.gz_A crystal structure of riboflavin synthase 0.9672 1 201
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9643 1 87
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.96 1 199
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9529 1 200
ID Description Score Start End Superfamily
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9697 102 200 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9689 1 89 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9622 1 89 2.40.30.20
af_B7FAH8_195_301_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9618 102 200 2.40.30.20
3a3bB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9594 98 187 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7D7ZRH1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9872 1 199 GO:0004746
GO:0009231
AF-A0A0F2IW45-F1-model_v4 deleted 0.9861 1 204
AF-A0A2E2TZC3-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9854 1 202 GO:0004746
GO:0009231
AF-A0A7V8IXX5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9853 1 198 GO:0004746
GO:0009231
AF-A0A7C4N3Y1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9853 1 201 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
94.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map