F409704
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 329 | 194 | 328 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10113393|Ga0207661_101133931 |
| Length | 267 |
| Sequence | MCLVAPLIDLFRFASVDVTTHAVAVIPDAETVAVITDVHANLPALEAALARIDELGIARVYCGGDLVGYGPHPNEVCALIAERGIPTIYGNYDYAIARDLDDCGCAYITAHDRELGQQSVIWTLAHTDAGSKAFLRELAFDLRFSVGATGVHLVHGSPRKVNEYLFEDKPASLYERLAAAESDRVLVFGHTHKPWVREYGGVLFVNCGSVGKPKDGDSRGAFAILTATQTGVEVTIERVEYDAEAVAREVAASGLPAEYADKLLAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 158 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 8.51 |
| Rhizosphere | 89.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1561607 | 2162886007 | Bacteria | 1782 |
| 2 | SwRhRL2b_contig_2107601 | 2162886007 | Bacteria | 3149 |
| 3 | JGI25407J50210_10011530 | 3300003373 | Bacteria | 2260 |
| 4 | JGI25407J50210_10027364 | 3300003373 | Bacteria | 1478 |
| 5 | Ga0065704_10090814 | 3300005289 | Bacteria | 2761 |
| 6 | Ga0070683_100002447 | 3300005329 | Bacteria | 14774 |
| 7 | Ga0068869_100466992 | 3300005334 | Bacteria | 1049 |
| 8 | Ga0070682_100021448 | 3300005337 | Bacteria | 3812 |
| 9 | Ga0068868_100017751 | 3300005338 | Bacteria | 5307 |
| 10 | Ga0068868_100106993 | 3300005338 | Bacteria | 2269 |
| 11 | Ga0070691_10086620 | 3300005341 | Bacteria | 1540 |
| 12 | Ga0070668_100147630 | 3300005347 | Bacteria | 1899 |
| 13 | Ga0070668_100169826 | 3300005347 | Bacteria | 1775 |
| 14 | Ga0070675_100028969 | 3300005354 | Bacteria | 4462 |
| 15 | Ga0070659_100043178 | 3300005366 | Bacteria | 3526 |
| 16 | Ga0070667_100769747 | 3300005367 | Bacteria | 893 |
| 17 | Ga0070714_100318058 | 3300005435 | Bacteria | 1455 |
| 18 | Ga0070710_10061184 | 3300005437 | Bacteria | 2144 |
| 19 | Ga0070710_10234009 | 3300005437 | Bacteria | 1174 |
| 20 | Ga0070700_100081711 | 3300005441 | Bacteria | 2088 |
| 21 | Ga0070663_100127951 | 3300005455 | Bacteria | 1926 |
| 22 | Ga0070678_100109670 | 3300005456 | Bacteria | 2157 |
| 23 | Ga0070662_100350335 | 3300005457 | Bacteria | 1210 |
| 24 | Ga0070707_100261159 | 3300005468 | Bacteria | 1685 |
| 25 | Ga0070679_100681216 | 3300005530 | Bacteria | 971 |
| 26 | Ga0070684_100059444 | 3300005535 | Bacteria | 3342 |
| 27 | Ga0070684_100483672 | 3300005535 | Bacteria | 1146 |
| 28 | Ga0068853_100355298 | 3300005539 | Bacteria | 1364 |
| 29 | Ga0068853_100724004 | 3300005539 | Bacteria | 950 |
| 30 | Ga0070672_100624293 | 3300005543 | Bacteria | 940 |
| 31 | Ga0070665_100064533 | 3300005548 | Bacteria | 3673 |
| 32 | Ga0070665_100136066 | 3300005548 | Bacteria | 2460 |
| 33 | Ga0068856_100036475 | 3300005614 | Bacteria | 4820 |
| 34 | Ga0070702_100009158 | 3300005615 | Bacteria | 4831 |
| 35 | Ga0068864_100004551 | 3300005618 | Bacteria | 11385 |
| 36 | Ga0068861_100037255 | 3300005719 | Bacteria | 3615 |
| 37 | Ga0068861_100795557 | 3300005719 | Bacteria | 887 |
| 38 | Ga0068863_100386488 | 3300005841 | Bacteria | 1367 |
| 39 | Ga0068858_100154194 | 3300005842 | Bacteria | 2161 |
| 40 | Ga0068860_100986410 | 3300005843 | Bacteria | 860 |
| 41 | Ga0068862_100021830 | 3300005844 | Bacteria | 5354 |
| 42 | Ga0081455_10003758 | 3300005937 | Bacteria | 17335 |
| 43 | Ga0081455_10259521 | 3300005937 | Bacteria | 1266 |
| 44 | Ga0081538_10000391 | 3300005981 | Bacteria | 49818 |
| 45 | Ga0081538_10000700 | 3300005981 | Bacteria | 36835 |
| 46 | Ga0081538_10001042 | 3300005981 | Bacteria | 29561 |
| 47 | Ga0081538_10002361 | 3300005981 | Bacteria | 18551 |
| 48 | Ga0081538_10010362 | 3300005981 | Bacteria | 7647 |
| 49 | Ga0081538_10014118 | 3300005981 | Bacteria | 6276 |
| 50 | Ga0081538_10070880 | 3300005981 | Bacteria | 1921 |
| 51 | Ga0081539_10013216 | 3300005985 | Bacteria | 6245 |
| 52 | Ga0075432_10031466 | 3300006058 | Bacteria | 1837 |
| 53 | Ga0070716_100110409 | 3300006173 | Bacteria | 1703 |
| 54 | Ga0070712_100009980 | 3300006175 | Bacteria | 5985 |
| 55 | Ga0070712_100030243 | 3300006175 | Bacteria | 3638 |
| 56 | Ga0070712_100168462 | 3300006175 | Bacteria | 1697 |
| 57 | Ga0075428_100126844 | 3300006844 | Bacteria | 2777 |
| 58 | Ga0075431_100020305 | 3300006847 | Bacteria | 6785 |
| 59 | Ga0075434_100123029 | 3300006871 | Bacteria | 2610 |
| 60 | Ga0075434_100206152 | 3300006871 | Bacteria | 1986 |
| 61 | Ga0068865_100055468 | 3300006881 | Bacteria | 2757 |
| 62 | Ga0068865_100113836 | 3300006881 | Bacteria | 2000 |
| 63 | Ga0075436_100154156 | 3300006914 | Unclassified | 1617 |
| 64 | Ga0111539_10056477 | 3300009094 | Bacteria | 4665 |
| 65 | Ga0111539_10081648 | 3300009094 | Bacteria | 3802 |
| 66 | Ga0111539_10145661 | 3300009094 | Bacteria | 2773 |
| 67 | Ga0105245_10020165 | 3300009098 | Bacteria | 5843 |
| 68 | Ga0105245_10316746 | 3300009098 | Archaea | 1535 |
| 69 | Ga0114129_10203746 | 3300009147 | Bacteria | 2678 |
| 70 | Ga0114129_10492555 | 3300009147 | Bacteria | 1602 |
| 71 | Ga0105243_10000006 | 3300009148 | Bacteria | 465541 |
| 72 | Ga0105243_10015197 | 3300009148 | Bacteria | 5827 |
| 73 | Ga0105241_10108344 | 3300009174 | Bacteria | 2220 |
| 74 | Ga0105242_10153008 | 3300009176 | Bacteria | 2013 |
| 75 | Ga0105242_10288086 | 3300009176 | Bacteria | 1494 |
| 76 | Ga0105248_10198120 | 3300009177 | Bacteria | 2263 |
| 77 | Ga0105237_10000657 | 3300009545 | Bacteria | 47992 |
| 78 | Ga0105237_10623440 | 3300009545 | Bacteria | 1085 |
| 79 | Ga0105238_10241515 | 3300009551 | Bacteria | 1784 |
| 80 | Ga0105249_10027597 | 3300009553 | Bacteria | 5123 |
| 81 | Ga0105249_10053091 | 3300009553 | Bacteria | 3704 |
| 82 | Ga0105249_10308339 | 3300009553 | Bacteria | 1590 |
| 83 | Ga0105249_10907389 | 3300009553 | Bacteria | 948 |
| 84 | Ga0105239_10024017 | 3300010375 | Bacteria | 6715 |
| 85 | Ga0105239_10071903 | 3300010375 | Bacteria | 3801 |
| 86 | Ga0105246_10015182 | 3300011119 | Bacteria | 4858 |
| 87 | Ga0157369_10533448 | 3300013105 | Bacteria | 1214 |
| 88 | Ga0163162_10015840 | 3300013306 | Bacteria | 7368 |
| 89 | Ga0157372_10128444 | 3300013307 | Bacteria | 2915 |
| 90 | Ga0157372_10194529 | 3300013307 | Bacteria | 2349 |
| 91 | Ga0157372_10541446 | 3300013307 | Bacteria | 1357 |
| 92 | Ga0157372_10615321 | 3300013307 | Bacteria | 1266 |
| 93 | Ga0157372_10788554 | 3300013307 | Bacteria | 1104 |
| 94 | Ga0157375_10264449 | 3300013308 | Bacteria | 1882 |
| 95 | Ga0163163_10162604 | 3300014325 | Bacteria | 2278 |
| 96 | Ga0157380_10507022 | 3300014326 | Bacteria | 1173 |
| 97 | Ga0157377_10052627 | 3300014745 | Bacteria | 2299 |
| 98 | Ga0157377_10215060 | 3300014745 | Bacteria | 1228 |
| 99 | Ga0157379_10301602 | 3300014968 | Bacteria | 1460 |
| 100 | Ga0213875_10047562 | 3300021388 | Bacteria | 2013 |
| 101 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 102 | Ga0207692_10134854 | 3300025898 | Bacteria | 1398 |
| 103 | Ga0207642_10009991 | 3300025899 | Bacteria | 3325 |
| 104 | Ga0207688_10045551 | 3300025901 | Bacteria | 2447 |
| 105 | Ga0207671_10000926 | 3300025914 | Bacteria | 36838 |
| 106 | Ga0207693_10029817 | 3300025915 | Bacteria | 4306 |
| 107 | Ga0207693_10086580 | 3300025915 | Bacteria | 2455 |
| 108 | Ga0207693_10206767 | 3300025915 | Bacteria | 1543 |
| 109 | Ga0207660_10438950 | 3300025917 | Bacteria | 1055 |
| 110 | Ga0207662_10173207 | 3300025918 | Bacteria | 1385 |
| 111 | Ga0207646_10273062 | 3300025922 | Bacteria | 1528 |
| 112 | Ga0207687_10086272 | 3300025927 | Bacteria | 2279 |
| 113 | Ga0207687_10154207 | 3300025927 | Bacteria | 1756 |
| 114 | Ga0207687_10221459 | 3300025927 | Archaea | 1490 |
| 115 | Ga0207687_10454875 | 3300025927 | Bacteria | 1062 |
| 116 | Ga0207664_10455106 | 3300025929 | Bacteria | 1143 |
| 117 | Ga0207690_10210742 | 3300025932 | Bacteria | 1481 |
| 118 | Ga0207706_10017699 | 3300025933 | Bacteria | 6420 |
| 119 | Ga0207706_10236559 | 3300025933 | Bacteria | 1597 |
| 120 | Ga0207686_10151692 | 3300025934 | Bacteria | 1614 |
| 121 | Ga0207709_10000007 | 3300025935 | Bacteria | 752025 |
| 122 | Ga0207709_10009725 | 3300025935 | Bacteria | 5298 |
| 123 | Ga0207670_10375066 | 3300025936 | Unclassified | 1132 |
| 124 | Ga0207704_10073723 | 3300025938 | Bacteria | 2175 |
| 125 | Ga0207665_10489233 | 3300025939 | Bacteria | 949 |
| 126 | Ga0207691_10648021 | 3300025940 | Bacteria | 893 |
| 127 | Ga0207689_10215382 | 3300025942 | Bacteria | 1587 |
| 128 | Ga0207661_10036293 | 3300025944 | Bacteria | 3846 |
| 129 | Ga0207661_10113393 | 3300025944 | Bacteria | 2297 |
| 130 | Ga0207661_10251726 | 3300025944 | Bacteria | 1570 |
| 131 | Ga0207679_10247430 | 3300025945 | Bacteria | 1514 |
| 132 | Ga0207651_10275389 | 3300025960 | Bacteria | 1388 |
| 133 | Ga0207668_10242192 | 3300025972 | Bacteria | 1460 |
| 134 | Ga0207668_10573558 | 3300025972 | Bacteria | 980 |
| 135 | Ga0207640_10007054 | 3300025981 | Bacteria | 6187 |
| 136 | Ga0207658_10341333 | 3300025986 | Bacteria | 1302 |
| 137 | Ga0207658_10705537 | 3300025986 | Bacteria | 912 |
| 138 | Ga0207677_10040228 | 3300026023 | Bacteria | 3080 |
| 139 | Ga0207703_10690786 | 3300026035 | Bacteria | 970 |
| 140 | Ga0207639_10614526 | 3300026041 | Bacteria | 1003 |
| 141 | Ga0207708_10000271 | 3300026075 | Bacteria | 40456 |
| 142 | Ga0207702_10150964 | 3300026078 | Bacteria | 2113 |
| 143 | Ga0207648_10039960 | 3300026089 | Bacteria | 4123 |
| 144 | Ga0207648_10192125 | 3300026089 | Bacteria | 1810 |
| 145 | Ga0207676_10038215 | 3300026095 | Bacteria | 3662 |
| 146 | Ga0207675_100001271 | 3300026118 | Bacteria | 25231 |
| 147 | Ga0207675_100533098 | 3300026118 | Bacteria | 1172 |
| 148 | Ga0207683_10029961 | 3300026121 | Bacteria | 4713 |
| 149 | Ga0207698_10587128 | 3300026142 | Bacteria | 1097 |
| 150 | Ga0207428_10039285 | 3300027907 | Bacteria | 3843 |
| 151 | Ga0268266_10048879 | 3300028379 | Bacteria | 3626 |
| 152 | Ga0268266_10425510 | 3300028379 | Bacteria | 1259 |
| 153 | Ga0268266_10911346 | 3300028379 | Bacteria | 850 |
| 154 | Ga0265337_1000793 | 3300028556 | Bacteria | 16632 |
| 155 | Ga0265326_10000759 | 3300028558 | Bacteria | 11938 |
| 156 | Ga0265319_1000062 | 3300028563 | Bacteria | 85615 |
| 157 | Ga0265319_1000711 | 3300028563 | Bacteria | 21750 |
| 158 | Ga0265319_1009092 | 3300028563 | Bacteria | 4273 |
| 159 | Ga0265318_10001005 | 3300028577 | Bacteria | 18023 |
| 160 | Ga0265318_10006420 | 3300028577 | Bacteria | 5416 |
| 161 | Ga0265336_10000002 | 3300028666 | Bacteria | 830172 |
| 162 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 163 | Ga0265338_10044366 | 3300028800 | Bacteria | 4107 |
| 164 | Ga0265324_10002017 | 3300029957 | Bacteria | 10814 |
| 165 | Ga0265320_10018550 | 3300031240 | Bacteria | 3827 |
| 166 | Ga0265325_10139196 | 3300031241 | Bacteria | 1156 |
| 167 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 168 | Ga0265339_10058266 | 3300031249 | Bacteria | 2086 |
| 169 | Ga0265327_10145429 | 3300031251 | Bacteria | 1105 |
| 170 | Ga0265316_10106406 | 3300031344 | Bacteria | 2127 |
| 171 | Ga0265316_10119166 | 3300031344 | Bacteria | 1994 |
| 172 | Ga0265313_10026603 | 3300031595 | Bacteria | 3044 |
| 173 | Ga0265314_10025765 | 3300031711 | Bacteria | 4430 |
| 174 | Ga0307413_10084506 | 3300031824 | Bacteria | 2046 |
| 175 | Ga0307410_10035101 | 3300031852 | Bacteria | 3254 |
| 176 | Ga0307406_10088844 | 3300031901 | Bacteria | 2074 |
| 177 | Ga0307407_10031031 | 3300031903 | Bacteria | 2890 |
| 178 | Ga0307409_100212248 | 3300031995 | Bacteria | 1740 |
| 179 | Ga0307416_100046330 | 3300032002 | Bacteria | 3430 |
| 180 | Ga0307416_100225973 | 3300032002 | Bacteria | 1800 |
| 181 | Ga0307415_100082568 | 3300032126 | Bacteria | 2299 |
| 182 | Ga0307415_100255686 | 3300032126 | Bacteria | 1426 |
| 183 | Ga0316574_0018830 | 3300035398 | Bacteria | 4065 |
| 184 | Ga0316584_0125831 | 3300036712 | Bacteria | 1914 |
| 185 | Ga0373925_0086623 | 3300037068 | Bacteria | 2390 |
| 186 | Ga0395899_0002789 | 3300037312 | Bacteria | 14079 |
| 187 | Ga0395899_0030276 | 3300037312 | Bacteria | 4071 |
| 188 | Ga0395899_0045455 | 3300037312 | Bacteria | 3272 |
| 189 | Ga0395899_0125075 | 3300037312 | Bacteria | 1839 |
| 190 | Ga0395900_0002952 | 3300037418 | Bacteria | 18521 |
| 191 | Ga0395900_0009689 | 3300037418 | Bacteria | 9869 |
| 192 | Ga0395900_0037133 | 3300037418 | Bacteria | 5024 |
| 193 | Ga0395900_0052064 | 3300037418 | Bacteria | 4215 |
| 194 | Ga0395900_0098752 | 3300037418 | Bacteria | 3000 |
| 195 | Ga0395900_0181729 | 3300037418 | Bacteria | 2137 |
| 196 | Ga0395900_0399874 | 3300037418 | Bacteria | 1338 |
| 197 | Ga0395900_0406386 | 3300037418 | Unclassified | 1325 |
| 198 | Ga0395900_0425465 | 3300037418 | Bacteria | 1288 |
| 199 | Ga0395898_0001341 | 3300037466 | Bacteria | 35566 |
| 200 | Ga0395898_0004911 | 3300037466 | Bacteria | 14516 |
| 201 | Ga0395898_0005316 | 3300037466 | Bacteria | 13920 |
| 202 | Ga0395898_0009706 | 3300037466 | Bacteria | 10093 |
| 203 | Ga0395898_0054752 | 3300037466 | Bacteria | 3892 |
| 204 | Ga0395898_0058361 | 3300037466 | Bacteria | 3757 |
| 205 | Ga0395898_0061889 | 3300037466 | Bacteria | 3636 |
| 206 | Ga0395898_0089579 | 3300037466 | Bacteria | 2961 |
| 207 | Ga0395898_0162095 | 3300037466 | Bacteria | 2139 |
| 208 | Ga0395898_0211511 | 3300037466 | Bacteria | 1850 |
| 209 | Ga0395898_0242324 | 3300037466 | Bacteria | 1720 |
| 210 | Ga0395898_0250656 | 3300037466 | Bacteria | 1688 |
| 211 | Ga0395898_0317536 | 3300037466 | Bacteria | 1486 |
| 212 | Ga0395898_0341992 | 3300037466 | Bacteria | 1427 |
| 213 | Ga0395898_0350756 | 3300037466 | Bacteria | 1407 |
| 214 | Ga0395898_0467918 | 3300037466 | Bacteria | 1200 |
| 215 | Ga0395905_0003142 | 3300037471 | Bacteria | 17794 |
| 216 | Ga0395905_0003391 | 3300037471 | Bacteria | 17054 |
| 217 | Ga0395905_0005729 | 3300037471 | Bacteria | 12632 |
| 218 | Ga0395905_0008408 | 3300037471 | Bacteria | 10176 |
| 219 | Ga0395905_0125442 | 3300037471 | Bacteria | 2414 |
| 220 | Ga0395905_0140022 | 3300037471 | Bacteria | 2276 |
| 221 | Ga0395905_0852637 | 3300037471 | Bacteria | 814 |
| 222 | Ga0436364_0894386 | 3300037853 | Bacteria | 1568 |
| 223 | Ga0395901_0001828 | 3300038443 | Bacteria | 21979 |
| 224 | Ga0395901_0002458 | 3300038443 | Bacteria | 18787 |
| 225 | Ga0395901_0004024 | 3300038443 | Bacteria | 14804 |
| 226 | Ga0395901_0008767 | 3300038443 | Bacteria | 10231 |
| 227 | Ga0395901_0020861 | 3300038443 | Bacteria | 6710 |
| 228 | Ga0395901_0026868 | 3300038443 | Bacteria | 5910 |
| 229 | Ga0395901_0042505 | 3300038443 | Bacteria | 4712 |
| 230 | Ga0395901_0073382 | 3300038443 | Bacteria | 3569 |
| 231 | Ga0395901_0077751 | 3300038443 | Bacteria | 3463 |
| 232 | Ga0395901_0132425 | 3300038443 | Bacteria | 2620 |
| 233 | Ga0395901_0181090 | 3300038443 | Bacteria | 2210 |
| 234 | Ga0395901_0236684 | 3300038443 | Bacteria | 1905 |
| 235 | Ga0395901_0268496 | 3300038443 | Unclassified | 1775 |
| 236 | Ga0395901_0313103 | 3300038443 | Bacteria | 1625 |
| 237 | Ga0395901_0314197 | 3300038443 | Unclassified | 1622 |
| 238 | Ga0395901_0414225 | 3300038443 | Bacteria | 1383 |
| 239 | Ga0395901_1001442 | 3300038443 | Bacteria | 811 |
| 240 | Ga0439460_0035035 | 3300042461 | Bacteria | 1450 |
| 241 | Ga0466959_0123009 | 3300045049 | Unclassified | 1843 |
| 242 | Ga0495592_0095484 | 3300046454 | Bacteria | 2126 |
| 243 | Ga0495592_0100343 | 3300046454 | Bacteria | 2064 |
| 244 | Ga0495664_0076467 | 3300046477 | Bacteria | 2004 |
| 245 | Ga0495630_0068062 | 3300046517 | Bacteria | 2677 |
| 246 | Ga0495665_0160337 | 3300046531 | Bacteria | 1172 |
| 247 | Ga0495625_0000787 | 3300046660 | Bacteria | 43981 |
| 248 | Ga0495676_0059428 | 3300047321 | Bacteria | 3002 |
| 249 | Ga0496100_0013794 | 3300048903 | Bacteria | 4675 |
| 250 | Ga0496100_0033861 | 3300048903 | Bacteria | 3200 |
| 251 | Ga0496101_0269366 | 3300048904 | Bacteria | 1329 |
| 252 | Ga0496102_0133289 | 3300048905 | Bacteria | 2327 |
| 253 | Ga0496102_0148943 | 3300048905 | Bacteria | 2198 |
| 254 | Ga0496102_0221828 | 3300048905 | Bacteria | 1782 |
| 255 | Ga0496102_0352904 | 3300048905 | Bacteria | 1385 |
| 256 | Ga0496104_0026687 | 3300048907 | Bacteria | 5337 |
| 257 | Ga0496104_0105868 | 3300048907 | Bacteria | 2695 |
| 258 | Ga0496105_0046864 | 3300048908 | Bacteria | 3568 |
| 259 | Ga0496106_0022070 | 3300048909 | Bacteria | 4728 |
| 260 | Ga0496106_0452565 | 3300048909 | Bacteria | 1031 |
| 261 | Ga0496107_0060036 | 3300048910 | Bacteria | 2752 |
| 262 | Ga0496107_0086120 | 3300048910 | Bacteria | 2293 |
| 263 | Ga0496108_0000894 | 3300048911 | Bacteria | 23226 |
| 264 | Ga0496108_0097078 | 3300048911 | Bacteria | 2511 |
| 265 | Ga0496109_0006929 | 3300048912 | Bacteria | 9565 |
| 266 | Ga0496109_0082049 | 3300048912 | Bacteria | 2971 |
| 267 | Ga0496109_0255807 | 3300048912 | Bacteria | 1649 |
| 268 | Ga0496110_0012777 | 3300048913 | Bacteria | 6915 |
| 269 | Ga0496110_0096273 | 3300048913 | Bacteria | 2652 |
| 270 | Ga0496111_0115397 | 3300048914 | Bacteria | 1980 |
| 271 | Ga0496112_0021407 | 3300048915 | Bacteria | 6149 |
| 272 | Ga0496112_0133083 | 3300048915 | Bacteria | 2457 |
| 273 | Ga0496112_0139993 | 3300048915 | Bacteria | 2389 |
| 274 | Ga0496112_0256506 | 3300048915 | Bacteria | 1699 |
| 275 | Ga0496113_0013478 | 3300048916 | Bacteria | 5542 |
| 276 | Ga0496114_0244027 | 3300048917 | Bacteria | 1580 |
| 277 | Ga0496116_0002384 | 3300048919 | Bacteria | 19818 |
| 278 | Ga0496117_0004082 | 3300048920 | Bacteria | 16385 |
| 279 | Ga0496122_0017301 | 3300048925 | Bacteria | 6751 |
| 280 | Ga0496124_0188309 | 3300048927 | Bacteria | 1582 |
| 281 | Ga0496125_0137475 | 3300048928 | Bacteria | 1706 |
| 282 | Ga0501031_0029469 | 3300049568 | Bacteria | 3580 |
| 283 | Ga0501032_0402653 | 3300049569 | Bacteria | 879 |
| 284 | Ga0501037_0204071 | 3300049573 | Bacteria | 1396 |
| 285 | Ga0501039_0101852 | 3300049575 | Bacteria | 2241 |
| 286 | Ga0501039_0175735 | 3300049575 | Bacteria | 1684 |
| 287 | Ga0501040_0041981 | 3300049576 | Bacteria | 3115 |
| 288 | Ga0501041_0038762 | 3300049577 | Bacteria | 2890 |
| 289 | Ga0501042_0014273 | 3300049578 | Bacteria | 5420 |
| 290 | Ga0501043_0191431 | 3300049579 | Bacteria | 1591 |
| 291 | Ga0501048_0112003 | 3300049582 | Bacteria | 1927 |
| 292 | Ga0501048_0178855 | 3300049582 | Bacteria | 1503 |
| 293 | Ga0501048_0220787 | 3300049582 | Bacteria | 1344 |
| 294 | Ga0501068_0239859 | 3300049584 | Bacteria | 1154 |
| 295 | Ga0501069_0423193 | 3300049585 | Bacteria | 790 |
| 296 | Ga0501071_0048246 | 3300049587 | Bacteria | 3062 |
| 297 | Ga0501071_0199057 | 3300049587 | Bacteria | 1504 |
| 298 | Ga0501072_0047356 | 3300049588 | Bacteria | 3386 |
| 299 | Ga0501074_0129317 | 3300049590 | Bacteria | 1807 |
| 300 | Ga0501075_0005673 | 3300049591 | Bacteria | 8542 |
| 301 | Ga0501075_0053010 | 3300049591 | Bacteria | 3050 |
| 302 | Ga0501076_0222410 | 3300049592 | Unclassified | 1543 |
| 303 | Ga0501076_0297231 | 3300049592 | Bacteria | 1323 |
| 304 | Ga0501077_0093611 | 3300049593 | Bacteria | 1905 |
| 305 | Ga0501077_0208712 | 3300049593 | Bacteria | 1241 |
| 306 | Ga0501079_0182602 | 3300049741 | Bacteria | 1637 |
| 307 | Ga0501079_0706335 | 3300049741 | Bacteria | 794 |
| 308 | Ga0501081_0152648 | 3300049743 | Bacteria | 1660 |
| 309 | Ga0501035_0143020 | 3300049822 | Bacteria | 2079 |
| 310 | nmdc:mga05p37_247397_c1 | 3300050507 | Bacteria | 2140 |
| 311 | nmdc:mga06r32_47375_c1 | 3300050510 | Bacteria | 4106 |
| 312 | nmdc:mga08y16_60254_c1 | 3300050511 | Bacteria | 3965 |
| 313 | nmdc:mga0n895_402252_c1 | 3300050512 | Bacteria | 1385 |
| 314 | nmdc:mga0rr50_245943_c1 | 3300050513 | Bacteria | 1484 |
| 315 | nmdc:mga08x19_40189_c1 | 3300050514 | Bacteria | 2976 |
| 316 | nmdc:mga0a205_244245_c1 | 3300050515 | Bacteria | 1676 |
| 317 | Ga0495601_0000363 | 3300053077 | Bacteria | 23921 |
| 318 | Ga0495601_0082194 | 3300053077 | Bacteria | 2068 |
| 319 | Ga0495612_0005746 | 3300053078 | Bacteria | 5124 |
| 320 | Ga0495612_0036566 | 3300053078 | Bacteria | 1993 |
| 321 | Ga0495619_0182537 | 3300053085 | Bacteria | 1452 |
| 322 | Ga0495619_0201928 | 3300053085 | Bacteria | 1376 |
| 323 | Ga0501084_0131246 | 3300054114 | Bacteria | 2109 |
| 324 | Ga0501084_0306934 | 3300054114 | Bacteria | 1340 |
| 325 | Ga0501082_0200923 | 3300060353 | Bacteria | 1734 |
| 326 | Ga0501082_0840540 | 3300060353 | Bacteria | 803 |
| 327 | Ga0530510_0032494 | 3300061734 | Bacteria | 3755 |
| 328 | Ga0530510_0482484 | 3300061734 | Bacteria | 939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0131246 | Ga0501084_0131246_125_742 | 188 |
| 2 | 3300025939 | Ga0207665_10489233 | Ga0207665_104892331 | 215 |
| 3 | 3300005366 | Ga0070659_100043178 | Ga0070659_1000431782 | 223 |
| 4 | 3300025932 | Ga0207690_10210742 | Ga0207690_102107422 | 223 |
| 5 | 3300037418 | Ga0395900_0098752 | Ga0395900_0098752_2255_2974 | 224 |
| 6 | 3300037466 | Ga0395898_0061889 | Ga0395898_0061889_1509_2228 | 224 |
| 7 | 3300038443 | Ga0395901_0073382 | Ga0395901_0073382_2818_3537 | 224 |
| 8 | 3300005468 | Ga0070707_100261159 | Ga0070707_1002611593 | 227 |
| 9 | 3300025922 | Ga0207646_10273062 | Ga0207646_102730622 | 227 |
| 10 | 3300006844 | Ga0075428_100126844 | Ga0075428_1001268441 | 228 |
| 11 | 3300009094 | Ga0111539_10081648 | Ga0111539_100816486 | 228 |
| 12 | 3300009147 | Ga0114129_10203746 | Ga0114129_102037463 | 228 |
| 13 | 3300060353 | Ga0501082_0840540 | Ga0501082_0840540_14_736 | 229 |
| 14 | 3300045049 | Ga0466959_0123009 | Ga0466959_0123009_591_1319 | 232 |
| 15 | 3300005437 | Ga0070710_10234009 | Ga0070710_102340092 | 233 |
| 16 | 3300005530 | Ga0070679_100681216 | Ga0070679_1006812162 | 234 |
| 17 | 3300005719 | Ga0068861_100795557 | Ga0068861_1007955572 | 234 |
| 18 | 3300009098 | Ga0105245_10316746 | Ga0105245_103167462 | 234 |
| 19 | 3300037466 | Ga0395898_0089579 | Ga0395898_0089579_1751_2458 | 234 |
| 20 | 3300037471 | Ga0395905_0852637 | Ga0395905_0852637_95_799 | 234 |
| 21 | 3300037853 | Ga0436364_0894386 | Ga0436364_0894386_285_992 | 234 |
| 22 | 3300038443 | Ga0395901_1001442 | Ga0395901_1001442_56_760 | 234 |
| 23 | 3300049568 | Ga0501031_0029469 | Ga0501031_0029469_38_748 | 235 |
| 24 | 3300049569 | Ga0501032_0402653 | Ga0501032_0402653_113_823 | 235 |
| 25 | 3300049573 | Ga0501037_0204071 | Ga0501037_0204071_528_1238 | 235 |
| 26 | 3300049575 | Ga0501039_0101852 | Ga0501039_0101852_50_760 | 235 |
| 27 | 3300049575 | Ga0501039_0175735 | Ga0501039_0175735_54_764 | 235 |
| 28 | 3300049576 | Ga0501040_0041981 | Ga0501040_0041981_722_1432 | 235 |
| 29 | 3300049577 | Ga0501041_0038762 | Ga0501041_0038762_1225_1935 | 235 |
| 30 | 3300049578 | Ga0501042_0014273 | Ga0501042_0014273_3491_4201 | 235 |
| 31 | 3300049579 | Ga0501043_0191431 | Ga0501043_0191431_142_852 | 235 |
| 32 | 3300049582 | Ga0501048_0112003 | Ga0501048_0112003_99_809 | 235 |
| 33 | 3300049582 | Ga0501048_0178855 | Ga0501048_0178855_55_765 | 235 |
| 34 | 3300049582 | Ga0501048_0220787 | Ga0501048_0220787_582_1292 | 235 |
| 35 | 3300049584 | Ga0501068_0239859 | Ga0501068_0239859_292_1002 | 235 |
| 36 | 3300049585 | Ga0501069_0423193 | Ga0501069_0423193_34_771 | 235 |
| 37 | 3300049587 | Ga0501071_0199057 | Ga0501071_0199057_745_1455 | 235 |
| 38 | 3300049588 | Ga0501072_0047356 | Ga0501072_0047356_187_897 | 235 |
| 39 | 3300049590 | Ga0501074_0129317 | Ga0501074_0129317_564_1274 | 235 |
| 40 | 3300049591 | Ga0501075_0053010 | Ga0501075_0053010_1507_2217 | 235 |
| 41 | 3300049592 | Ga0501076_0297231 | Ga0501076_0297231_215_925 | 235 |
| 42 | 3300049593 | Ga0501077_0093611 | Ga0501077_0093611_1144_1854 | 235 |
| 43 | 3300049593 | Ga0501077_0208712 | Ga0501077_0208712_187_897 | 235 |
| 44 | 3300049741 | Ga0501079_0182602 | Ga0501079_0182602_217_927 | 235 |
| 45 | 3300049743 | Ga0501081_0152648 | Ga0501081_0152648_901_1611 | 235 |
| 46 | 3300054114 | Ga0501084_0306934 | Ga0501084_0306934_324_1034 | 235 |
| 47 | 3300060353 | Ga0501082_0200923 | Ga0501082_0200923_668_1378 | 235 |
| 48 | 3300061734 | Ga0530510_0032494 | Ga0530510_0032494_1951_2661 | 235 |
| 49 | 3300025942 | Ga0207689_10215382 | Ga0207689_102153822 | 236 |
| 50 | 3300037418 | Ga0395900_0425465 | Ga0395900_0425465_27_737 | 236 |
| 51 | 3300005539 | Ga0068853_100724004 | Ga0068853_1007240041 | 237 |
| 52 | 3300005981 | Ga0081538_10014118 | Ga0081538_100141181 | 237 |
| 53 | 3300035398 | Ga0316574_0018830 | Ga0316574_0018830_2210_2926 | 237 |
| 54 | 3300036712 | Ga0316584_0125831 | Ga0316584_0125831_1168_1884 | 237 |
| 55 | 3300037312 | Ga0395899_0030276 | Ga0395899_0030276_3237_3953 | 237 |
| 56 | 3300037418 | Ga0395900_0037133 | Ga0395900_0037133_3518_4234 | 237 |
| 57 | 3300037466 | Ga0395898_0250656 | Ga0395898_0250656_560_1276 | 237 |
| 58 | 3300037471 | Ga0395905_0140022 | Ga0395905_0140022_1180_1896 | 237 |
| 59 | 3300038443 | Ga0395901_0077751 | Ga0395901_0077751_413_1129 | 237 |
| 60 | 3300003373 | JGI25407J50210_10027364 | JGI25407J50210_100273641 | 238 |
| 61 | 3300005535 | Ga0070684_100483672 | Ga0070684_1004836722 | 238 |
| 62 | 3300005548 | Ga0070665_100064533 | Ga0070665_1000645333 | 238 |
| 63 | 3300005841 | Ga0068863_100386488 | Ga0068863_1003864882 | 238 |
| 64 | 3300005937 | Ga0081455_10003758 | Ga0081455_1000375814 | 238 |
| 65 | 3300005981 | Ga0081538_10001042 | Ga0081538_1000104211 | 238 |
| 66 | 3300005981 | Ga0081538_10070880 | Ga0081538_100708803 | 238 |
| 67 | 3300005985 | Ga0081539_10013216 | Ga0081539_100132162 | 238 |
| 68 | 3300006871 | Ga0075434_100206152 | Ga0075434_1002061525 | 238 |
| 69 | 3300009094 | Ga0111539_10145661 | Ga0111539_101456611 | 238 |
| 70 | 3300009553 | Ga0105249_10907389 | Ga0105249_109073891 | 238 |
| 71 | 3300013307 | Ga0157372_10615321 | Ga0157372_106153212 | 238 |
| 72 | 3300013307 | Ga0157372_10788554 | Ga0157372_107885541 | 238 |
| 73 | 3300014325 | Ga0163163_10162604 | Ga0163163_101626041 | 238 |
| 74 | 3300021388 | Ga0213875_10047562 | Ga0213875_100475622 | 238 |
| 75 | 3300025915 | Ga0207693_10206767 | Ga0207693_102067672 | 238 |
| 76 | 3300025927 | Ga0207687_10221459 | Ga0207687_102214592 | 238 |
| 77 | 3300025934 | Ga0207686_10151692 | Ga0207686_101516922 | 238 |
| 78 | 3300026142 | Ga0207698_10587128 | Ga0207698_105871282 | 238 |
| 79 | 3300028379 | Ga0268266_10048879 | Ga0268266_100488794 | 238 |
| 80 | 3300028563 | Ga0265319_1000062 | Ga0265319_10000626 | 238 |
| 81 | 3300028563 | Ga0265319_1000711 | Ga0265319_10007118 | 238 |
| 82 | 3300028577 | Ga0265318_10006420 | Ga0265318_100064204 | 238 |
| 83 | 3300028800 | Ga0265338_10044366 | Ga0265338_100443665 | 238 |
| 84 | 3300031240 | Ga0265320_10018550 | Ga0265320_100185505 | 238 |
| 85 | 3300031241 | Ga0265325_10139196 | Ga0265325_101391962 | 238 |
| 86 | 3300031251 | Ga0265327_10145429 | Ga0265327_101454291 | 238 |
| 87 | 3300031595 | Ga0265313_10026603 | Ga0265313_100266035 | 238 |
| 88 | 3300031711 | Ga0265314_10025765 | Ga0265314_100257653 | 238 |
| 89 | 3300037068 | Ga0373925_0086623 | Ga0373925_0086623_1384_2106 | 238 |
| 90 | 3300037418 | Ga0395900_0052064 | Ga0395900_0052064_2166_2885 | 238 |
| 91 | 3300037418 | Ga0395900_0406386 | Ga0395900_0406386_457_1176 | 238 |
| 92 | 3300037466 | Ga0395898_0009706 | Ga0395898_0009706_333_1052 | 238 |
| 93 | 3300037466 | Ga0395898_0054752 | Ga0395898_0054752_507_1226 | 238 |
| 94 | 3300037466 | Ga0395898_0162095 | Ga0395898_0162095_1063_1782 | 238 |
| 95 | 3300037466 | Ga0395898_0317536 | Ga0395898_0317536_483_1202 | 238 |
| 96 | 3300037466 | Ga0395898_0350756 | Ga0395898_0350756_236_955 | 238 |
| 97 | 3300037466 | Ga0395898_0467918 | Ga0395898_0467918_404_1123 | 238 |
| 98 | 3300037471 | Ga0395905_0003142 | Ga0395905_0003142_8831_9550 | 238 |
| 99 | 3300037471 | Ga0395905_0125442 | Ga0395905_0125442_652_1371 | 238 |
| 100 | 3300038443 | Ga0395901_0001828 | Ga0395901_0001828_12202_12921 | 238 |
| 101 | 3300038443 | Ga0395901_0026868 | Ga0395901_0026868_3970_4689 | 238 |
| 102 | 3300038443 | Ga0395901_0042505 | Ga0395901_0042505_3659_4384 | 238 |
| 103 | 3300038443 | Ga0395901_0181090 | Ga0395901_0181090_1080_1799 | 238 |
| 104 | 3300038443 | Ga0395901_0414225 | Ga0395901_0414225_608_1330 | 238 |
| 105 | 3300046454 | Ga0495592_0095484 | Ga0495592_0095484_1163_1882 | 238 |
| 106 | 3300046477 | Ga0495664_0076467 | Ga0495664_0076467_1199_1918 | 238 |
| 107 | 3300046517 | Ga0495630_0068062 | Ga0495630_0068062_538_1257 | 238 |
| 108 | 3300046531 | Ga0495665_0160337 | Ga0495665_0160337_148_870 | 238 |
| 109 | 3300046660 | Ga0495625_0000787 | Ga0495625_0000787_27903_28622 | 238 |
| 110 | 3300047321 | Ga0495676_0059428 | Ga0495676_0059428_828_1550 | 238 |
| 111 | 3300048903 | Ga0496100_0033861 | Ga0496100_0033861_1117_1836 | 238 |
| 112 | 3300048904 | Ga0496101_0269366 | Ga0496101_0269366_340_1059 | 238 |
| 113 | 3300048905 | Ga0496102_0133289 | Ga0496102_0133289_1025_1744 | 238 |
| 114 | 3300048905 | Ga0496102_0352904 | Ga0496102_0352904_352_1077 | 238 |
| 115 | 3300048907 | Ga0496104_0105868 | Ga0496104_0105868_45_764 | 238 |
| 116 | 3300048908 | Ga0496105_0046864 | Ga0496105_0046864_2154_2873 | 238 |
| 117 | 3300048909 | Ga0496106_0022070 | Ga0496106_0022070_3767_4486 | 238 |
| 118 | 3300048910 | Ga0496107_0060036 | Ga0496107_0060036_1219_1938 | 238 |
| 119 | 3300048911 | Ga0496108_0000894 | Ga0496108_0000894_8394_9113 | 238 |
| 120 | 3300048911 | Ga0496108_0097078 | Ga0496108_0097078_876_1595 | 238 |
| 121 | 3300048912 | Ga0496109_0006929 | Ga0496109_0006929_4471_5190 | 238 |
| 122 | 3300048912 | Ga0496109_0082049 | Ga0496109_0082049_1431_2150 | 238 |
| 123 | 3300048913 | Ga0496110_0012777 | Ga0496110_0012777_2085_2804 | 238 |
| 124 | 3300048914 | Ga0496111_0115397 | Ga0496111_0115397_865_1584 | 238 |
| 125 | 3300048915 | Ga0496112_0133083 | Ga0496112_0133083_1053_1772 | 238 |
| 126 | 3300048915 | Ga0496112_0139993 | Ga0496112_0139993_1295_2014 | 238 |
| 127 | 3300048916 | Ga0496113_0013478 | Ga0496113_0013478_88_807 | 238 |
| 128 | 3300049592 | Ga0501076_0222410 | Ga0501076_0222410_658_1377 | 238 |
| 129 | 3300049741 | Ga0501079_0706335 | Ga0501079_0706335_63_782 | 238 |
| 130 | 3300050515 | nmdc:mga0a205_244245_c1 | nmdc:mga0a205_244245_c1_835_1560 | 238 |
| 131 | 3300053077 | Ga0495601_0082194 | Ga0495601_0082194_925_1644 | 238 |
| 132 | 3300053078 | Ga0495612_0005746 | Ga0495612_0005746_3445_4164 | 238 |
| 133 | 3300053078 | Ga0495612_0036566 | Ga0495612_0036566_901_1623 | 238 |
| 134 | 3300053085 | Ga0495619_0182537 | Ga0495619_0182537_601_1320 | 238 |
| 135 | 3300061734 | Ga0530510_0482484 | Ga0530510_0482484_26_745 | 238 |
| 136 | 3300003373 | JGI25407J50210_10011530 | JGI25407J50210_100115303 | 239 |
| 137 | 3300005329 | Ga0070683_100002447 | Ga0070683_10000244712 | 239 |
| 138 | 3300005334 | Ga0068869_100466992 | Ga0068869_1004669922 | 239 |
| 139 | 3300005337 | Ga0070682_100021448 | Ga0070682_1000214482 | 239 |
| 140 | 3300005338 | Ga0068868_100017751 | Ga0068868_1000177514 | 239 |
| 141 | 3300005338 | Ga0068868_100106993 | Ga0068868_1001069932 | 239 |
| 142 | 3300005341 | Ga0070691_10086620 | Ga0070691_100866202 | 239 |
| 143 | 3300005347 | Ga0070668_100147630 | Ga0070668_1001476302 | 239 |
| 144 | 3300005347 | Ga0070668_100169826 | Ga0070668_1001698261 | 239 |
| 145 | 3300005354 | Ga0070675_100028969 | Ga0070675_1000289694 | 239 |
| 146 | 3300005367 | Ga0070667_100769747 | Ga0070667_1007697471 | 239 |
| 147 | 3300005435 | Ga0070714_100318058 | Ga0070714_1003180581 | 239 |
| 148 | 3300005437 | Ga0070710_10061184 | Ga0070710_100611843 | 239 |
| 149 | 3300005441 | Ga0070700_100081711 | Ga0070700_1000817113 | 239 |
| 150 | 3300005455 | Ga0070663_100127951 | Ga0070663_1001279513 | 239 |
| 151 | 3300005456 | Ga0070678_100109670 | Ga0070678_1001096703 | 239 |
| 152 | 3300005457 | Ga0070662_100350335 | Ga0070662_1003503352 | 239 |
| 153 | 3300005535 | Ga0070684_100059444 | Ga0070684_1000594442 | 239 |
| 154 | 3300005539 | Ga0068853_100355298 | Ga0068853_1003552983 | 239 |
| 155 | 3300005543 | Ga0070672_100624293 | Ga0070672_1006242932 | 239 |
| 156 | 3300005548 | Ga0070665_100136066 | Ga0070665_1001360662 | 239 |
| 157 | 3300005614 | Ga0068856_100036475 | Ga0068856_1000364757 | 239 |
| 158 | 3300005615 | Ga0070702_100009158 | Ga0070702_1000091583 | 239 |
| 159 | 3300005618 | Ga0068864_100004551 | Ga0068864_1000045513 | 239 |
| 160 | 3300005719 | Ga0068861_100037255 | Ga0068861_1000372554 | 239 |
| 161 | 3300005842 | Ga0068858_100154194 | Ga0068858_1001541942 | 239 |
| 162 | 3300005843 | Ga0068860_100986410 | Ga0068860_1009864101 | 239 |
| 163 | 3300005844 | Ga0068862_100021830 | Ga0068862_1000218306 | 239 |
| 164 | 3300005937 | Ga0081455_10259521 | Ga0081455_102595212 | 239 |
| 165 | 3300005981 | Ga0081538_10002361 | Ga0081538_1000236114 | 239 |
| 166 | 3300005981 | Ga0081538_10010362 | Ga0081538_100103623 | 239 |
| 167 | 3300006058 | Ga0075432_10031466 | Ga0075432_100314661 | 239 |
| 168 | 3300006173 | Ga0070716_100110409 | Ga0070716_1001104092 | 239 |
| 169 | 3300006175 | Ga0070712_100009980 | Ga0070712_1000099803 | 239 |
| 170 | 3300006175 | Ga0070712_100030243 | Ga0070712_1000302434 | 239 |
| 171 | 3300006175 | Ga0070712_100168462 | Ga0070712_1001684622 | 239 |
| 172 | 3300006847 | Ga0075431_100020305 | Ga0075431_1000203056 | 239 |
| 173 | 3300006871 | Ga0075434_100123029 | Ga0075434_1001230293 | 239 |
| 174 | 3300006881 | Ga0068865_100055468 | Ga0068865_1000554684 | 239 |
| 175 | 3300006881 | Ga0068865_100113836 | Ga0068865_1001138364 | 239 |
| 176 | 3300006914 | Ga0075436_100154156 | Ga0075436_1001541562 | 239 |
| 177 | 3300009094 | Ga0111539_10056477 | Ga0111539_100564773 | 239 |
| 178 | 3300009098 | Ga0105245_10020165 | Ga0105245_100201654 | 239 |
| 179 | 3300009147 | Ga0114129_10492555 | Ga0114129_104925552 | 239 |
| 180 | 3300009148 | Ga0105243_10015197 | Ga0105243_100151976 | 239 |
| 181 | 3300009174 | Ga0105241_10108344 | Ga0105241_101083442 | 239 |
| 182 | 3300009176 | Ga0105242_10153008 | Ga0105242_101530081 | 239 |
| 183 | 3300009176 | Ga0105242_10288086 | Ga0105242_102880861 | 239 |
| 184 | 3300009177 | Ga0105248_10198120 | Ga0105248_101981204 | 239 |
| 185 | 3300009545 | Ga0105237_10000657 | Ga0105237_1000065724 | 239 |
| 186 | 3300009545 | Ga0105237_10623440 | Ga0105237_106234401 | 239 |
| 187 | 3300009551 | Ga0105238_10241515 | Ga0105238_102415152 | 239 |
| 188 | 3300009553 | Ga0105249_10027597 | Ga0105249_100275973 | 239 |
| 189 | 3300009553 | Ga0105249_10053091 | Ga0105249_100530913 | 239 |
| 190 | 3300009553 | Ga0105249_10308339 | Ga0105249_103083392 | 239 |
| 191 | 3300010375 | Ga0105239_10024017 | Ga0105239_100240175 | 239 |
| 192 | 3300010375 | Ga0105239_10071903 | Ga0105239_100719036 | 239 |
| 193 | 3300011119 | Ga0105246_10015182 | Ga0105246_100151823 | 239 |
| 194 | 3300013105 | Ga0157369_10533448 | Ga0157369_105334482 | 239 |
| 195 | 3300013306 | Ga0163162_10015840 | Ga0163162_100158407 | 239 |
| 196 | 3300013307 | Ga0157372_10128444 | Ga0157372_101284444 | 239 |
| 197 | 3300013307 | Ga0157372_10194529 | Ga0157372_101945293 | 239 |
| 198 | 3300013307 | Ga0157372_10541446 | Ga0157372_105414463 | 239 |
| 199 | 3300013308 | Ga0157375_10264449 | Ga0157375_102644491 | 239 |
| 200 | 3300014326 | Ga0157380_10507022 | Ga0157380_105070221 | 239 |
| 201 | 3300014745 | Ga0157377_10052627 | Ga0157377_100526273 | 239 |
| 202 | 3300014745 | Ga0157377_10215060 | Ga0157377_102150602 | 239 |
| 203 | 3300014968 | Ga0157379_10301602 | Ga0157379_103016022 | 239 |
| 204 | 3300025898 | Ga0207692_10134854 | Ga0207692_101348541 | 239 |
| 205 | 3300025899 | Ga0207642_10009991 | Ga0207642_100099914 | 239 |
| 206 | 3300025901 | Ga0207688_10045551 | Ga0207688_100455513 | 239 |
| 207 | 3300025914 | Ga0207671_10000926 | Ga0207671_1000092618 | 239 |
| 208 | 3300025915 | Ga0207693_10029817 | Ga0207693_100298174 | 239 |
| 209 | 3300025915 | Ga0207693_10086580 | Ga0207693_100865803 | 239 |
| 210 | 3300025917 | Ga0207660_10438950 | Ga0207660_104389502 | 239 |
| 211 | 3300025918 | Ga0207662_10173207 | Ga0207662_101732071 | 239 |
| 212 | 3300025927 | Ga0207687_10086272 | Ga0207687_100862722 | 239 |
| 213 | 3300025927 | Ga0207687_10154207 | Ga0207687_101542071 | 239 |
| 214 | 3300025927 | Ga0207687_10454875 | Ga0207687_104548751 | 239 |
| 215 | 3300025929 | Ga0207664_10455106 | Ga0207664_104551062 | 239 |
| 216 | 3300025933 | Ga0207706_10017699 | Ga0207706_100176992 | 239 |
| 217 | 3300025933 | Ga0207706_10236559 | Ga0207706_102365592 | 239 |
| 218 | 3300025935 | Ga0207709_10009725 | Ga0207709_100097252 | 239 |
| 219 | 3300025936 | Ga0207670_10375066 | Ga0207670_103750661 | 239 |
| 220 | 3300025938 | Ga0207704_10073723 | Ga0207704_100737231 | 239 |
| 221 | 3300025940 | Ga0207691_10648021 | Ga0207691_106480211 | 239 |
| 222 | 3300025944 | Ga0207661_10036293 | Ga0207661_100362936 | 239 |
| 223 | 3300025944 | Ga0207661_10113393 | Ga0207661_101133931 | 239 |
| 224 | 3300025944 | Ga0207661_10251726 | Ga0207661_102517263 | 239 |
| 225 | 3300025945 | Ga0207679_10247430 | Ga0207679_102474303 | 239 |
| 226 | 3300025960 | Ga0207651_10275389 | Ga0207651_102753892 | 239 |
| 227 | 3300025972 | Ga0207668_10242192 | Ga0207668_102421923 | 239 |
| 228 | 3300025972 | Ga0207668_10573558 | Ga0207668_105735582 | 239 |
| 229 | 3300025981 | Ga0207640_10007054 | Ga0207640_100070547 | 239 |
| 230 | 3300025986 | Ga0207658_10341333 | Ga0207658_103413331 | 239 |
| 231 | 3300025986 | Ga0207658_10705537 | Ga0207658_107055371 | 239 |
| 232 | 3300026023 | Ga0207677_10040228 | Ga0207677_100402283 | 239 |
| 233 | 3300026035 | Ga0207703_10690786 | Ga0207703_106907862 | 239 |
| 234 | 3300026041 | Ga0207639_10614526 | Ga0207639_106145262 | 239 |
| 235 | 3300026075 | Ga0207708_10000271 | Ga0207708_1000027114 | 239 |
| 236 | 3300026078 | Ga0207702_10150964 | Ga0207702_101509642 | 239 |
| 237 | 3300026089 | Ga0207648_10039960 | Ga0207648_100399605 | 239 |
| 238 | 3300026089 | Ga0207648_10192125 | Ga0207648_101921253 | 239 |
| 239 | 3300026095 | Ga0207676_10038215 | Ga0207676_100382155 | 239 |
| 240 | 3300026118 | Ga0207675_100001271 | Ga0207675_10000127117 | 239 |
| 241 | 3300026118 | Ga0207675_100533098 | Ga0207675_1005330982 | 239 |
| 242 | 3300026121 | Ga0207683_10029961 | Ga0207683_100299614 | 239 |
| 243 | 3300027907 | Ga0207428_10039285 | Ga0207428_100392852 | 239 |
| 244 | 3300028379 | Ga0268266_10425510 | Ga0268266_104255102 | 239 |
| 245 | 3300028379 | Ga0268266_10911346 | Ga0268266_109113461 | 239 |
| 246 | 3300028556 | Ga0265337_1000793 | Ga0265337_10007938 | 239 |
| 247 | 3300028558 | Ga0265326_10000759 | Ga0265326_100007598 | 239 |
| 248 | 3300028563 | Ga0265319_1009092 | Ga0265319_10090922 | 239 |
| 249 | 3300028577 | Ga0265318_10001005 | Ga0265318_100010058 | 239 |
| 250 | 3300028666 | Ga0265336_10000002 | Ga0265336_10000002792 | 239 |
| 251 | 3300028800 | Ga0265338_10000001 | Ga0265338_1000000120 | 239 |
| 252 | 3300029957 | Ga0265324_10002017 | Ga0265324_100020177 | 239 |
| 253 | 3300031247 | Ga0265340_10000001 | Ga0265340_1000000120 | 239 |
| 254 | 3300031249 | Ga0265339_10058266 | Ga0265339_100582662 | 239 |
| 255 | 3300031344 | Ga0265316_10106406 | Ga0265316_101064063 | 239 |
| 256 | 3300031344 | Ga0265316_10119166 | Ga0265316_101191662 | 239 |
| 257 | 3300031824 | Ga0307413_10084506 | Ga0307413_100845063 | 239 |
| 258 | 3300031852 | Ga0307410_10035101 | Ga0307410_100351014 | 239 |
| 259 | 3300031901 | Ga0307406_10088844 | Ga0307406_100888442 | 239 |
| 260 | 3300031903 | Ga0307407_10031031 | Ga0307407_100310314 | 239 |
| 261 | 3300031995 | Ga0307409_100212248 | Ga0307409_1002122482 | 239 |
| 262 | 3300032002 | Ga0307416_100046330 | Ga0307416_1000463305 | 239 |
| 263 | 3300032002 | Ga0307416_100225973 | Ga0307416_1002259733 | 239 |
| 264 | 3300032126 | Ga0307415_100082568 | Ga0307415_1000825681 | 239 |
| 265 | 3300032126 | Ga0307415_100255686 | Ga0307415_1002556862 | 239 |
| 266 | 3300037312 | Ga0395899_0045455 | Ga0395899_0045455_2069_2791 | 239 |
| 267 | 3300037312 | Ga0395899_0125075 | Ga0395899_0125075_614_1339 | 239 |
| 268 | 3300037418 | Ga0395900_0009689 | Ga0395900_0009689_1998_2720 | 239 |
| 269 | 3300037418 | Ga0395900_0181729 | Ga0395900_0181729_1036_1758 | 239 |
| 270 | 3300037466 | Ga0395898_0001341 | Ga0395898_0001341_21955_22680 | 239 |
| 271 | 3300037466 | Ga0395898_0005316 | Ga0395898_0005316_2217_2939 | 239 |
| 272 | 3300037466 | Ga0395898_0058361 | Ga0395898_0058361_2575_3297 | 239 |
| 273 | 3300037466 | Ga0395898_0211511 | Ga0395898_0211511_688_1410 | 239 |
| 274 | 3300037466 | Ga0395898_0341992 | Ga0395898_0341992_408_1139 | 239 |
| 275 | 3300037471 | Ga0395905_0005729 | Ga0395905_0005729_3981_4706 | 239 |
| 276 | 3300037471 | Ga0395905_0008408 | Ga0395905_0008408_7246_7968 | 239 |
| 277 | 3300038443 | Ga0395901_0002458 | Ga0395901_0002458_15498_16223 | 239 |
| 278 | 3300038443 | Ga0395901_0008767 | Ga0395901_0008767_2258_2980 | 239 |
| 279 | 3300038443 | Ga0395901_0020861 | Ga0395901_0020861_4791_5522 | 239 |
| 280 | 3300038443 | Ga0395901_0132425 | Ga0395901_0132425_1118_1840 | 239 |
| 281 | 3300038443 | Ga0395901_0236684 | Ga0395901_0236684_1100_1825 | 239 |
| 282 | 3300038443 | Ga0395901_0268496 | Ga0395901_0268496_710_1435 | 239 |
| 283 | 3300038443 | Ga0395901_0314197 | Ga0395901_0314197_850_1572 | 239 |
| 284 | 3300042461 | Ga0439460_0035035 | Ga0439460_0035035_23_745 | 239 |
| 285 | 3300046454 | Ga0495592_0100343 | Ga0495592_0100343_691_1416 | 239 |
| 286 | 3300048903 | Ga0496100_0013794 | Ga0496100_0013794_3675_4415 | 239 |
| 287 | 3300048905 | Ga0496102_0148943 | Ga0496102_0148943_234_968 | 239 |
| 288 | 3300048905 | Ga0496102_0221828 | Ga0496102_0221828_77_811 | 239 |
| 289 | 3300048907 | Ga0496104_0026687 | Ga0496104_0026687_1933_2667 | 239 |
| 290 | 3300048909 | Ga0496106_0452565 | Ga0496106_0452565_79_813 | 239 |
| 291 | 3300048910 | Ga0496107_0086120 | Ga0496107_0086120_299_1033 | 239 |
| 292 | 3300048912 | Ga0496109_0255807 | Ga0496109_0255807_171_905 | 239 |
| 293 | 3300048913 | Ga0496110_0096273 | Ga0496110_0096273_334_1068 | 239 |
| 294 | 3300048915 | Ga0496112_0021407 | Ga0496112_0021407_5393_6127 | 239 |
| 295 | 3300048915 | Ga0496112_0256506 | Ga0496112_0256506_639_1364 | 239 |
| 296 | 3300048917 | Ga0496114_0244027 | Ga0496114_0244027_687_1421 | 239 |
| 297 | 3300049587 | Ga0501071_0048246 | Ga0501071_0048246_360_1136 | 239 |
| 298 | 3300049591 | Ga0501075_0005673 | Ga0501075_0005673_2263_3039 | 239 |
| 299 | 3300050507 | nmdc:mga05p37_247397_c1 | nmdc:mga05p37_247397_c1_1250_1990 | 239 |
| 300 | 3300050510 | nmdc:mga06r32_47375_c1 | nmdc:mga06r32_47375_c1_348_1088 | 239 |
| 301 | 3300050511 | nmdc:mga08y16_60254_c1 | nmdc:mga08y16_60254_c1_719_1459 | 239 |
| 302 | 3300050512 | nmdc:mga0n895_402252_c1 | nmdc:mga0n895_402252_c1_526_1266 | 239 |
| 303 | 3300050513 | nmdc:mga0rr50_245943_c1 | nmdc:mga0rr50_245943_c1_636_1376 | 239 |
| 304 | 3300050514 | nmdc:mga08x19_40189_c1 | nmdc:mga08x19_40189_c1_1575_2315 | 239 |
| 305 | 3300053077 | Ga0495601_0000363 | Ga0495601_0000363_20712_21437 | 239 |
| 306 | 3300053085 | Ga0495619_0201928 | Ga0495619_0201928_171_893 | 239 |
| 307 | iso_pu_bacteria | 2721755487 | 2722726849 | 239 |
| 308 | 3300005981 | Ga0081538_10000391 | Ga0081538_100003919 | 240 |
| 309 | 3300005981 | Ga0081538_10000700 | Ga0081538_1000070032 | 240 |
| 310 | 3300037312 | Ga0395899_0002789 | Ga0395899_0002789_12440_13171 | 240 |
| 311 | 3300037418 | Ga0395900_0002952 | Ga0395900_0002952_6615_7346 | 240 |
| 312 | 3300037418 | Ga0395900_0399874 | Ga0395900_0399874_380_1111 | 240 |
| 313 | 3300037466 | Ga0395898_0004911 | Ga0395898_0004911_4980_5711 | 240 |
| 314 | 3300037466 | Ga0395898_0242324 | Ga0395898_0242324_32_763 | 240 |
| 315 | 3300037471 | Ga0395905_0003391 | Ga0395905_0003391_5107_5838 | 240 |
| 316 | 3300038443 | Ga0395901_0004024 | Ga0395901_0004024_2959_3690 | 240 |
| 317 | 3300038443 | Ga0395901_0313103 | Ga0395901_0313103_93_824 | 240 |
| 318 | 3300049822 | Ga0501035_0143020 | Ga0501035_0143020_1132_1869 | 240 |
| 319 | 3300025304 | Ga0209257_1000008 | Ga0209257_1000008520 | 241 |
| 320 | 3300048919 | Ga0496116_0002384 | Ga0496116_0002384_2652_3389 | 243 |
| 321 | 3300048920 | Ga0496117_0004082 | Ga0496117_0004082_9851_10588 | 243 |
| 322 | 3300048925 | Ga0496122_0017301 | Ga0496122_0017301_4894_5631 | 243 |
| 323 | 3300048927 | Ga0496124_0188309 | Ga0496124_0188309_788_1525 | 243 |
| 324 | 3300048928 | Ga0496125_0137475 | Ga0496125_0137475_68_805 | 243 |
| 325 | 2162886007 | SwRhRL2b_contig_1561607 | SwRhRL2b_0005.00001300 | 246 |
| 326 | 2162886007 | SwRhRL2b_contig_2107601 | SwRhRL2b_0570.00007790 | 246 |
| 327 | 3300005289 | Ga0065704_10090814 | Ga0065704_100908142 | 246 |
| 328 | 3300009148 | Ga0105243_10000006 | Ga0105243_10000006191 | 246 |
| 329 | 3300025935 | Ga0207709_10000007 | Ga0207709_10000007430 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nnw-assembly1.cif.gz_A | hypothetical protein from pyrococcus furiosus pfu-1218608 | 0.8317 | 3 | 240 |
| 2gju-assembly1.cif.gz_B | crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 | 0.8249 | 3 | 240 |
| 3qfn-assembly1.cif.gz_B | crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate | 0.8115 | 3 | 243 |
| 1nnw-assembly1.cif.gz_A | hypothetical protein from pyrococcus furiosus pfu-1218608 | 0.8031 | 3 | 240 |
| 2gju-assembly1.cif.gz_B | crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 | 0.7967 | 3 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58322_5_243_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8253 | 5 | 241 | 3.60.21.10 |
| 2gjuC00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8252 | 3 | 240 | 3.60.21.10 |
| 3qfnB00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8115 | 3 | 243 | 3.60.21.10 |
| af_Q58322_5_243_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.809 | 5 | 241 | 3.60.21.10 |
| 2gjuC00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7971 | 3 | 240 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5BY85-F1-model_v4 | Predicted phosphodiesterase | 0.9848 | 1 | 240 |
GO:0005737
GO:0016791 |
| AF-A0A348Y657-F1-model_v4 | deleted | 0.983 | 3 | 242 |
|
| AF-A0A4U9K1M3-F1-model_v4 | deleted | 0.9743 | 3 | 240 |
|
| AF-A0A420CDM6-F1-model_v4 | Putative phosphodiesterase | 0.9734 | 3 | 236 |
GO:0005737
GO:0016791 |
| AF-A0A1H5XIS1-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9713 | 3 | 241 |
GO:0005737
GO:0016791 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar