F409814

General Info

Members Datasets Scaffolds Average Seq Length
329 224 658 335

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0053280|Ga0495620_0053280_192_1322
Length 376
Sequence MASHGTPRHRVVVLALDGLLPFELGIPQRIFGKARDADGRPLYEIVTCSVRPPGPVETDADFAVLVANGPEALATADTVVIPASYELGPVHEEGILTPELTAALAHLRPGTRLVSICTGSYVLAAAGYLDDRPATTHWMHAEHFQRLFPKIKVDAEVLFVDDGDVLTSAGVAAGIDLCLHLVRRDHGTAVANDVARRTVVPPHRDGGQAQYIQRPVPEPQAATTTAARAWALARLHEPIQLRDMAEQEAMSVRTFTRRFREEVGVSPGHWLTQQRIERARHLLETSDLSIDQVARDAGFGTAQSMRQHLQAVLGVTPTAYRRTFQTSGASRVEDLGARQPLKGRGAVYISGSAAGRDQPPPTRGRMNRPPKTEPTP

Samples

Sample ID Description Type Environment
1 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
38 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
53 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
152 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
159 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
160 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2643221548 Streptomyces sp. Root55 Isolate Unclassified
164 2643221578 Streptomyces sp. Root63 Isolate Unclassified
165 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
166 2643221647 Streptomyces sp. Root369 Isolate Unclassified
167 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
168 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
169 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
170 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
171 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
172 2643221714 Streptomyces sp. Root264 Isolate Unclassified
173 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
174 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
175 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
176 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
177 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
178 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
179 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
180 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
181 2808606448 Streptomyces sp. 193411 Isolate Unclassified
182 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
183 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
184 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
185 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
186 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
187 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
188 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
189 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
190 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
191 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
192 2867428634 Streptomyces sp. RP5T Isolate Unclassified
193 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
194 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
195 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
196 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
197 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
198 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
199 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
200 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
201 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
202 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
203 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
204 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
205 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
206 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
207 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
208 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
209 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
210 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
211 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
212 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
213 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
214 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
215 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
216 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
217 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
218 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
219 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
220 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
221 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
222 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
223 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
224 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.9
Metatranscriptomes 0.3
Isolates 22.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0.61
Rhizoplane 1.52
Rhizosphere 72.04
Stem 0
Stem Tuber 0.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495620_0053280 3300046515 Bacteria 1713
2 JGI24739J22299_10029895 3300001989 Bacteria 1891
3 JGI24737J22298_10008627 3300001990 Bacteria 3409
4 JGI24744J21845_10001121 3300002077 Bacteria 5212
5 rootH1_10008928 3300003316 Bacteria 3571
6 rootH1_10003616 3300003323 Bacteria 3574
7 rootH1_10005115 3300003323 Bacteria 10679
8 Ga0006562J51391_1116161 3300003578 Bacteria 2700
9 Ga0055540_1000859 3300003792 Bacteria 20290
10 Ga0055540_1003918 3300003792 Bacteria 6974
11 Ga0070663_100342720 3300005455 Bacteria 1208
12 Ga0075365_10002360 3300006038 Bacteria 9208
13 Ga0075365_10146710 3300006038 Bacteria 1640
14 Ga0075363_100004356 3300006048 Bacteria 6173
15 Ga0075363_100084763 3300006048 Bacteria 1738
16 Ga0075364_10030431 3300006051 Bacteria 3464
17 Ga0075367_10009723 3300006178 Bacteria 5037
18 Ga0075369_10003198 3300006186 Bacteria 5941
19 Ga0075369_10045394 3300006186 Bacteria 1889
20 Ga0075370_10022518 3300006353 Bacteria 3460
21 Ga0075430_100012091 3300006846 Bacteria 7348
22 Ga0105245_10077485 3300009098 Bacteria 3031
23 Ga0105248_10003295 3300009177 Bacteria 17915
24 Ga0105248_10120416 3300009177 Bacteria 2961
25 Ga0105238_10237334 3300009551 Bacteria 1800
26 Ga0105239_10125505 3300010375 Bacteria 2852
27 Ga0105246_10018197 3300011119 Bacteria 4476
28 Ga0163162_10004798 3300013306 Bacteria 13047
29 Ga0157372_10008754 3300013307 Bacteria 10747
30 Ga0182008_10006291 3300014497 Bacteria 6662
31 Ga0183367_1005 3300015688 Bacteria 652063
32 Ga0209673_1010746 3300025273 Bacteria 3833
33 Ga0209758_1001535 3300025297 Bacteria 26565
34 Ga0209051_1000516 3300025303 Bacteria 48783
35 Ga0209051_1002031 3300025303 Bacteria 15398
36 Ga0209051_1004763 3300025303 Bacteria 8201
37 Ga0209051_1027183 3300025303 Bacteria 2286
38 Ga0207647_10134562 3300025904 Bacteria 1451
39 Ga0207694_10099779 3300025924 Bacteria 2300
40 Ga0207709_10152769 3300025935 Bacteria 1601
41 Ga0207703_10376864 3300026035 Bacteria 1312
42 Ga0207678_10174645 3300026067 Bacteria 1834
43 Ga0207678_10334346 3300026067 Bacteria 1304
44 Ga0207702_10139972 3300026078 Bacteria 2188
45 Ga0307517_10063677 3300028786 Bacteria 3443
46 Ga0307515_10000933 3300028794 Bacteria 67151
47 Ga0307511_10001111 3300030521 Bacteria 28701
48 Ga0307512_10008482 3300030522 Bacteria 10010
49 Ga0307513_10057236 3300031456 Bacteria 4155
50 Ga0307513_10162181 3300031456 Bacteria 2126
51 Ga0307509_10006913 3300031507 Bacteria 15059
52 Ga0307509_10007427 3300031507 Bacteria 14329
53 Ga0307508_10060630 3300031616 Bacteria 3344
54 Ga0307508_10122875 3300031616 Bacteria 2199
55 Ga0307514_10004391 3300031649 Bacteria 12988
56 Ga0307514_10018676 3300031649 Bacteria 5682
57 Ga0307516_10008421 3300031730 Bacteria 11690
58 Ga0307516_10035388 3300031730 Bacteria 5011
59 Ga0307412_10309048 3300031911 Bacteria 1253
60 Ga0307411_10151115 3300032005 Bacteria 1726
61 Ga0307507_10006857 3300033179 Bacteria 17009
62 Ga0307507_10014960 3300033179 Bacteria 9183
63 Ga0307507_10044303 3300033179 Bacteria 4401
64 Ga0307510_10029762 3300033180 Bacteria 6208
65 Ga0307510_10034711 3300033180 Bacteria 5641
66 Ga0307510_10120932 3300033180 Bacteria 2323
67 Ga0395898_0002755 3300037466 Bacteria 20248
68 Ga0395898_0010768 3300037466 Bacteria 9551
69 Ga0395901_0059756 3300038443 Bacteria 3966
70 Ga0439436_0001975 3300041404 Bacteria 6083
71 Ga0439436_0038919 3300041404 Bacteria 1366
72 Ga0439439_0012864 3300041406 Bacteria 2024
73 Ga0451795_0149361 3300041456 Bacteria 2371
74 Ga0439433_0011199 3300041999 Bacteria 1962
75 Ga0439433_0022701 3300041999 Bacteria 1409
76 Ga0439442_021070 3300042002 Bacteria 1351
77 Ga0439449_0001724 3300042007 Bacteria 8593
78 Ga0439449_0018269 3300042007 Bacteria 2631
79 Ga0439449_0040072 3300042007 Bacteria 1741
80 Ga0439449_0041559 3300042007 Bacteria 1709
81 Ga0439449_0042644 3300042007 Bacteria 1685
82 Ga0439457_000829 3300042014 Bacteria 9283
83 Ga0439457_007500 3300042014 Bacteria 2613
84 Ga0439457_021166 3300042014 Bacteria 1442
85 Ga0439462_0005341 3300042015 Bacteria 3165
86 Ga0439462_0007281 3300042015 Bacteria 2766
87 Ga0466972_0006520 3300044658 Bacteria 5864
88 Ga0466965_0097706 3300044683 Bacteria 1499
89 Ga0466966_0015083 3300044684 Bacteria 5111
90 Ga0466961_0006252 3300044693 Bacteria 7563
91 Ga0466971_0007433 3300044719 Bacteria 4773
92 Ga0466960_0003247 3300044901 Bacteria 6233
93 Ga0466960_0120935 3300044901 Bacteria 1371
94 Ga0466967_0045140 3300045976 Bacteria 3827
95 Ga0495592_0033998 3300046454 Bacteria 3845
96 Ga0495592_0059202 3300046454 Bacteria 2821
97 Ga0495603_0000859 3300046455 Bacteria 17392
98 Ga0495603_0003363 3300046455 Bacteria 9517
99 Ga0495603_0023111 3300046455 Bacteria 3763
100 Ga0495603_0035398 3300046455 Bacteria 2999
101 Ga0495603_0096952 3300046455 Bacteria 1722
102 Ga0495603_0126469 3300046455 Bacteria 1489
103 Ga0495629_0006743 3300046459 Bacteria 8489
104 Ga0495629_0012760 3300046459 Bacteria 6081
105 Ga0495629_0012973 3300046459 Bacteria 6026
106 Ga0495629_0030228 3300046459 Bacteria 3841
107 Ga0495629_0042948 3300046459 Bacteria 3175
108 Ga0495629_0140223 3300046459 Bacteria 1682
109 Ga0495638_0035895 3300046460 Bacteria 3158
110 Ga0495651_0000578 3300046462 Bacteria 28428
111 Ga0495651_0229526 3300046462 Bacteria 1279
112 Ga0495605_0091433 3300046474 Bacteria 1409
113 Ga0495639_0047552 3300046475 Bacteria 1944
114 Ga0495662_0001250 3300046476 Bacteria 12534
115 Ga0495662_0001317 3300046476 Bacteria 12297
116 Ga0495662_0001758 3300046476 Bacteria 10832
117 Ga0495664_0004549 3300046477 Bacteria 7589
118 Ga0495585_0168804 3300046492 Bacteria 1131
119 Ga0495594_0001865 3300046499 Bacteria 10964
120 Ga0495594_0005272 3300046499 Bacteria 6640
121 Ga0495594_0027513 3300046499 Bacteria 3064
122 Ga0495594_0105109 3300046499 Bacteria 1589
123 Ga0495583_0025756 3300046506 Bacteria 2933
124 Ga0495583_0039217 3300046506 Bacteria 2232
125 Ga0495616_0037805 3300046513 Bacteria 2481
126 Ga0495618_0026350 3300046514 Bacteria 3614
127 Ga0495628_0028270 3300046516 Bacteria 4557
128 Ga0495628_0165094 3300046516 Bacteria 1681
129 Ga0495630_0050970 3300046517 Bacteria 3097
130 Ga0495631_0003816 3300046518 Bacteria 8183
131 Ga0495643_0004495 3300046522 Bacteria 9723
132 Ga0495648_0065241 3300046524 Bacteria 2141
133 Ga0495652_0017825 3300046529 Bacteria 6337
134 Ga0495652_0065892 3300046529 Bacteria 3042
135 Ga0495640_0020684 3300046533 Bacteria 4840
136 Ga0495586_0095934 3300046535 Bacteria 1642
137 Ga0495587_0002864 3300046536 Bacteria 11545
138 Ga0495587_0031845 3300046536 Bacteria 3191
139 Ga0495597_0065456 3300046542 Bacteria 1576
140 Ga0495645_0062545 3300046543 Bacteria 2696
141 Ga0495633_0037328 3300046558 Bacteria 2324
142 Ga0495667_0061097 3300046559 Bacteria 2471
143 Ga0495656_0029822 3300046615 Bacteria 2199
144 Ga0495668_0011892 3300046616 Bacteria 5187
145 Ga0495634_0001336 3300046642 Bacteria 22482
146 Ga0495635_0007896 3300046663 Bacteria 7433
147 Ga0495661_0135631 3300046665 Bacteria 1344
148 Ga0495661_0143846 3300046665 Bacteria 1294
149 Ga0495588_0003689 3300046674 Bacteria 6706
150 Ga0495588_0006955 3300046674 Bacteria 5128
151 Ga0495657_0011835 3300046675 Bacteria 6503
152 Ga0495657_0023494 3300046675 Bacteria 4403
153 Ga0495657_0120871 3300046675 Bacteria 1649
154 Ga0495646_0013774 3300046680 Bacteria 5141
155 Ga0495658_0011701 3300046683 Bacteria 4421
156 Ga0495613_0001593 3300046689 Bacteria 17194
157 Ga0495613_0005049 3300046689 Bacteria 9898
158 Ga0495613_0007318 3300046689 Bacteria 8219
159 Ga0495613_0008877 3300046689 Bacteria 7455
160 Ga0495613_0011938 3300046689 Bacteria 6457
161 Ga0495613_0024849 3300046689 Bacteria 4464
162 Ga0495613_0047764 3300046689 Bacteria 3162
163 Ga0495613_0054632 3300046689 Bacteria 2935
164 Ga0495624_0054006 3300046690 Bacteria 2534
165 Ga0495671_0062569 3300046692 Bacteria 1834
166 Ga0495649_0048517 3300046694 Bacteria 2307
167 Ga0495649_0056464 3300046694 Bacteria 2119
168 Ga0495589_0019759 3300046794 Bacteria 3448
169 Ga0495600_0017257 3300046809 Bacteria 4588
170 Ga0495581_0001441 3300047315 Bacteria 13208
171 Ga0495581_0045024 3300047315 Bacteria 2551
172 Ga0495581_0128164 3300047315 Bacteria 1478
173 Ga0495604_0000686 3300047317 Bacteria 28678
174 Ga0495604_0022511 3300047317 Bacteria 5031
175 Ga0495604_0073186 3300047317 Bacteria 2587
176 Ga0495636_0003461 3300047318 Bacteria 6131
177 Ga0495636_0013822 3300047318 Bacteria 3204
178 Ga0495636_0016249 3300047318 Bacteria 2972
179 Ga0495672_0104412 3300047320 Bacteria 1531
180 Ga0495676_0003128 3300047321 Bacteria 14969
181 Ga0495676_0020158 3300047321 Bacteria 5858
182 Ga0495676_0027838 3300047321 Bacteria 4841
183 Ga0495676_0032641 3300047321 Bacteria 4392
184 Ga0495680_0073240 3300047322 Bacteria 2603
185 Ga0495683_0049446 3300047323 Bacteria 2105
186 Ga0495683_0051224 3300047323 Bacteria 2065
187 Ga0495683_0099120 3300047323 Bacteria 1403
188 Ga0495687_003071 3300047443 Bacteria 12517
189 Ga0495687_010721 3300047443 Bacteria 5000
190 Ga0495687_037569 3300047443 Bacteria 2156
191 Ga0495675_0062459 3300047444 Bacteria 2358
192 Ga0495675_0106610 3300047444 Bacteria 1751
193 Ga0495677_0021828 3300047445 Bacteria 2320
194 Ga0495685_004920 3300047447 Bacteria 4338
195 Ga0495685_011941 3300047447 Bacteria 2938
196 Ga0495685_039642 3300047447 Bacteria 1612
197 Ga0495685_051982 3300047447 Bacteria 1388
198 Ga0495681_0000288 3300047470 Bacteria 40169
199 Ga0495681_0072737 3300047470 Bacteria 1554
200 Ga0495686_0005179 3300047472 Bacteria 10381
201 Ga0495686_0207050 3300047472 Bacteria 1122
202 Ga0495593_0000828 3300047673 Bacteria 17973
203 Ga0495602_0022018 3300048088 Bacteria 6250
204 Ga0495614_0000635 3300048089 Bacteria 14667
205 Ga0495614_0001556 3300048089 Bacteria 9959
206 Ga0496101_0021685 3300048904 Bacteria 4415
207 Ga0496102_0051519 3300048905 Bacteria 3750
208 Ga0496106_0053958 3300048909 Bacteria 3036
209 Ga0496109_0097989 3300048912 Bacteria 2718
210 Ga0496126_0119350 3300048929 Bacteria 2288
211 Ga0495678_026591 3300049459 Bacteria 2467
212 Ga0501032_0013977 3300049569 Bacteria 5695
213 Ga0501033_0005596 3300049570 Bacteria 9924
214 Ga0501033_0008401 3300049570 Bacteria 7997
215 Ga0501033_0185023 3300049570 Bacteria 1492
216 Ga0501034_0072941 3300049571 Bacteria 3441
217 Ga0501034_0084559 3300049571 Bacteria 3174
218 Ga0501036_0006304 3300049572 Bacteria 9627
219 Ga0501036_0066692 3300049572 Bacteria 3045
220 Ga0501037_0003852 3300049573 Bacteria 10891
221 Ga0501037_0010723 3300049573 Bacteria 6736
222 Ga0501038_0014859 3300049574 Bacteria 7090
223 Ga0501039_0182289 3300049575 Bacteria 1651
224 Ga0501042_0129767 3300049578 Bacteria 1816
225 Ga0501043_0040504 3300049579 Bacteria 3661
226 Ga0501046_0023216 3300049580 Bacteria 5104
227 Ga0501047_0025520 3300049581 Bacteria 5681
228 Ga0501048_0021143 3300049582 Bacteria 4765
229 Ga0501048_0021827 3300049582 Bacteria 4686
230 Ga0501070_0194944 3300049586 Bacteria 1664
231 Ga0501035_0023376 3300049822 Bacteria 5670
232 Ga0501035_0080638 3300049822 Bacteria 2873
233 Ga0501035_0101776 3300049822 Bacteria 2521
234 Ga0501044_0014284 3300049823 Bacteria 8574
235 Ga0501044_0059094 3300049823 Bacteria 3930
236 Ga0501044_0215511 3300049823 Bacteria 1873
237 Ga0501044_0238769 3300049823 Bacteria 1762
238 nmdc:mga03n38_2561_c1 3300050490 Bacteria 5649
239 nmdc:mga03n38_2652_c1 3300050490 Bacteria 5584
240 nmdc:mga03n38_90313_c1 3300050490 Bacteria 1457
241 nmdc:mga00v17_72067_c1 3300050491 Bacteria 2143
242 nmdc:mga07m45_32476_c1 3300050496 Bacteria 2895
243 nmdc:mga0qj67_22655_c1 3300050509 Bacteria 4826
244 nmdc:mga0sz30_3173_c2 3300050516 Bacteria 5456
245 Ga0495612_0020926 3300053078 Bacteria 2623
246 Ga0500635_0023834 3300053080 Bacteria 1914
247 Ga0495655_0011532 3300053083 Bacteria 1779
248 Ga0500640_001577 3300053095 Bacteria 7010
249 Ga0500652_006237 3300053131 Bacteria 3825
250 Ga0500573_0033739 3300053140 Bacteria 2953
251 Ga0500627_0012672 3300053158 Bacteria 3169
252 Ga0500645_000014 3300053730 Bacteria 151349
253 Ga0466962_0008056 3300061719 Bacteria 5051
254 Ga0466962_0066013 3300061719 Bacteria 1727
255 2547408091 2547132111 Bacteria 8013147
256 2585299361 2582581312 Bacteria 7308206
257 2585303304 2582581313 Bacteria 10042643
258 2585308763 2582581313 Bacteria 10042643
259 2585313458 2582581314 Bacteria 11452267
260 2616695103 2616644814 Bacteria 11555299
261 2643764894 2643221548 Bacteria 8053412
262 2643902690 2643221578 Bacteria 9213798
263 2643942133 2643221587 Bacteria 7586415
264 2644267793 2643221647 Bacteria 10741251
265 2644404802 2643221673 Bacteria 9196637
266 2644429216 2643221677 Bacteria 7584031
267 2644437135 2643221678 Bacteria 9540101
268 2644461266 2643221682 Bacteria 6743283
269 2644490921 2643221687 Bacteria 6500351
270 2644627794 2643221714 Bacteria 9015452
271 2644628875 2643221714 Bacteria 9015452
272 2738704989 2738541274 Bacteria 6909446
273 2739330164 2738543028 Bacteria 6917070
274 2784588545 2784132148 Bacteria 8627943
275 2785343344 2784746763 Bacteria 9783172
276 2785369471 2784746768 Bacteria 10036182
277 2804847084 2802429296 Bacteria 7227771
278 2808842031 2808606359 Bacteria 9866990
279 2809197907 2808606439 Bacteria 5952208
280 2809232157 2808606448 Bacteria 8656184
281 2811849002 2808606982 Bacteria 7791042
282 2812353920 2811994879 Bacteria 9313447
283 2812358136 2811994879 Bacteria 9313447
284 2812480547 2811994917 Bacteria 7761064
285 2819695344 2818991463 Bacteria 7948711
286 2837273040 2837268691 Bacteria 7850704
287 2852636706 2852635781 Bacteria 8251373
288 2852639112 2852635781 Bacteria 8251373
289 2862181857 2862178590 Bacteria 8583590
290 2862186532 2862178590 Bacteria 8583590
291 2862282745 2862281513 Bacteria 9621493
292 2862285619 2862281513 Bacteria 9621493
293 2862391652 2862382967 Bacteria 10317375
294 2862513941 2862507626 Bacteria 9425308
295 2867437110 2867428634 Bacteria 9590268
296 2873155758 2873151551 Bacteria 8625867
297 2875395850 2875391855 Bacteria 7600475
298 2877677303 2877676314 Bacteria 9512378
299 2899372953 2899370129 Bacteria 6781179
300 2902843931 2902837492 Bacteria 6697721
301 2912724365 2912723979 Bacteria 8557534
302 2919469542 2919468124 Bacteria 9133025
303 2935392005 2935390628 Bacteria 7043367
304 2946048778 2946045630 Bacteria 8527308
305 2946067705 2946064051 Bacteria 8957905
306 2946071776 2946064051 Bacteria 8957905
307 2946075886 2946072368 Bacteria 8999607
308 2946079548 2946072368 Bacteria 8999607
309 2947232666 2947224130 Bacteria 9938529
310 2954007449 2954002825 Bacteria 9173742
311 2954692850 2954691527 Bacteria 10720516
312 2954707923 2954701450 Bacteria 10834262
313 2954716278 2954711539 Bacteria 10867210
314 2954726220 2954721474 Bacteria 10456478
315 2954735590 2954731030 Bacteria 10243860
316 2954745145 2954740390 Bacteria 10229294
317 2954754446 2954749733 Bacteria 10366972
318 2954764119 2954759201 Bacteria 9358192
319 2997457010 2997451912 Bacteria 8492419
320 3006397395 3006393351 Bacteria 6615579
321 3006488849 3006486233 Bacteria 8157040
322 8008567335 8008558824 Bacteria 10610750
323 8008578909 8008574985 Bacteria 7815457
324 8023630816 8023623736 Bacteria 8593882
325 8025417313 8025413630 Bacteria 7014048
326 8025479001 8025478263 Bacteria 8209203
327 8025538076 8025530807 Bacteria 8495698
328 8056831727 8056829672 Bacteria 9045328
329 8057574319 8057568493 Bacteria 7221719
330 Ga0495620_0053280
331 JGI24739J22299_10029895
332 JGI24737J22298_10008627
333 JGI24744J21845_10001121
334 rootH1_10008928
335 rootH1_10003616
336 rootH1_10005115
337 Ga0006562J51391_1116161
338 Ga0055540_1000859
339 Ga0055540_1003918
340 Ga0070663_100342720
341 Ga0075365_10002360
342 Ga0075365_10146710
343 Ga0075363_100004356
344 Ga0075363_100084763
345 Ga0075364_10030431
346 Ga0075367_10009723
347 Ga0075369_10003198
348 Ga0075369_10045394
349 Ga0075370_10022518
350 Ga0075430_100012091
351 Ga0105245_10077485
352 Ga0105248_10003295
353 Ga0105248_10120416
354 Ga0105238_10237334
355 Ga0105239_10125505
356 Ga0105246_10018197
357 Ga0163162_10004798
358 Ga0157372_10008754
359 Ga0182008_10006291
360 Ga0183367_1005
361 Ga0209673_1010746
362 Ga0209758_1001535
363 Ga0209051_1000516
364 Ga0209051_1002031
365 Ga0209051_1004763
366 Ga0209051_1027183
367 Ga0207647_10134562
368 Ga0207694_10099779
369 Ga0207709_10152769
370 Ga0207703_10376864
371 Ga0207678_10174645
372 Ga0207678_10334346
373 Ga0207702_10139972
374 Ga0307517_10063677
375 Ga0307515_10000933
376 Ga0307511_10001111
377 Ga0307512_10008482
378 Ga0307513_10057236
379 Ga0307513_10162181
380 Ga0307509_10006913
381 Ga0307509_10007427
382 Ga0307508_10060630
383 Ga0307508_10122875
384 Ga0307514_10004391
385 Ga0307514_10018676
386 Ga0307516_10008421
387 Ga0307516_10035388
388 Ga0307412_10309048
389 Ga0307411_10151115
390 Ga0307507_10006857
391 Ga0307507_10014960
392 Ga0307507_10044303
393 Ga0307510_10029762
394 Ga0307510_10034711
395 Ga0307510_10120932
396 Ga0395898_0002755
397 Ga0395898_0010768
398 Ga0395901_0059756
399 Ga0439436_0001975
400 Ga0439436_0038919
401 Ga0439439_0012864
402 Ga0451795_0149361
403 Ga0439433_0011199
404 Ga0439433_0022701
405 Ga0439442_021070
406 Ga0439449_0001724
407 Ga0439449_0018269
408 Ga0439449_0040072
409 Ga0439449_0041559
410 Ga0439449_0042644
411 Ga0439457_000829
412 Ga0439457_007500
413 Ga0439457_021166
414 Ga0439462_0005341
415 Ga0439462_0007281
416 Ga0466972_0006520
417 Ga0466965_0097706
418 Ga0466966_0015083
419 Ga0466961_0006252
420 Ga0466971_0007433
421 Ga0466960_0003247
422 Ga0466960_0120935
423 Ga0466967_0045140
424 Ga0495592_0033998
425 Ga0495592_0059202
426 Ga0495603_0000859
427 Ga0495603_0003363
428 Ga0495603_0023111
429 Ga0495603_0035398
430 Ga0495603_0096952
431 Ga0495603_0126469
432 Ga0495629_0006743
433 Ga0495629_0012760
434 Ga0495629_0012973
435 Ga0495629_0030228
436 Ga0495629_0042948
437 Ga0495629_0140223
438 Ga0495638_0035895
439 Ga0495651_0000578
440 Ga0495651_0229526
441 Ga0495605_0091433
442 Ga0495639_0047552
443 Ga0495662_0001250
444 Ga0495662_0001317
445 Ga0495662_0001758
446 Ga0495664_0004549
447 Ga0495585_0168804
448 Ga0495594_0001865
449 Ga0495594_0005272
450 Ga0495594_0027513
451 Ga0495594_0105109
452 Ga0495583_0025756
453 Ga0495583_0039217
454 Ga0495616_0037805
455 Ga0495618_0026350
456 Ga0495628_0028270
457 Ga0495628_0165094
458 Ga0495630_0050970
459 Ga0495631_0003816
460 Ga0495643_0004495
461 Ga0495648_0065241
462 Ga0495652_0017825
463 Ga0495652_0065892
464 Ga0495640_0020684
465 Ga0495586_0095934
466 Ga0495587_0002864
467 Ga0495587_0031845
468 Ga0495597_0065456
469 Ga0495645_0062545
470 Ga0495633_0037328
471 Ga0495667_0061097
472 Ga0495656_0029822
473 Ga0495668_0011892
474 Ga0495634_0001336
475 Ga0495635_0007896
476 Ga0495661_0135631
477 Ga0495661_0143846
478 Ga0495588_0003689
479 Ga0495588_0006955
480 Ga0495657_0011835
481 Ga0495657_0023494
482 Ga0495657_0120871
483 Ga0495646_0013774
484 Ga0495658_0011701
485 Ga0495613_0001593
486 Ga0495613_0005049
487 Ga0495613_0007318
488 Ga0495613_0008877
489 Ga0495613_0011938
490 Ga0495613_0024849
491 Ga0495613_0047764
492 Ga0495613_0054632
493 Ga0495624_0054006
494 Ga0495671_0062569
495 Ga0495649_0048517
496 Ga0495649_0056464
497 Ga0495589_0019759
498 Ga0495600_0017257
499 Ga0495581_0001441
500 Ga0495581_0045024
501 Ga0495581_0128164
502 Ga0495604_0000686
503 Ga0495604_0022511
504 Ga0495604_0073186
505 Ga0495636_0003461
506 Ga0495636_0013822
507 Ga0495636_0016249
508 Ga0495672_0104412
509 Ga0495676_0003128
510 Ga0495676_0020158
511 Ga0495676_0027838
512 Ga0495676_0032641
513 Ga0495680_0073240
514 Ga0495683_0049446
515 Ga0495683_0051224
516 Ga0495683_0099120
517 Ga0495687_003071
518 Ga0495687_010721
519 Ga0495687_037569
520 Ga0495675_0062459
521 Ga0495675_0106610
522 Ga0495677_0021828
523 Ga0495685_004920
524 Ga0495685_011941
525 Ga0495685_039642
526 Ga0495685_051982
527 Ga0495681_0000288
528 Ga0495681_0072737
529 Ga0495686_0005179
530 Ga0495686_0207050
531 Ga0495593_0000828
532 Ga0495602_0022018
533 Ga0495614_0000635
534 Ga0495614_0001556
535 Ga0496101_0021685
536 Ga0496102_0051519
537 Ga0496106_0053958
538 Ga0496109_0097989
539 Ga0496126_0119350
540 Ga0495678_026591
541 Ga0501032_0013977
542 Ga0501033_0005596
543 Ga0501033_0008401
544 Ga0501033_0185023
545 Ga0501034_0072941
546 Ga0501034_0084559
547 Ga0501036_0006304
548 Ga0501036_0066692
549 Ga0501037_0003852
550 Ga0501037_0010723
551 Ga0501038_0014859
552 Ga0501039_0182289
553 Ga0501042_0129767
554 Ga0501043_0040504
555 Ga0501046_0023216
556 Ga0501047_0025520
557 Ga0501048_0021143
558 Ga0501048_0021827
559 Ga0501070_0194944
560 Ga0501035_0023376
561 Ga0501035_0080638
562 Ga0501035_0101776
563 Ga0501044_0014284
564 Ga0501044_0059094
565 Ga0501044_0215511
566 Ga0501044_0238769
567 nmdc:mga03n38_2561_c1
568 nmdc:mga03n38_2652_c1
569 nmdc:mga03n38_90313_c1
570 nmdc:mga00v17_72067_c1
571 nmdc:mga07m45_32476_c1
572 nmdc:mga0qj67_22655_c1
573 nmdc:mga0sz30_3173_c2
574 Ga0495612_0020926
575 Ga0500635_0023834
576 Ga0495655_0011532
577 Ga0500640_001577
578 Ga0500652_006237
579 Ga0500573_0033739
580 Ga0500627_0012672
581 Ga0500645_000014
582 Ga0466962_0008056
583 Ga0466962_0066013
584 2547408091
585 2585299361
586 2585303304
587 2585308763
588 2585313458
589 2616695103
590 2643764894
591 2643902690
592 2643942133
593 2644267793
594 2644404802
595 2644429216
596 2644437135
597 2644461266
598 2644490921
599 2644627794
600 2644628875
601 2738704989
602 2739330164
603 2784588545
604 2785343344
605 2785369471
606 2804847084
607 2808842031
608 2809197907
609 2809232157
610 2811849002
611 2812353920
612 2812358136
613 2812480547
614 2819695344
615 2837273040
616 2852636706
617 2852639112
618 2862181857
619 2862186532
620 2862282745
621 2862285619
622 2862391652
623 2862513941
624 2867437110
625 2873155758
626 2875395850
627 2877677303
628 2899372953
629 2902843931
630 2912724365
631 2919469542
632 2935392005
633 2946048778
634 2946067705
635 2946071776
636 2946075886
637 2946079548
638 2947232666
639 2954007449
640 2954692850
641 2954707923
642 2954716278
643 2954726220
644 2954735590
645 2954745145
646 2954754446
647 2954764119
648 2997457010
649 3006397395
650 3006488849
651 8008567335
652 8008578909
653 8023630816
654 8025417313
655 8025479001
656 8025538076
657 8056831727
658 8057574319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

244

323

0.97

PF01965

DJ-1_PfpI

DJ-1/PfpI family

9

184

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9748 225 327
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9488 225 324
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9379 228 322
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9332 225 325
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9127 228 314
ID Description Score Start End Superfamily
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9748 225 327 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9665 274 328 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.964 225 327 1.10.10.60
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9584 225 278 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9454 225 324 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6G3XN48-F1-model_v4 AraC family transcriptional regulator 0.9853 16 166 GO:0006355
AF-A0A7C6WMJ3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9786 225 325 GO:0003700
GO:0043565
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.978 225 323 GO:0003700
GO:0043565
AF-A4X6Y1-F1-model_v4 Transcriptional regulator, AraC family 0.976 225 323 GO:0003700
GO:0043565
AF-A0A6L8Z911-F1-model_v4 deleted 0.975 225 323

Map