F409781

General Info

Members Datasets Scaffolds Average Seq Length
329 133 329 193

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0033665|Ga0466961_0033665_2491_3123
Length 210
Sequence MEQRHILSLGDSAMTVRTALASRLRHALEAPSPLPPLVGDFPELRSKADTEAAVLIAITDRPDPGVILTVRREHLRTHAGQIAFPGGRVDSGEDAFVAALREAHEEVLLHPDQVDVVQAIEPYRTVTGYVITPVIGVIPPDLPLRPHEHEVAEWFEAPLDFLLDVNNQQQVSALFQGQTRNYYEIIWNDRRIWGATAAMIVNLSRRLQWR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
132 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.86
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006328 3300001979 Bacteria 4915
2 JGI24735J21928_10011690 3300002067 Bacteria 2780
3 Ga0070658_10005061 3300005327 Bacteria 10730
4 Ga0070658_10011920 3300005327 Bacteria 6981
5 Ga0070658_10036104 3300005327 Bacteria 3983
6 Ga0070658_10045954 3300005327 Bacteria 3533
7 Ga0070658_10247667 3300005327 Bacteria 1511
8 Ga0070658_10278847 3300005327 Bacteria 1422
9 Ga0070658_10462852 3300005327 Unclassified 1093
10 Ga0070658_10493253 3300005327 Bacteria 1057
11 Ga0070676_10763914 3300005328 Bacteria 710
12 Ga0070670_100128181 3300005331 Bacteria 2190
13 Ga0070680_100017760 3300005336 Bacteria 5612
14 Ga0070680_100021076 3300005336 Bacteria 5176
15 Ga0070680_100056883 3300005336 Bacteria 3196
16 Ga0070680_100060066 3300005336 Bacteria 3111
17 Ga0070680_100136594 3300005336 Bacteria 2054
18 Ga0068868_100079695 3300005338 Bacteria 2623
19 Ga0068868_100226867 3300005338 Bacteria 1566
20 Ga0070660_100001490 3300005339 Bacteria 16029
21 Ga0070660_100007720 3300005339 Bacteria 7500
22 Ga0070660_100012581 3300005339 Bacteria 6044
23 Ga0070660_100123348 3300005339 Bacteria 2069
24 Ga0070660_100318373 3300005339 Bacteria 1277
25 Ga0070660_100341894 3300005339 Bacteria 1231
26 Ga0070660_100362303 3300005339 Bacteria 1195
27 Ga0070661_100075673 3300005344 Bacteria 2481
28 Ga0070661_100107386 3300005344 Bacteria 2082
29 Ga0070661_100143189 3300005344 Bacteria 1802
30 Ga0070661_100445685 3300005344 Bacteria 1029
31 Ga0070692_10014754 3300005345 Bacteria 3679
32 Ga0070669_100087300 3300005353 Bacteria 2332
33 Ga0070675_100013993 3300005354 Bacteria 6317
34 Ga0070675_100703154 3300005354 Bacteria 921
35 Ga0070671_100008389 3300005355 Bacteria 8280
36 Ga0070671_100024124 3300005355 Bacteria 4978
37 Ga0070671_100141761 3300005355 Bacteria 2028
38 Ga0070671_100344172 3300005355 Bacteria 1272
39 Ga0070673_100021156 3300005364 Bacteria 4709
40 Ga0070673_100119368 3300005364 Bacteria 2197
41 Ga0070673_100194685 3300005364 Bacteria 1743
42 Ga0070688_100774754 3300005365 Unclassified 748
43 Ga0070659_100018751 3300005366 Bacteria 5223
44 Ga0070659_100024807 3300005366 Bacteria 4600
45 Ga0070659_100109335 3300005366 Bacteria 2231
46 Ga0070659_100289188 3300005366 Bacteria 1365
47 Ga0070659_100612121 3300005366 Bacteria 937
48 Ga0070659_101113785 3300005366 Bacteria 696
49 Ga0070667_100428176 3300005367 Bacteria 1207
50 Ga0070667_101122603 3300005367 Bacteria 735
51 Ga0070663_100188505 3300005455 Bacteria 1604
52 Ga0070663_100286465 3300005455 Bacteria 1314
53 Ga0070678_100001974 3300005456 Bacteria 11082
54 Ga0070662_100141986 3300005457 Bacteria 1862
55 Ga0070662_100407299 3300005457 Bacteria 1123
56 Ga0070681_10038919 3300005458 Bacteria 4768
57 Ga0070681_10055637 3300005458 Bacteria 3939
58 Ga0070681_10095440 3300005458 Bacteria 2923
59 Ga0070681_10403644 3300005458 Bacteria 1278
60 Ga0070681_10651514 3300005458 Bacteria 968
61 Ga0068867_100064519 3300005459 Bacteria 2723
62 Ga0070679_100004910 3300005530 Bacteria 12335
63 Ga0070679_100036031 3300005530 Bacteria 4909
64 Ga0070679_100047213 3300005530 Bacteria 4292
65 Ga0070679_100114818 3300005530 Bacteria 2678
66 Ga0070679_100459731 3300005530 Bacteria 1217
67 Ga0068853_100194445 3300005539 Bacteria 1844
68 Ga0068853_100357829 3300005539 Bacteria 1359
69 Ga0068853_100585898 3300005539 Bacteria 1058
70 Ga0070665_100039043 3300005548 Bacteria 4774
71 Ga0070665_100065268 3300005548 Bacteria 3652
72 Ga0070665_100149016 3300005548 Bacteria 2343
73 Ga0068855_100038741 3300005563 Bacteria 5662
74 Ga0068855_100108367 3300005563 Bacteria 3190
75 Ga0070664_100223616 3300005564 Bacteria 1685
76 Ga0068857_100056156 3300005577 Bacteria 3494
77 Ga0068857_100472752 3300005577 Bacteria 1174
78 Ga0068854_100005814 3300005578 Bacteria 7813
79 Ga0068854_100092771 3300005578 Bacteria 2250
80 Ga0068854_100283166 3300005578 Bacteria 1335
81 Ga0068856_100076487 3300005614 Bacteria 3316
82 Ga0068856_100112402 3300005614 Bacteria 2721
83 Ga0068856_100253572 3300005614 Bacteria 1774
84 Ga0068852_100014278 3300005616 Bacteria 6107
85 Ga0068852_100156943 3300005616 Bacteria 2121
86 Ga0068852_100223135 3300005616 Bacteria 1793
87 Ga0068859_100831859 3300005617 Bacteria 1010
88 Ga0068864_100079634 3300005618 Bacteria 2869
89 Ga0068863_100125680 3300005841 Bacteria 2447
90 Ga0068863_100463895 3300005841 Bacteria 1244
91 Ga0068858_100550906 3300005842 Bacteria 1116
92 Ga0068862_100078802 3300005844 Bacteria 2855
93 Ga0075366_10193641 3300006195 Bacteria 1236
94 Ga0097620_100831844 3300006931 Bacteria 1010
95 Ga0105240_10033909 3300009093 Bacteria 6591
96 Ga0105248_10048144 3300009177 Bacteria 4781
97 Ga0105248_10080318 3300009177 Bacteria 3665
98 Ga0105237_10190607 3300009545 Bacteria 2050
99 Ga0105238_10035976 3300009551 Bacteria 5034
100 Ga0105238_10203108 3300009551 Bacteria 1958
101 Ga0157373_10040242 3300013100 Bacteria 3345
102 Ga0157373_10358579 3300013100 Bacteria 1041
103 Ga0157371_10033553 3300013102 Bacteria 3687
104 Ga0157371_10141588 3300013102 Bacteria 1713
105 Ga0157371_10147861 3300013102 Bacteria 1675
106 Ga0157370_10036611 3300013104 Bacteria 4760
107 Ga0157370_10110025 3300013104 Bacteria 2575
108 Ga0157370_10159015 3300013104 Bacteria 2102
109 Ga0157370_10165427 3300013104 Bacteria 2057
110 Ga0157369_10007970 3300013105 Bacteria 12172
111 Ga0157369_10083675 3300013105 Bacteria 3412
112 Ga0157369_10308215 3300013105 Bacteria 1646
113 Ga0157369_10435352 3300013105 Bacteria 1359
114 Ga0157369_10566009 3300013105 Bacteria 1174
115 Ga0157374_10305203 3300013296 Bacteria 1575
116 Ga0157372_10157384 3300013307 Bacteria 2625
117 Ga0157372_10790060 3300013307 Bacteria 1103
118 Ga0157372_11032218 3300013307 Bacteria 952
119 Ga0157375_10352184 3300013308 Bacteria 1638
120 Ga0182008_10064255 3300014497 Bacteria 1807
121 Ga0157376_10143582 3300014969 Bacteria 2144
122 Ga0197907_10131162 3300020069 Bacteria 1238
123 Ga0206356_10638507 3300020070 Bacteria 888
124 Ga0206356_11761959 3300020070 Bacteria 1905
125 Ga0206353_10771127 3300020082 Bacteria 2956
126 Ga0207682_10002883 3300025893 Bacteria 7588
127 Ga0207688_10126496 3300025901 Bacteria 1495
128 Ga0207647_10078464 3300025904 Bacteria 1983
129 Ga0207645_10387977 3300025907 Bacteria 938
130 Ga0207705_10004391 3300025909 Bacteria 10652
131 Ga0207705_10006192 3300025909 Bacteria 8898
132 Ga0207705_10012265 3300025909 Bacteria 6193
133 Ga0207705_10028951 3300025909 Bacteria 3950
134 Ga0207705_10043292 3300025909 Bacteria 3234
135 Ga0207705_10093713 3300025909 Bacteria 2202
136 Ga0207705_10110526 3300025909 Bacteria 2030
137 Ga0207705_10207757 3300025909 Bacteria 1485
138 Ga0207705_10290507 3300025909 Bacteria 1252
139 Ga0207705_10558560 3300025909 Bacteria 890
140 Ga0207705_10614119 3300025909 Bacteria 845
141 Ga0207707_10010567 3300025912 Bacteria 8014
142 Ga0207707_10087980 3300025912 Bacteria 2714
143 Ga0207707_10242596 3300025912 Bacteria 1566
144 Ga0207707_10413720 3300025912 Bacteria 1157
145 Ga0207695_10267113 3300025913 Bacteria 1607
146 Ga0207660_10013631 3300025917 Bacteria 5330
147 Ga0207660_10103561 3300025917 Bacteria 2129
148 Ga0207660_10220557 3300025917 Bacteria 1488
149 Ga0207657_10000339 3300025919 Bacteria 49518
150 Ga0207657_10002226 3300025919 Bacteria 21039
151 Ga0207657_10002737 3300025919 Bacteria 18988
152 Ga0207657_10035759 3300025919 Bacteria 4451
153 Ga0207657_10068405 3300025919 Bacteria 3017
154 Ga0207657_10316199 3300025919 Bacteria 1235
155 Ga0207657_10342707 3300025919 Bacteria 1179
156 Ga0207649_10068334 3300025920 Bacteria 2259
157 Ga0207649_10802675 3300025920 Bacteria 735
158 Ga0207652_10004605 3300025921 Bacteria 11175
159 Ga0207652_10460302 3300025921 Bacteria 1146
160 Ga0207681_10040089 3300025923 Bacteria 3114
161 Ga0207694_10115864 3300025924 Bacteria 2135
162 Ga0207694_10240124 3300025924 Bacteria 1481
163 Ga0207659_10012371 3300025926 Bacteria 5426
164 Ga0207700_10519208 3300025928 Bacteria 1055
165 Ga0207644_10103602 3300025931 Bacteria 2141
166 Ga0207644_10512320 3300025931 Bacteria 990
167 Ga0207644_10734170 3300025931 Bacteria 824
168 Ga0207690_10001815 3300025932 Bacteria 13100
169 Ga0207690_10008694 3300025932 Bacteria 6024
170 Ga0207690_10028872 3300025932 Bacteria 3519
171 Ga0207690_10323019 3300025932 Bacteria 1214
172 Ga0207690_10637924 3300025932 Bacteria 872
173 Ga0207706_10018956 3300025933 Bacteria 6187
174 Ga0207706_10033695 3300025933 Bacteria 4557
175 Ga0207706_10187238 3300025933 Bacteria 1817
176 Ga0207706_10210020 3300025933 Bacteria 1706
177 Ga0207670_10646471 3300025936 Unclassified 872
178 Ga0207691_10117285 3300025940 Bacteria 2362
179 Ga0207691_10199082 3300025940 Bacteria 1744
180 Ga0207711_10163676 3300025941 Bacteria 2015
181 Ga0207661_10062426 3300025944 Bacteria 3014
182 Ga0207661_10072280 3300025944 Bacteria 2822
183 Ga0207679_10115167 3300025945 Bacteria 2129
184 Ga0207679_10525496 3300025945 Unclassified 1059
185 Ga0207679_11342767 3300025945 Bacteria 656
186 Ga0207667_10012617 3300025949 Bacteria 9715
187 Ga0207651_10056068 3300025960 Bacteria 2710
188 Ga0207651_10134516 3300025960 Bacteria 1899
189 Ga0207651_10943912 3300025960 Unclassified 769
190 Ga0207640_10081611 3300025981 Bacteria 2212
191 Ga0207640_10105578 3300025981 Bacteria 1985
192 Ga0207640_10729017 3300025981 Bacteria 853
193 Ga0207658_10048164 3300025986 Bacteria 3124
194 Ga0207658_10318272 3300025986 Bacteria 1346
195 Ga0207677_10201871 3300026023 Bacteria 1581
196 Ga0207703_10006561 3300026035 Bacteria 9282
197 Ga0207639_10240461 3300026041 Bacteria 1574
198 Ga0207639_10899094 3300026041 Bacteria 827
199 Ga0207678_10008776 3300026067 Bacteria 8893
200 Ga0207678_10038288 3300026067 Bacteria 4167
201 Ga0207702_10081545 3300026078 Bacteria 2809
202 Ga0207702_10192120 3300026078 Bacteria 1887
203 Ga0207702_10246616 3300026078 Bacteria 1675
204 Ga0207641_10732151 3300026088 Bacteria 975
205 Ga0207641_11181738 3300026088 Bacteria 764
206 Ga0207648_10038059 3300026089 Bacteria 4235
207 Ga0207683_10002663 3300026121 Bacteria 15600
208 Ga0207698_10012706 3300026142 Bacteria 5523
209 Ga0207698_10253809 3300026142 Bacteria 1611
210 Ga0268266_10233301 3300028379 Bacteria 1695
211 Ga0268266_10244370 3300028379 Bacteria 1658
212 Ga0268265_10247225 3300028380 Bacteria 1577
213 Ga0307412_10305366 3300031911 Bacteria 1259
214 Ga0307409_100106350 3300031995 Bacteria 2341
215 Ga0307409_100188293 3300031995 Bacteria 1834
216 Ga0307416_100001716 3300032002 Bacteria 12124
217 Ga0307416_100285728 3300032002 Bacteria 1630
218 Ga0307416_100750394 3300032002 Bacteria 1069
219 Ga0307414_10085743 3300032004 Bacteria 2321
220 Ga0307414_10239167 3300032004 Bacteria 1502
221 Ga0307411_10038914 3300032005 Bacteria 3005
222 Ga0307411_10511207 3300032005 Bacteria 1017
223 Ga0307415_100058281 3300032126 Bacteria 2658
224 Ga0307415_100078625 3300032126 Bacteria 2347
225 Ga0395899_0000432 3300037312 Bacteria 48281
226 Ga0395899_0002361 3300037312 Bacteria 15363
227 Ga0395899_0003237 3300037312 Bacteria 12919
228 Ga0395899_0030829 3300037312 Bacteria 4031
229 Ga0395899_0043314 3300037312 Bacteria 3358
230 Ga0395899_0191357 3300037312 Bacteria 1431
231 Ga0395899_0286588 3300037312 Unclassified 1119
232 Ga0395900_0000432 3300037418 Bacteria 60134
233 Ga0395900_0001148 3300037418 Bacteria 33301
234 Ga0395900_0005773 3300037418 Bacteria 12931
235 Ga0395900_0006882 3300037418 Bacteria 11797
236 Ga0395900_0017379 3300037418 Bacteria 7342
237 Ga0395900_0022846 3300037418 Bacteria 6399
238 Ga0395900_0037965 3300037418 Bacteria 4966
239 Ga0395900_0091177 3300037418 Bacteria 3132
240 Ga0395900_0120085 3300037418 Bacteria 2697
241 Ga0395900_0127179 3300037418 Bacteria 2613
242 Ga0395900_0242807 3300037418 Bacteria 1806
243 Ga0395900_0252602 3300037418 Unclassified 1764
244 Ga0395900_0670299 3300037418 Bacteria 972
245 Ga0395900_0979199 3300037418 Bacteria 766
246 Ga0395898_0000021 3300037466 Bacteria 393971
247 Ga0395898_0001152 3300037466 Bacteria 40373
248 Ga0395898_0002234 3300037466 Bacteria 23570
249 Ga0395898_0011941 3300037466 Bacteria 8995
250 Ga0395898_0019121 3300037466 Bacteria 6974
251 Ga0395898_0469208 3300037466 Bacteria 1198
252 Ga0395898_0540118 3300037466 Bacteria 1108
253 Ga0395905_0000413 3300037471 Bacteria 60132
254 Ga0395905_0000649 3300037471 Bacteria 46291
255 Ga0395905_0000688 3300037471 Bacteria 44764
256 Ga0395905_0001939 3300037471 Bacteria 23712
257 Ga0395905_0004189 3300037471 Bacteria 15085
258 Ga0395905_0006002 3300037471 Bacteria 12300
259 Ga0395905_0009108 3300037471 Bacteria 9725
260 Ga0395905_0011627 3300037471 Bacteria 8502
261 Ga0395905_0024167 3300037471 Bacteria 5735
262 Ga0395905_0032222 3300037471 Bacteria 4930
263 Ga0395905_0085869 3300037471 Bacteria 2949
264 Ga0395905_0102836 3300037471 Bacteria 2682
265 Ga0395905_0210181 3300037471 Bacteria 1823
266 Ga0395905_0602337 3300037471 Bacteria 1000
267 Ga0395901_0000386 3300038443 Bacteria 52804
268 Ga0395901_0002452 3300038443 Bacteria 18805
269 Ga0395901_0003117 3300038443 Bacteria 16656
270 Ga0395901_0004674 3300038443 Bacteria 13804
271 Ga0395901_0014797 3300038443 Bacteria 7927
272 Ga0395901_0016429 3300038443 Bacteria 7538
273 Ga0395901_0054384 3300038443 Bacteria 4161
274 Ga0395901_0179976 3300038443 Bacteria 2217
275 Ga0395901_0216361 3300038443 Bacteria 2004
276 Ga0395901_0257782 3300038443 Bacteria 1816
277 Ga0395901_0421743 3300038443 Bacteria 1368
278 Ga0395901_0552476 3300038443 Bacteria 1167
279 Ga0395901_0652408 3300038443 Bacteria 1055
280 Ga0395901_0761362 3300038443 Bacteria 960
281 Ga0436365_0185827 3300039437 Bacteria 2359
282 Ga0436365_1895876 3300039437 Bacteria 889
283 Ga0439458_0000497 3300042157 Bacteria 10086
284 Ga0466972_0092840 3300044658 Bacteria 1431
285 Ga0466966_0078317 3300044684 Bacteria 2061
286 Ga0466966_0464416 3300044684 Unclassified 761
287 Ga0466961_0016572 3300044693 Bacteria 4737
288 Ga0466961_0033665 3300044693 Bacteria 3291
289 Ga0466963_0037256 3300044694 Bacteria 3174
290 Ga0466963_0367373 3300044694 Bacteria 1014
291 Ga0466971_0073851 3300044719 Bacteria 1550
292 Ga0466971_0253748 3300044719 Unclassified 838
293 Ga0466970_0117970 3300044765 Bacteria 1452
294 Ga0466957_0172546 3300044842 Bacteria 1409
295 Ga0466957_0179443 3300044842 Bacteria 1382
296 Ga0466957_0259257 3300044842 Bacteria 1158
297 Ga0466959_0458383 3300045049 Bacteria 864
298 Ga0466958_0162478 3300045836 Bacteria 1411
299 Ga0466958_0302232 3300045836 Bacteria 1027
300 Ga0466958_0344624 3300045836 Bacteria 959
301 Ga0466967_0050475 3300045976 Bacteria 3643
302 Ga0466967_0147260 3300045976 Bacteria 2197
303 Ga0495616_0082110 3300046513 Bacteria 1540
304 Ga0495654_0050252 3300046530 Bacteria 2039
305 Ga0495668_0021150 3300046616 Bacteria 3734
306 Ga0495669_0012589 3300046684 Bacteria 3602
307 Ga0495669_0232603 3300046684 Bacteria 884
308 Ga0495685_066960 3300047447 Bacteria 1206
309 Ga0496100_0324469 3300048903 Bacteria 1157
310 Ga0496101_0030116 3300048904 Bacteria 3803
311 Ga0496101_0214871 3300048904 Bacteria 1491
312 Ga0496106_0007667 3300048909 Bacteria 7985
313 Ga0496107_0023077 3300048910 Bacteria 4397
314 Ga0496107_0269173 3300048910 Bacteria 1268
315 Ga0496108_0000676 3300048911 Bacteria 26369
316 Ga0496109_0051763 3300048912 Bacteria 3741
317 Ga0496109_0332100 3300048912 Bacteria 1435
318 Ga0496110_0426821 3300048913 Bacteria 1208
319 Ga0496110_0969815 3300048913 Unclassified 757
320 Ga0496111_0053156 3300048914 Bacteria 2926
321 Ga0496112_0157429 3300048915 Bacteria 2238
322 Ga0496112_0402620 3300048915 Bacteria 1308
323 Ga0496113_0009478 3300048916 Bacteria 6387
324 Ga0496113_0073063 3300048916 Bacteria 2612
325 Ga0501209_116736 3300049656 Bacteria 790
326 Ga0501270_042601 3300049767 Bacteria 796
327 Ga0466962_0008867 3300061719 Bacteria 4820
328 Ga0466962_0186990 3300061719 Bacteria 1010
329 Ga0466962_0197599 3300061719 Bacteria 982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10002883 Ga0207682_100028837 166
2 3300025901 Ga0207688_10126496 Ga0207688_101264962 166
3 3300037418 Ga0395900_0127179 Ga0395900_0127179_1217_1753 166
4 3300037466 Ga0395898_0469208 Ga0395898_0469208_240_776 166
5 3300038443 Ga0395901_0179976 Ga0395901_0179976_520_1056 166
6 3300061719 Ga0466962_0197599 Ga0466962_0197599_435_971 166
7 3300002067 JGI24735J21928_10011690 JGI24735J21928_100116902 167
8 3300013102 Ga0157371_10147861 Ga0157371_101478612 168
9 3300038443 Ga0395901_0257782 Ga0395901_0257782_958_1503 169
10 3300005327 Ga0070658_10462852 Ga0070658_104628522 170
11 3300005344 Ga0070661_100075673 Ga0070661_1000756734 170
12 3300025909 Ga0207705_10012265 Ga0207705_100122657 170
13 3300025981 Ga0207640_10729017 Ga0207640_107290171 170
14 3300037466 Ga0395898_0540118 Ga0395898_0540118_334_885 171
15 3300025944 Ga0207661_10072280 Ga0207661_100722802 174
16 3300025928 Ga0207700_10519208 Ga0207700_105192082 175
17 3300005327 Ga0070658_10247667 Ga0070658_102476672 177
18 3300005336 Ga0070680_100017760 Ga0070680_1000177609 177
19 3300005339 Ga0070660_100001490 Ga0070660_10000149010 177
20 3300005345 Ga0070692_10014754 Ga0070692_100147542 177
21 3300005458 Ga0070681_10038919 Ga0070681_100389192 177
22 3300005530 Ga0070679_100004910 Ga0070679_1000049109 177
23 3300005539 Ga0068853_100357829 Ga0068853_1003578292 177
24 3300005563 Ga0068855_100038741 Ga0068855_1000387417 177
25 3300005616 Ga0068852_100223135 Ga0068852_1002231352 177
26 3300013100 Ga0157373_10358579 Ga0157373_103585792 177
27 3300013104 Ga0157370_10110025 Ga0157370_101100252 177
28 3300013105 Ga0157369_10308215 Ga0157369_103082152 177
29 3300025909 Ga0207705_10004391 Ga0207705_100043916 177
30 3300025912 Ga0207707_10010567 Ga0207707_100105672 177
31 3300025917 Ga0207660_10220557 Ga0207660_102205572 177
32 3300025919 Ga0207657_10002737 Ga0207657_1000273714 177
33 3300025921 Ga0207652_10004605 Ga0207652_100046055 177
34 3300025949 Ga0207667_10012617 Ga0207667_100126175 177
35 3300026041 Ga0207639_10899094 Ga0207639_108990942 177
36 3300037312 Ga0395899_0191357 Ga0395899_0191357_90_674 177
37 3300038443 Ga0395901_0761362 Ga0395901_0761362_331_915 177
38 3300025919 Ga0207657_10316199 Ga0207657_103161992 180
39 3300005327 Ga0070658_10005061 Ga0070658_100050615 181
40 3300005327 Ga0070658_10011920 Ga0070658_100119208 181
41 3300005327 Ga0070658_10036104 Ga0070658_100361045 181
42 3300005327 Ga0070658_10278847 Ga0070658_102788472 181
43 3300005328 Ga0070676_10763914 Ga0070676_107639141 181
44 3300005331 Ga0070670_100128181 Ga0070670_1001281812 181
45 3300005336 Ga0070680_100056883 Ga0070680_1000568834 181
46 3300005336 Ga0070680_100136594 Ga0070680_1001365942 181
47 3300005338 Ga0068868_100226867 Ga0068868_1002268671 181
48 3300005339 Ga0070660_100007720 Ga0070660_1000077201 181
49 3300005339 Ga0070660_100123348 Ga0070660_1001233483 181
50 3300005353 Ga0070669_100087300 Ga0070669_1000873003 181
51 3300005354 Ga0070675_100013993 Ga0070675_1000139935 181
52 3300005354 Ga0070675_100703154 Ga0070675_1007031542 181
53 3300005355 Ga0070671_100008389 Ga0070671_1000083893 181
54 3300005355 Ga0070671_100141761 Ga0070671_1001417612 181
55 3300005355 Ga0070671_100344172 Ga0070671_1003441722 181
56 3300005364 Ga0070673_100194685 Ga0070673_1001946852 181
57 3300005365 Ga0070688_100774754 Ga0070688_1007747541 181
58 3300005366 Ga0070659_100018751 Ga0070659_1000187515 181
59 3300005366 Ga0070659_100289188 Ga0070659_1002891882 181
60 3300005366 Ga0070659_101113785 Ga0070659_1011137851 181
61 3300005367 Ga0070667_100428176 Ga0070667_1004281761 181
62 3300005367 Ga0070667_101122603 Ga0070667_1011226031 181
63 3300005455 Ga0070663_100286465 Ga0070663_1002864652 181
64 3300005456 Ga0070678_100001974 Ga0070678_1000019746 181
65 3300005457 Ga0070662_100407299 Ga0070662_1004072992 181
66 3300005458 Ga0070681_10651514 Ga0070681_106515142 181
67 3300005459 Ga0068867_100064519 Ga0068867_1000645194 181
68 3300005530 Ga0070679_100047213 Ga0070679_1000472135 181
69 3300005548 Ga0070665_100039043 Ga0070665_1000390434 181
70 3300005548 Ga0070665_100065268 Ga0070665_1000652683 181
71 3300005548 Ga0070665_100149016 Ga0070665_1001490162 181
72 3300005564 Ga0070664_100223616 Ga0070664_1002236162 181
73 3300005577 Ga0068857_100472752 Ga0068857_1004727522 181
74 3300005578 Ga0068854_100005814 Ga0068854_1000058147 181
75 3300005614 Ga0068856_100112402 Ga0068856_1001124023 181
76 3300005617 Ga0068859_100831859 Ga0068859_1008318592 181
77 3300005841 Ga0068863_100125680 Ga0068863_1001256803 181
78 3300005842 Ga0068858_100550906 Ga0068858_1005509062 181
79 3300005844 Ga0068862_100078802 Ga0068862_1000788024 181
80 3300006931 Ga0097620_100831844 Ga0097620_1008318442 181
81 3300009177 Ga0105248_10048144 Ga0105248_100481443 181
82 3300009545 Ga0105237_10190607 Ga0105237_101906072 181
83 3300009551 Ga0105238_10035976 Ga0105238_100359762 181
84 3300013104 Ga0157370_10159015 Ga0157370_101590152 181
85 3300013104 Ga0157370_10165427 Ga0157370_101654272 181
86 3300013105 Ga0157369_10007970 Ga0157369_100079709 181
87 3300013105 Ga0157369_10566009 Ga0157369_105660092 181
88 3300013308 Ga0157375_10352184 Ga0157375_103521842 181
89 3300014497 Ga0182008_10064255 Ga0182008_100642552 181
90 3300014969 Ga0157376_10143582 Ga0157376_101435822 181
91 3300020070 Ga0206356_11761959 Ga0206356_117619592 181
92 3300025907 Ga0207645_10387977 Ga0207645_103879771 181
93 3300025909 Ga0207705_10006192 Ga0207705_100061929 181
94 3300025909 Ga0207705_10028951 Ga0207705_100289514 181
95 3300025909 Ga0207705_10110526 Ga0207705_101105262 181
96 3300025909 Ga0207705_10290507 Ga0207705_102905072 181
97 3300025909 Ga0207705_10558560 Ga0207705_105585601 181
98 3300025912 Ga0207707_10413720 Ga0207707_104137202 181
99 3300025917 Ga0207660_10103561 Ga0207660_101035612 181
100 3300025919 Ga0207657_10000339 Ga0207657_100003397 181
101 3300025919 Ga0207657_10002226 Ga0207657_1000222615 181
102 3300025919 Ga0207657_10068405 Ga0207657_100684053 181
103 3300025923 Ga0207681_10040089 Ga0207681_100400894 181
104 3300025924 Ga0207694_10115864 Ga0207694_101158642 181
105 3300025926 Ga0207659_10012371 Ga0207659_100123715 181
106 3300025931 Ga0207644_10103602 Ga0207644_101036022 181
107 3300025931 Ga0207644_10734170 Ga0207644_107341702 181
108 3300025932 Ga0207690_10008694 Ga0207690_100086945 181
109 3300025932 Ga0207690_10028872 Ga0207690_100288722 181
110 3300025932 Ga0207690_10637924 Ga0207690_106379242 181
111 3300025933 Ga0207706_10187238 Ga0207706_101872383 181
112 3300025936 Ga0207670_10646471 Ga0207670_106464711 181
113 3300025940 Ga0207691_10117285 Ga0207691_101172852 181
114 3300025940 Ga0207691_10199082 Ga0207691_101990822 181
115 3300025944 Ga0207661_10062426 Ga0207661_100624262 181
116 3300025945 Ga0207679_10525496 Ga0207679_105254962 181
117 3300025945 Ga0207679_11342767 Ga0207679_113427671 181
118 3300025960 Ga0207651_10134516 Ga0207651_101345162 181
119 3300025960 Ga0207651_10943912 Ga0207651_109439121 181
120 3300025986 Ga0207658_10318272 Ga0207658_103182722 181
121 3300026035 Ga0207703_10006561 Ga0207703_100065613 181
122 3300026067 Ga0207678_10008776 Ga0207678_100087762 181
123 3300026088 Ga0207641_11181738 Ga0207641_111817382 181
124 3300026089 Ga0207648_10038059 Ga0207648_100380596 181
125 3300026121 Ga0207683_10002663 Ga0207683_1000266316 181
126 3300028379 Ga0268266_10233301 Ga0268266_102333013 181
127 3300028379 Ga0268266_10244370 Ga0268266_102443702 181
128 3300028380 Ga0268265_10247225 Ga0268265_102472252 181
129 3300031995 Ga0307409_100106350 Ga0307409_1001063503 181
130 3300031995 Ga0307409_100188293 Ga0307409_1001882932 181
131 3300032002 Ga0307416_100001716 Ga0307416_1000017165 181
132 3300032002 Ga0307416_100285728 Ga0307416_1002857282 181
133 3300032002 Ga0307416_100750394 Ga0307416_1007503942 181
134 3300032004 Ga0307414_10085743 Ga0307414_100857432 181
135 3300032004 Ga0307414_10239167 Ga0307414_102391672 181
136 3300032005 Ga0307411_10038914 Ga0307411_100389143 181
137 3300032126 Ga0307415_100058281 Ga0307415_1000582813 181
138 3300032126 Ga0307415_100078625 Ga0307415_1000786252 181
139 3300037312 Ga0395899_0000432 Ga0395899_0000432_38888_39469 181
140 3300037312 Ga0395899_0030829 Ga0395899_0030829_2809_3390 181
141 3300037312 Ga0395899_0043314 Ga0395899_0043314_188_769 181
142 3300037312 Ga0395899_0286588 Ga0395899_0286588_205_786 181
143 3300037418 Ga0395900_0000432 Ga0395900_0000432_51767_52348 181
144 3300037418 Ga0395900_0001148 Ga0395900_0001148_6138_6719 181
145 3300037418 Ga0395900_0005773 Ga0395900_0005773_8534_9115 181
146 3300037418 Ga0395900_0006882 Ga0395900_0006882_9012_9593 181
147 3300037418 Ga0395900_0037965 Ga0395900_0037965_1426_2007 181
148 3300037418 Ga0395900_0091177 Ga0395900_0091177_346_927 181
149 3300037418 Ga0395900_0120085 Ga0395900_0120085_255_836 181
150 3300037418 Ga0395900_0242807 Ga0395900_0242807_405_986 181
151 3300037418 Ga0395900_0252602 Ga0395900_0252602_169_750 181
152 3300037418 Ga0395900_0670299 Ga0395900_0670299_191_772 181
153 3300037466 Ga0395898_0000021 Ga0395898_0000021_385601_386182 181
154 3300037466 Ga0395898_0002234 Ga0395898_0002234_14891_15472 181
155 3300037466 Ga0395898_0019121 Ga0395898_0019121_5178_5759 181
156 3300037471 Ga0395905_0000413 Ga0395905_0000413_51767_52348 181
157 3300037471 Ga0395905_0000649 Ga0395905_0000649_37648_38229 181
158 3300037471 Ga0395905_0000688 Ga0395905_0000688_8231_8812 181
159 3300037471 Ga0395905_0001939 Ga0395905_0001939_4694_5275 181
160 3300037471 Ga0395905_0006002 Ga0395905_0006002_3329_3910 181
161 3300037471 Ga0395905_0009108 Ga0395905_0009108_7969_8550 181
162 3300037471 Ga0395905_0011627 Ga0395905_0011627_6837_7418 181
163 3300037471 Ga0395905_0024167 Ga0395905_0024167_3697_4278 181
164 3300037471 Ga0395905_0210181 Ga0395905_0210181_134_715 181
165 3300038443 Ga0395901_0002452 Ga0395901_0002452_8107_8688 181
166 3300038443 Ga0395901_0003117 Ga0395901_0003117_3455_4036 181
167 3300038443 Ga0395901_0004674 Ga0395901_0004674_5345_5926 181
168 3300038443 Ga0395901_0216361 Ga0395901_0216361_154_735 181
169 3300038443 Ga0395901_0421743 Ga0395901_0421743_319_900 181
170 3300038443 Ga0395901_0552476 Ga0395901_0552476_154_735 181
171 3300039437 Ga0436365_0185827 Ga0436365_0185827_1732_2313 181
172 3300039437 Ga0436365_1895876 Ga0436365_1895876_262_843 181
173 3300044684 Ga0466966_0078317 Ga0466966_0078317_1139_1720 181
174 3300044693 Ga0466961_0016572 Ga0466961_0016572_3739_4320 181
175 3300044694 Ga0466963_0037256 Ga0466963_0037256_493_1074 181
176 3300044694 Ga0466963_0367373 Ga0466963_0367373_236_817 181
177 3300044719 Ga0466971_0073851 Ga0466971_0073851_144_725 181
178 3300044765 Ga0466970_0117970 Ga0466970_0117970_401_982 181
179 3300044842 Ga0466957_0172546 Ga0466957_0172546_673_1254 181
180 3300045049 Ga0466959_0458383 Ga0466959_0458383_95_676 181
181 3300045836 Ga0466958_0302232 Ga0466958_0302232_157_738 181
182 3300045836 Ga0466958_0344624 Ga0466958_0344624_351_932 181
183 3300045976 Ga0466967_0147260 Ga0466967_0147260_982_1563 181
184 3300046513 Ga0495616_0082110 Ga0495616_0082110_603_1184 181
185 3300046530 Ga0495654_0050252 Ga0495654_0050252_1159_1740 181
186 3300046616 Ga0495668_0021150 Ga0495668_0021150_28_609 181
187 3300046684 Ga0495669_0012589 Ga0495669_0012589_2356_2937 181
188 3300047447 Ga0495685_066960 Ga0495685_066960_73_654 181
189 3300048904 Ga0496101_0214871 Ga0496101_0214871_696_1277 181
190 3300048910 Ga0496107_0269173 Ga0496107_0269173_503_1084 181
191 3300048911 Ga0496108_0000676 Ga0496108_0000676_17821_18402 181
192 3300048912 Ga0496109_0051763 Ga0496109_0051763_2480_3061 181
193 3300048913 Ga0496110_0969815 Ga0496110_0969815_123_704 181
194 3300048915 Ga0496112_0402620 Ga0496112_0402620_66_647 181
195 3300048916 Ga0496113_0073063 Ga0496113_0073063_714_1295 181
196 3300061719 Ga0466962_0186990 Ga0466962_0186990_181_762 181
197 3300005327 Ga0070658_10045954 Ga0070658_100459543 182
198 3300005327 Ga0070658_10493253 Ga0070658_104932532 182
199 3300005336 Ga0070680_100021076 Ga0070680_1000210764 182
200 3300005336 Ga0070680_100060066 Ga0070680_1000600663 182
201 3300005338 Ga0068868_100079695 Ga0068868_1000796954 182
202 3300005339 Ga0070660_100318373 Ga0070660_1003183732 182
203 3300005339 Ga0070660_100341894 Ga0070660_1003418942 182
204 3300005339 Ga0070660_100362303 Ga0070660_1003623032 182
205 3300005344 Ga0070661_100107386 Ga0070661_1001073862 182
206 3300005344 Ga0070661_100143189 Ga0070661_1001431892 182
207 3300005344 Ga0070661_100445685 Ga0070661_1004456852 182
208 3300005355 Ga0070671_100024124 Ga0070671_1000241245 182
209 3300005364 Ga0070673_100021156 Ga0070673_1000211565 182
210 3300005364 Ga0070673_100119368 Ga0070673_1001193682 182
211 3300005366 Ga0070659_100109335 Ga0070659_1001093351 182
212 3300005455 Ga0070663_100188505 Ga0070663_1001885052 182
213 3300005458 Ga0070681_10055637 Ga0070681_100556374 182
214 3300005458 Ga0070681_10095440 Ga0070681_100954405 182
215 3300005530 Ga0070679_100114818 Ga0070679_1001148183 182
216 3300005530 Ga0070679_100459731 Ga0070679_1004597312 182
217 3300005539 Ga0068853_100585898 Ga0068853_1005858982 182
218 3300005563 Ga0068855_100108367 Ga0068855_1001083672 182
219 3300005577 Ga0068857_100056156 Ga0068857_1000561565 182
220 3300005578 Ga0068854_100092771 Ga0068854_1000927712 182
221 3300005578 Ga0068854_100283166 Ga0068854_1002831662 182
222 3300005614 Ga0068856_100076487 Ga0068856_1000764872 182
223 3300005614 Ga0068856_100253572 Ga0068856_1002535722 182
224 3300005616 Ga0068852_100014278 Ga0068852_1000142782 182
225 3300005618 Ga0068864_100079634 Ga0068864_1000796343 182
226 3300005841 Ga0068863_100463895 Ga0068863_1004638952 182
227 3300009093 Ga0105240_10033909 Ga0105240_100339095 182
228 3300009177 Ga0105248_10080318 Ga0105248_100803185 182
229 3300009551 Ga0105238_10203108 Ga0105238_102031082 182
230 3300013102 Ga0157371_10141588 Ga0157371_101415883 182
231 3300013104 Ga0157370_10036611 Ga0157370_100366112 182
232 3300013105 Ga0157369_10435352 Ga0157369_104353522 182
233 3300013296 Ga0157374_10305203 Ga0157374_103052032 182
234 3300013307 Ga0157372_10157384 Ga0157372_101573843 182
235 3300013307 Ga0157372_11032218 Ga0157372_110322182 182
236 3300020069 Ga0197907_10131162 Ga0197907_101311622 182
237 3300020070 Ga0206356_10638507 Ga0206356_106385072 182
238 3300020082 Ga0206353_10771127 Ga0206353_107711273 182
239 3300025909 Ga0207705_10093713 Ga0207705_100937132 182
240 3300025909 Ga0207705_10207757 Ga0207705_102077572 182
241 3300025909 Ga0207705_10614119 Ga0207705_106141192 182
242 3300025912 Ga0207707_10087980 Ga0207707_100879803 182
243 3300025912 Ga0207707_10242596 Ga0207707_102425962 182
244 3300025913 Ga0207695_10267113 Ga0207695_102671132 182
245 3300025917 Ga0207660_10013631 Ga0207660_100136313 182
246 3300025919 Ga0207657_10342707 Ga0207657_103427071 182
247 3300025920 Ga0207649_10068334 Ga0207649_100683343 182
248 3300025920 Ga0207649_10802675 Ga0207649_108026751 182
249 3300025921 Ga0207652_10460302 Ga0207652_104603022 182
250 3300025924 Ga0207694_10240124 Ga0207694_102401242 182
251 3300025931 Ga0207644_10512320 Ga0207644_105123202 182
252 3300025932 Ga0207690_10323019 Ga0207690_103230192 182
253 3300025933 Ga0207706_10018956 Ga0207706_100189569 182
254 3300025933 Ga0207706_10210020 Ga0207706_102100202 182
255 3300025941 Ga0207711_10163676 Ga0207711_101636762 182
256 3300025945 Ga0207679_10115167 Ga0207679_101151672 182
257 3300025960 Ga0207651_10056068 Ga0207651_100560683 182
258 3300025981 Ga0207640_10081611 Ga0207640_100816112 182
259 3300025981 Ga0207640_10105578 Ga0207640_101055782 182
260 3300025986 Ga0207658_10048164 Ga0207658_100481641 182
261 3300026023 Ga0207677_10201871 Ga0207677_102018713 182
262 3300026067 Ga0207678_10038288 Ga0207678_100382883 182
263 3300026078 Ga0207702_10081545 Ga0207702_100815453 182
264 3300026078 Ga0207702_10192120 Ga0207702_101921202 182
265 3300026078 Ga0207702_10246616 Ga0207702_102466162 182
266 3300026088 Ga0207641_10732151 Ga0207641_107321512 182
267 3300026142 Ga0207698_10012706 Ga0207698_100127067 182
268 3300037312 Ga0395899_0002361 Ga0395899_0002361_3246_3830 182
269 3300037418 Ga0395900_0022846 Ga0395900_0022846_4815_5399 182
270 3300037466 Ga0395898_0001152 Ga0395898_0001152_1454_2038 182
271 3300037471 Ga0395905_0004189 Ga0395905_0004189_12604_13188 182
272 3300037471 Ga0395905_0085869 Ga0395905_0085869_853_1437 182
273 3300037471 Ga0395905_0102836 Ga0395905_0102836_1784_2368 182
274 3300037471 Ga0395905_0602337 Ga0395905_0602337_11_595 182
275 3300038443 Ga0395901_0000386 Ga0395901_0000386_13758_14342 182
276 3300038443 Ga0395901_0016429 Ga0395901_0016429_103_687 182
277 3300038443 Ga0395901_0054384 Ga0395901_0054384_1088_1672 182
278 3300038443 Ga0395901_0652408 Ga0395901_0652408_426_1010 182
279 3300044719 Ga0466971_0253748 Ga0466971_0253748_66_650 182
280 3300046684 Ga0495669_0232603 Ga0495669_0232603_243_827 182
281 3300048903 Ga0496100_0324469 Ga0496100_0324469_180_764 182
282 3300048904 Ga0496101_0030116 Ga0496101_0030116_3119_3703 182
283 3300048909 Ga0496106_0007667 Ga0496106_0007667_2747_3331 182
284 3300048910 Ga0496107_0023077 Ga0496107_0023077_2189_2773 182
285 3300048912 Ga0496109_0332100 Ga0496109_0332100_288_872 182
286 3300048913 Ga0496110_0426821 Ga0496110_0426821_349_933 182
287 3300048914 Ga0496111_0053156 Ga0496111_0053156_1549_2133 182
288 3300048915 Ga0496112_0157429 Ga0496112_0157429_507_1091 182
289 3300048916 Ga0496113_0009478 Ga0496113_0009478_3121_3705 182
290 3300005339 Ga0070660_100012581 Ga0070660_1000125812 185
291 3300005366 Ga0070659_100024807 Ga0070659_1000248074 185
292 3300005366 Ga0070659_100612121 Ga0070659_1006121212 185
293 3300005457 Ga0070662_100141986 Ga0070662_1001419862 185
294 3300005458 Ga0070681_10403644 Ga0070681_104036442 185
295 3300005530 Ga0070679_100036031 Ga0070679_1000360312 185
296 3300005539 Ga0068853_100194445 Ga0068853_1001944453 185
297 3300005616 Ga0068852_100156943 Ga0068852_1001569432 185
298 3300006195 Ga0075366_10193641 Ga0075366_101936412 185
299 3300013100 Ga0157373_10040242 Ga0157373_100402422 185
300 3300013102 Ga0157371_10033553 Ga0157371_100335532 185
301 3300013105 Ga0157369_10083675 Ga0157369_100836752 185
302 3300013307 Ga0157372_10790060 Ga0157372_107900602 185
303 3300025904 Ga0207647_10078464 Ga0207647_100784642 185
304 3300025909 Ga0207705_10043292 Ga0207705_100432922 185
305 3300025919 Ga0207657_10035759 Ga0207657_100357592 185
306 3300025932 Ga0207690_10001815 Ga0207690_1000181512 185
307 3300025933 Ga0207706_10033695 Ga0207706_100336953 185
308 3300026041 Ga0207639_10240461 Ga0207639_102404613 185
309 3300026142 Ga0207698_10253809 Ga0207698_102538092 185
310 3300037312 Ga0395899_0003237 Ga0395899_0003237_4786_5379 185
311 3300037418 Ga0395900_0017379 Ga0395900_0017379_4787_5380 185
312 3300037418 Ga0395900_0979199 Ga0395900_0979199_120_713 185
313 3300037466 Ga0395898_0011941 Ga0395898_0011941_4100_4693 185
314 3300037471 Ga0395905_0032222 Ga0395905_0032222_240_833 185
315 3300038443 Ga0395901_0014797 Ga0395901_0014797_3237_3830 185
316 3300042157 Ga0439458_0000497 Ga0439458_0000497_7472_8065 185
317 3300044658 Ga0466972_0092840 Ga0466972_0092840_62_655 185
318 3300044684 Ga0466966_0464416 Ga0466966_0464416_101_694 185
319 3300044842 Ga0466957_0259257 Ga0466957_0259257_422_1015 185
320 3300045836 Ga0466958_0162478 Ga0466958_0162478_455_1048 185
321 3300045976 Ga0466967_0050475 Ga0466967_0050475_948_1541 185
322 3300001979 JGI24740J21852_10006328 JGI24740J21852_100063286 192
323 3300031911 Ga0307412_10305366 Ga0307412_103053661 192
324 3300032005 Ga0307411_10511207 Ga0307411_105112072 192
325 3300044693 Ga0466961_0033665 Ga0466961_0033665_2491_3123 192
326 3300044842 Ga0466957_0179443 Ga0466957_0179443_98_730 192
327 3300049656 Ga0501209_116736 Ga0501209_116736_109_738 192
328 3300049767 Ga0501270_042601 Ga0501270_042601_75_704 192
329 3300061719 Ga0466962_0008867 Ga0466962_0008867_3152_3784 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

49

175

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbw-assembly1.cif.gz_A-2 crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1 0.8004 149 167
7b7n-assembly1.cif.gz_E human herpesvirus-8 gh/gl in complex with epha2 0.7872 149 167
7czf-assembly1.cif.gz_A crystal structure of kaposi sarcoma associated herpesvirus (kshv ) ghgl in complex with the ligand binding domian (lbd) of epha2 0.7701 149 167
1nqy-assembly1.cif.gz_A the structure of a coa pyrophosphatase from d. radiodurans 0.7511 39 186
3hei-assembly6.cif.gz_K ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex 0.7486 149 167
ID Description Score Start End Superfamily
af_P03010_1_491_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8456 150 175 3.30.420.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8121 32 186 3.90.79.10
af_Q58528_66_303_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7518 147 170 1.50.10.10
1nqyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7511 39 186 3.90.79.10
af_Q4V6M1_1_140_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.751 44 142 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A444K3B7-F1-model_v4 CoA pyrophosphatase 0.9205 79 191 GO:0010945
AF-A0A3B9B2E9-F1-model_v4 deleted 0.9086 74 191
AF-W1XMY3-F1-model_v4 Nudix hydrolase domain-containing protein 0.9064 78 177 GO:0010945
AF-A0A4U9W345-F1-model_v4 Putative NUDIX hydrolase 0.9015 76 175 GO:0010945
AF-A0A3D2LDV5-F1-model_v4 deleted 0.9 91 191

Feature Viewer

pLDDT pTM Quality
68.09 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map