F409704

General Info

Members Datasets Scaffolds Average Seq Length
329 194 328 241

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10113393|Ga0207661_101133931
Length 267
Sequence MCLVAPLIDLFRFASVDVTTHAVAVIPDAETVAVITDVHANLPALEAALARIDELGIARVYCGGDLVGYGPHPNEVCALIAERGIPTIYGNYDYAIARDLDDCGCAYITAHDRELGQQSVIWTLAHTDAGSKAFLRELAFDLRFSVGATGVHLVHGSPRKVNEYLFEDKPASLYERLAAAESDRVLVFGHTHKPWVREYGGVLFVNCGSVGKPKDGDSRGAFAILTATQTGVEVTIERVEYDAEAVAREVAASGLPAEYADKLLAAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 8.51
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1561607 2162886007 Bacteria 1782
2 SwRhRL2b_contig_2107601 2162886007 Bacteria 3149
3 JGI25407J50210_10011530 3300003373 Bacteria 2260
4 JGI25407J50210_10027364 3300003373 Bacteria 1478
5 Ga0065704_10090814 3300005289 Bacteria 2761
6 Ga0070683_100002447 3300005329 Bacteria 14774
7 Ga0068869_100466992 3300005334 Bacteria 1049
8 Ga0070682_100021448 3300005337 Bacteria 3812
9 Ga0068868_100017751 3300005338 Bacteria 5307
10 Ga0068868_100106993 3300005338 Bacteria 2269
11 Ga0070691_10086620 3300005341 Bacteria 1540
12 Ga0070668_100147630 3300005347 Bacteria 1899
13 Ga0070668_100169826 3300005347 Bacteria 1775
14 Ga0070675_100028969 3300005354 Bacteria 4462
15 Ga0070659_100043178 3300005366 Bacteria 3526
16 Ga0070667_100769747 3300005367 Bacteria 893
17 Ga0070714_100318058 3300005435 Bacteria 1455
18 Ga0070710_10061184 3300005437 Bacteria 2144
19 Ga0070710_10234009 3300005437 Bacteria 1174
20 Ga0070700_100081711 3300005441 Bacteria 2088
21 Ga0070663_100127951 3300005455 Bacteria 1926
22 Ga0070678_100109670 3300005456 Bacteria 2157
23 Ga0070662_100350335 3300005457 Bacteria 1210
24 Ga0070707_100261159 3300005468 Bacteria 1685
25 Ga0070679_100681216 3300005530 Bacteria 971
26 Ga0070684_100059444 3300005535 Bacteria 3342
27 Ga0070684_100483672 3300005535 Bacteria 1146
28 Ga0068853_100355298 3300005539 Bacteria 1364
29 Ga0068853_100724004 3300005539 Bacteria 950
30 Ga0070672_100624293 3300005543 Bacteria 940
31 Ga0070665_100064533 3300005548 Bacteria 3673
32 Ga0070665_100136066 3300005548 Bacteria 2460
33 Ga0068856_100036475 3300005614 Bacteria 4820
34 Ga0070702_100009158 3300005615 Bacteria 4831
35 Ga0068864_100004551 3300005618 Bacteria 11385
36 Ga0068861_100037255 3300005719 Bacteria 3615
37 Ga0068861_100795557 3300005719 Bacteria 887
38 Ga0068863_100386488 3300005841 Bacteria 1367
39 Ga0068858_100154194 3300005842 Bacteria 2161
40 Ga0068860_100986410 3300005843 Bacteria 860
41 Ga0068862_100021830 3300005844 Bacteria 5354
42 Ga0081455_10003758 3300005937 Bacteria 17335
43 Ga0081455_10259521 3300005937 Bacteria 1266
44 Ga0081538_10000391 3300005981 Bacteria 49818
45 Ga0081538_10000700 3300005981 Bacteria 36835
46 Ga0081538_10001042 3300005981 Bacteria 29561
47 Ga0081538_10002361 3300005981 Bacteria 18551
48 Ga0081538_10010362 3300005981 Bacteria 7647
49 Ga0081538_10014118 3300005981 Bacteria 6276
50 Ga0081538_10070880 3300005981 Bacteria 1921
51 Ga0081539_10013216 3300005985 Bacteria 6245
52 Ga0075432_10031466 3300006058 Bacteria 1837
53 Ga0070716_100110409 3300006173 Bacteria 1703
54 Ga0070712_100009980 3300006175 Bacteria 5985
55 Ga0070712_100030243 3300006175 Bacteria 3638
56 Ga0070712_100168462 3300006175 Bacteria 1697
57 Ga0075428_100126844 3300006844 Bacteria 2777
58 Ga0075431_100020305 3300006847 Bacteria 6785
59 Ga0075434_100123029 3300006871 Bacteria 2610
60 Ga0075434_100206152 3300006871 Bacteria 1986
61 Ga0068865_100055468 3300006881 Bacteria 2757
62 Ga0068865_100113836 3300006881 Bacteria 2000
63 Ga0075436_100154156 3300006914 Unclassified 1617
64 Ga0111539_10056477 3300009094 Bacteria 4665
65 Ga0111539_10081648 3300009094 Bacteria 3802
66 Ga0111539_10145661 3300009094 Bacteria 2773
67 Ga0105245_10020165 3300009098 Bacteria 5843
68 Ga0105245_10316746 3300009098 Archaea 1535
69 Ga0114129_10203746 3300009147 Bacteria 2678
70 Ga0114129_10492555 3300009147 Bacteria 1602
71 Ga0105243_10000006 3300009148 Bacteria 465541
72 Ga0105243_10015197 3300009148 Bacteria 5827
73 Ga0105241_10108344 3300009174 Bacteria 2220
74 Ga0105242_10153008 3300009176 Bacteria 2013
75 Ga0105242_10288086 3300009176 Bacteria 1494
76 Ga0105248_10198120 3300009177 Bacteria 2263
77 Ga0105237_10000657 3300009545 Bacteria 47992
78 Ga0105237_10623440 3300009545 Bacteria 1085
79 Ga0105238_10241515 3300009551 Bacteria 1784
80 Ga0105249_10027597 3300009553 Bacteria 5123
81 Ga0105249_10053091 3300009553 Bacteria 3704
82 Ga0105249_10308339 3300009553 Bacteria 1590
83 Ga0105249_10907389 3300009553 Bacteria 948
84 Ga0105239_10024017 3300010375 Bacteria 6715
85 Ga0105239_10071903 3300010375 Bacteria 3801
86 Ga0105246_10015182 3300011119 Bacteria 4858
87 Ga0157369_10533448 3300013105 Bacteria 1214
88 Ga0163162_10015840 3300013306 Bacteria 7368
89 Ga0157372_10128444 3300013307 Bacteria 2915
90 Ga0157372_10194529 3300013307 Bacteria 2349
91 Ga0157372_10541446 3300013307 Bacteria 1357
92 Ga0157372_10615321 3300013307 Bacteria 1266
93 Ga0157372_10788554 3300013307 Bacteria 1104
94 Ga0157375_10264449 3300013308 Bacteria 1882
95 Ga0163163_10162604 3300014325 Bacteria 2278
96 Ga0157380_10507022 3300014326 Bacteria 1173
97 Ga0157377_10052627 3300014745 Bacteria 2299
98 Ga0157377_10215060 3300014745 Bacteria 1228
99 Ga0157379_10301602 3300014968 Bacteria 1460
100 Ga0213875_10047562 3300021388 Bacteria 2013
101 Ga0209257_1000008 3300025304 Bacteria 1294570
102 Ga0207692_10134854 3300025898 Bacteria 1398
103 Ga0207642_10009991 3300025899 Bacteria 3325
104 Ga0207688_10045551 3300025901 Bacteria 2447
105 Ga0207671_10000926 3300025914 Bacteria 36838
106 Ga0207693_10029817 3300025915 Bacteria 4306
107 Ga0207693_10086580 3300025915 Bacteria 2455
108 Ga0207693_10206767 3300025915 Bacteria 1543
109 Ga0207660_10438950 3300025917 Bacteria 1055
110 Ga0207662_10173207 3300025918 Bacteria 1385
111 Ga0207646_10273062 3300025922 Bacteria 1528
112 Ga0207687_10086272 3300025927 Bacteria 2279
113 Ga0207687_10154207 3300025927 Bacteria 1756
114 Ga0207687_10221459 3300025927 Archaea 1490
115 Ga0207687_10454875 3300025927 Bacteria 1062
116 Ga0207664_10455106 3300025929 Bacteria 1143
117 Ga0207690_10210742 3300025932 Bacteria 1481
118 Ga0207706_10017699 3300025933 Bacteria 6420
119 Ga0207706_10236559 3300025933 Bacteria 1597
120 Ga0207686_10151692 3300025934 Bacteria 1614
121 Ga0207709_10000007 3300025935 Bacteria 752025
122 Ga0207709_10009725 3300025935 Bacteria 5298
123 Ga0207670_10375066 3300025936 Unclassified 1132
124 Ga0207704_10073723 3300025938 Bacteria 2175
125 Ga0207665_10489233 3300025939 Bacteria 949
126 Ga0207691_10648021 3300025940 Bacteria 893
127 Ga0207689_10215382 3300025942 Bacteria 1587
128 Ga0207661_10036293 3300025944 Bacteria 3846
129 Ga0207661_10113393 3300025944 Bacteria 2297
130 Ga0207661_10251726 3300025944 Bacteria 1570
131 Ga0207679_10247430 3300025945 Bacteria 1514
132 Ga0207651_10275389 3300025960 Bacteria 1388
133 Ga0207668_10242192 3300025972 Bacteria 1460
134 Ga0207668_10573558 3300025972 Bacteria 980
135 Ga0207640_10007054 3300025981 Bacteria 6187
136 Ga0207658_10341333 3300025986 Bacteria 1302
137 Ga0207658_10705537 3300025986 Bacteria 912
138 Ga0207677_10040228 3300026023 Bacteria 3080
139 Ga0207703_10690786 3300026035 Bacteria 970
140 Ga0207639_10614526 3300026041 Bacteria 1003
141 Ga0207708_10000271 3300026075 Bacteria 40456
142 Ga0207702_10150964 3300026078 Bacteria 2113
143 Ga0207648_10039960 3300026089 Bacteria 4123
144 Ga0207648_10192125 3300026089 Bacteria 1810
145 Ga0207676_10038215 3300026095 Bacteria 3662
146 Ga0207675_100001271 3300026118 Bacteria 25231
147 Ga0207675_100533098 3300026118 Bacteria 1172
148 Ga0207683_10029961 3300026121 Bacteria 4713
149 Ga0207698_10587128 3300026142 Bacteria 1097
150 Ga0207428_10039285 3300027907 Bacteria 3843
151 Ga0268266_10048879 3300028379 Bacteria 3626
152 Ga0268266_10425510 3300028379 Bacteria 1259
153 Ga0268266_10911346 3300028379 Bacteria 850
154 Ga0265337_1000793 3300028556 Bacteria 16632
155 Ga0265326_10000759 3300028558 Bacteria 11938
156 Ga0265319_1000062 3300028563 Bacteria 85615
157 Ga0265319_1000711 3300028563 Bacteria 21750
158 Ga0265319_1009092 3300028563 Bacteria 4273
159 Ga0265318_10001005 3300028577 Bacteria 18023
160 Ga0265318_10006420 3300028577 Bacteria 5416
161 Ga0265336_10000002 3300028666 Bacteria 830172
162 Ga0265338_10000001 3300028800 Bacteria 1177449
163 Ga0265338_10044366 3300028800 Bacteria 4107
164 Ga0265324_10002017 3300029957 Bacteria 10814
165 Ga0265320_10018550 3300031240 Bacteria 3827
166 Ga0265325_10139196 3300031241 Bacteria 1156
167 Ga0265340_10000001 3300031247 Bacteria 1647668
168 Ga0265339_10058266 3300031249 Bacteria 2086
169 Ga0265327_10145429 3300031251 Bacteria 1105
170 Ga0265316_10106406 3300031344 Bacteria 2127
171 Ga0265316_10119166 3300031344 Bacteria 1994
172 Ga0265313_10026603 3300031595 Bacteria 3044
173 Ga0265314_10025765 3300031711 Bacteria 4430
174 Ga0307413_10084506 3300031824 Bacteria 2046
175 Ga0307410_10035101 3300031852 Bacteria 3254
176 Ga0307406_10088844 3300031901 Bacteria 2074
177 Ga0307407_10031031 3300031903 Bacteria 2890
178 Ga0307409_100212248 3300031995 Bacteria 1740
179 Ga0307416_100046330 3300032002 Bacteria 3430
180 Ga0307416_100225973 3300032002 Bacteria 1800
181 Ga0307415_100082568 3300032126 Bacteria 2299
182 Ga0307415_100255686 3300032126 Bacteria 1426
183 Ga0316574_0018830 3300035398 Bacteria 4065
184 Ga0316584_0125831 3300036712 Bacteria 1914
185 Ga0373925_0086623 3300037068 Bacteria 2390
186 Ga0395899_0002789 3300037312 Bacteria 14079
187 Ga0395899_0030276 3300037312 Bacteria 4071
188 Ga0395899_0045455 3300037312 Bacteria 3272
189 Ga0395899_0125075 3300037312 Bacteria 1839
190 Ga0395900_0002952 3300037418 Bacteria 18521
191 Ga0395900_0009689 3300037418 Bacteria 9869
192 Ga0395900_0037133 3300037418 Bacteria 5024
193 Ga0395900_0052064 3300037418 Bacteria 4215
194 Ga0395900_0098752 3300037418 Bacteria 3000
195 Ga0395900_0181729 3300037418 Bacteria 2137
196 Ga0395900_0399874 3300037418 Bacteria 1338
197 Ga0395900_0406386 3300037418 Unclassified 1325
198 Ga0395900_0425465 3300037418 Bacteria 1288
199 Ga0395898_0001341 3300037466 Bacteria 35566
200 Ga0395898_0004911 3300037466 Bacteria 14516
201 Ga0395898_0005316 3300037466 Bacteria 13920
202 Ga0395898_0009706 3300037466 Bacteria 10093
203 Ga0395898_0054752 3300037466 Bacteria 3892
204 Ga0395898_0058361 3300037466 Bacteria 3757
205 Ga0395898_0061889 3300037466 Bacteria 3636
206 Ga0395898_0089579 3300037466 Bacteria 2961
207 Ga0395898_0162095 3300037466 Bacteria 2139
208 Ga0395898_0211511 3300037466 Bacteria 1850
209 Ga0395898_0242324 3300037466 Bacteria 1720
210 Ga0395898_0250656 3300037466 Bacteria 1688
211 Ga0395898_0317536 3300037466 Bacteria 1486
212 Ga0395898_0341992 3300037466 Bacteria 1427
213 Ga0395898_0350756 3300037466 Bacteria 1407
214 Ga0395898_0467918 3300037466 Bacteria 1200
215 Ga0395905_0003142 3300037471 Bacteria 17794
216 Ga0395905_0003391 3300037471 Bacteria 17054
217 Ga0395905_0005729 3300037471 Bacteria 12632
218 Ga0395905_0008408 3300037471 Bacteria 10176
219 Ga0395905_0125442 3300037471 Bacteria 2414
220 Ga0395905_0140022 3300037471 Bacteria 2276
221 Ga0395905_0852637 3300037471 Bacteria 814
222 Ga0436364_0894386 3300037853 Bacteria 1568
223 Ga0395901_0001828 3300038443 Bacteria 21979
224 Ga0395901_0002458 3300038443 Bacteria 18787
225 Ga0395901_0004024 3300038443 Bacteria 14804
226 Ga0395901_0008767 3300038443 Bacteria 10231
227 Ga0395901_0020861 3300038443 Bacteria 6710
228 Ga0395901_0026868 3300038443 Bacteria 5910
229 Ga0395901_0042505 3300038443 Bacteria 4712
230 Ga0395901_0073382 3300038443 Bacteria 3569
231 Ga0395901_0077751 3300038443 Bacteria 3463
232 Ga0395901_0132425 3300038443 Bacteria 2620
233 Ga0395901_0181090 3300038443 Bacteria 2210
234 Ga0395901_0236684 3300038443 Bacteria 1905
235 Ga0395901_0268496 3300038443 Unclassified 1775
236 Ga0395901_0313103 3300038443 Bacteria 1625
237 Ga0395901_0314197 3300038443 Unclassified 1622
238 Ga0395901_0414225 3300038443 Bacteria 1383
239 Ga0395901_1001442 3300038443 Bacteria 811
240 Ga0439460_0035035 3300042461 Bacteria 1450
241 Ga0466959_0123009 3300045049 Unclassified 1843
242 Ga0495592_0095484 3300046454 Bacteria 2126
243 Ga0495592_0100343 3300046454 Bacteria 2064
244 Ga0495664_0076467 3300046477 Bacteria 2004
245 Ga0495630_0068062 3300046517 Bacteria 2677
246 Ga0495665_0160337 3300046531 Bacteria 1172
247 Ga0495625_0000787 3300046660 Bacteria 43981
248 Ga0495676_0059428 3300047321 Bacteria 3002
249 Ga0496100_0013794 3300048903 Bacteria 4675
250 Ga0496100_0033861 3300048903 Bacteria 3200
251 Ga0496101_0269366 3300048904 Bacteria 1329
252 Ga0496102_0133289 3300048905 Bacteria 2327
253 Ga0496102_0148943 3300048905 Bacteria 2198
254 Ga0496102_0221828 3300048905 Bacteria 1782
255 Ga0496102_0352904 3300048905 Bacteria 1385
256 Ga0496104_0026687 3300048907 Bacteria 5337
257 Ga0496104_0105868 3300048907 Bacteria 2695
258 Ga0496105_0046864 3300048908 Bacteria 3568
259 Ga0496106_0022070 3300048909 Bacteria 4728
260 Ga0496106_0452565 3300048909 Bacteria 1031
261 Ga0496107_0060036 3300048910 Bacteria 2752
262 Ga0496107_0086120 3300048910 Bacteria 2293
263 Ga0496108_0000894 3300048911 Bacteria 23226
264 Ga0496108_0097078 3300048911 Bacteria 2511
265 Ga0496109_0006929 3300048912 Bacteria 9565
266 Ga0496109_0082049 3300048912 Bacteria 2971
267 Ga0496109_0255807 3300048912 Bacteria 1649
268 Ga0496110_0012777 3300048913 Bacteria 6915
269 Ga0496110_0096273 3300048913 Bacteria 2652
270 Ga0496111_0115397 3300048914 Bacteria 1980
271 Ga0496112_0021407 3300048915 Bacteria 6149
272 Ga0496112_0133083 3300048915 Bacteria 2457
273 Ga0496112_0139993 3300048915 Bacteria 2389
274 Ga0496112_0256506 3300048915 Bacteria 1699
275 Ga0496113_0013478 3300048916 Bacteria 5542
276 Ga0496114_0244027 3300048917 Bacteria 1580
277 Ga0496116_0002384 3300048919 Bacteria 19818
278 Ga0496117_0004082 3300048920 Bacteria 16385
279 Ga0496122_0017301 3300048925 Bacteria 6751
280 Ga0496124_0188309 3300048927 Bacteria 1582
281 Ga0496125_0137475 3300048928 Bacteria 1706
282 Ga0501031_0029469 3300049568 Bacteria 3580
283 Ga0501032_0402653 3300049569 Bacteria 879
284 Ga0501037_0204071 3300049573 Bacteria 1396
285 Ga0501039_0101852 3300049575 Bacteria 2241
286 Ga0501039_0175735 3300049575 Bacteria 1684
287 Ga0501040_0041981 3300049576 Bacteria 3115
288 Ga0501041_0038762 3300049577 Bacteria 2890
289 Ga0501042_0014273 3300049578 Bacteria 5420
290 Ga0501043_0191431 3300049579 Bacteria 1591
291 Ga0501048_0112003 3300049582 Bacteria 1927
292 Ga0501048_0178855 3300049582 Bacteria 1503
293 Ga0501048_0220787 3300049582 Bacteria 1344
294 Ga0501068_0239859 3300049584 Bacteria 1154
295 Ga0501069_0423193 3300049585 Bacteria 790
296 Ga0501071_0048246 3300049587 Bacteria 3062
297 Ga0501071_0199057 3300049587 Bacteria 1504
298 Ga0501072_0047356 3300049588 Bacteria 3386
299 Ga0501074_0129317 3300049590 Bacteria 1807
300 Ga0501075_0005673 3300049591 Bacteria 8542
301 Ga0501075_0053010 3300049591 Bacteria 3050
302 Ga0501076_0222410 3300049592 Unclassified 1543
303 Ga0501076_0297231 3300049592 Bacteria 1323
304 Ga0501077_0093611 3300049593 Bacteria 1905
305 Ga0501077_0208712 3300049593 Bacteria 1241
306 Ga0501079_0182602 3300049741 Bacteria 1637
307 Ga0501079_0706335 3300049741 Bacteria 794
308 Ga0501081_0152648 3300049743 Bacteria 1660
309 Ga0501035_0143020 3300049822 Bacteria 2079
310 nmdc:mga05p37_247397_c1 3300050507 Bacteria 2140
311 nmdc:mga06r32_47375_c1 3300050510 Bacteria 4106
312 nmdc:mga08y16_60254_c1 3300050511 Bacteria 3965
313 nmdc:mga0n895_402252_c1 3300050512 Bacteria 1385
314 nmdc:mga0rr50_245943_c1 3300050513 Bacteria 1484
315 nmdc:mga08x19_40189_c1 3300050514 Bacteria 2976
316 nmdc:mga0a205_244245_c1 3300050515 Bacteria 1676
317 Ga0495601_0000363 3300053077 Bacteria 23921
318 Ga0495601_0082194 3300053077 Bacteria 2068
319 Ga0495612_0005746 3300053078 Bacteria 5124
320 Ga0495612_0036566 3300053078 Bacteria 1993
321 Ga0495619_0182537 3300053085 Bacteria 1452
322 Ga0495619_0201928 3300053085 Bacteria 1376
323 Ga0501084_0131246 3300054114 Bacteria 2109
324 Ga0501084_0306934 3300054114 Bacteria 1340
325 Ga0501082_0200923 3300060353 Bacteria 1734
326 Ga0501082_0840540 3300060353 Bacteria 803
327 Ga0530510_0032494 3300061734 Bacteria 3755
328 Ga0530510_0482484 3300061734 Bacteria 939

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0131246 Ga0501084_0131246_125_742 188
2 3300025939 Ga0207665_10489233 Ga0207665_104892331 215
3 3300005366 Ga0070659_100043178 Ga0070659_1000431782 223
4 3300025932 Ga0207690_10210742 Ga0207690_102107422 223
5 3300037418 Ga0395900_0098752 Ga0395900_0098752_2255_2974 224
6 3300037466 Ga0395898_0061889 Ga0395898_0061889_1509_2228 224
7 3300038443 Ga0395901_0073382 Ga0395901_0073382_2818_3537 224
8 3300005468 Ga0070707_100261159 Ga0070707_1002611593 227
9 3300025922 Ga0207646_10273062 Ga0207646_102730622 227
10 3300006844 Ga0075428_100126844 Ga0075428_1001268441 228
11 3300009094 Ga0111539_10081648 Ga0111539_100816486 228
12 3300009147 Ga0114129_10203746 Ga0114129_102037463 228
13 3300060353 Ga0501082_0840540 Ga0501082_0840540_14_736 229
14 3300045049 Ga0466959_0123009 Ga0466959_0123009_591_1319 232
15 3300005437 Ga0070710_10234009 Ga0070710_102340092 233
16 3300005530 Ga0070679_100681216 Ga0070679_1006812162 234
17 3300005719 Ga0068861_100795557 Ga0068861_1007955572 234
18 3300009098 Ga0105245_10316746 Ga0105245_103167462 234
19 3300037466 Ga0395898_0089579 Ga0395898_0089579_1751_2458 234
20 3300037471 Ga0395905_0852637 Ga0395905_0852637_95_799 234
21 3300037853 Ga0436364_0894386 Ga0436364_0894386_285_992 234
22 3300038443 Ga0395901_1001442 Ga0395901_1001442_56_760 234
23 3300049568 Ga0501031_0029469 Ga0501031_0029469_38_748 235
24 3300049569 Ga0501032_0402653 Ga0501032_0402653_113_823 235
25 3300049573 Ga0501037_0204071 Ga0501037_0204071_528_1238 235
26 3300049575 Ga0501039_0101852 Ga0501039_0101852_50_760 235
27 3300049575 Ga0501039_0175735 Ga0501039_0175735_54_764 235
28 3300049576 Ga0501040_0041981 Ga0501040_0041981_722_1432 235
29 3300049577 Ga0501041_0038762 Ga0501041_0038762_1225_1935 235
30 3300049578 Ga0501042_0014273 Ga0501042_0014273_3491_4201 235
31 3300049579 Ga0501043_0191431 Ga0501043_0191431_142_852 235
32 3300049582 Ga0501048_0112003 Ga0501048_0112003_99_809 235
33 3300049582 Ga0501048_0178855 Ga0501048_0178855_55_765 235
34 3300049582 Ga0501048_0220787 Ga0501048_0220787_582_1292 235
35 3300049584 Ga0501068_0239859 Ga0501068_0239859_292_1002 235
36 3300049585 Ga0501069_0423193 Ga0501069_0423193_34_771 235
37 3300049587 Ga0501071_0199057 Ga0501071_0199057_745_1455 235
38 3300049588 Ga0501072_0047356 Ga0501072_0047356_187_897 235
39 3300049590 Ga0501074_0129317 Ga0501074_0129317_564_1274 235
40 3300049591 Ga0501075_0053010 Ga0501075_0053010_1507_2217 235
41 3300049592 Ga0501076_0297231 Ga0501076_0297231_215_925 235
42 3300049593 Ga0501077_0093611 Ga0501077_0093611_1144_1854 235
43 3300049593 Ga0501077_0208712 Ga0501077_0208712_187_897 235
44 3300049741 Ga0501079_0182602 Ga0501079_0182602_217_927 235
45 3300049743 Ga0501081_0152648 Ga0501081_0152648_901_1611 235
46 3300054114 Ga0501084_0306934 Ga0501084_0306934_324_1034 235
47 3300060353 Ga0501082_0200923 Ga0501082_0200923_668_1378 235
48 3300061734 Ga0530510_0032494 Ga0530510_0032494_1951_2661 235
49 3300025942 Ga0207689_10215382 Ga0207689_102153822 236
50 3300037418 Ga0395900_0425465 Ga0395900_0425465_27_737 236
51 3300005539 Ga0068853_100724004 Ga0068853_1007240041 237
52 3300005981 Ga0081538_10014118 Ga0081538_100141181 237
53 3300035398 Ga0316574_0018830 Ga0316574_0018830_2210_2926 237
54 3300036712 Ga0316584_0125831 Ga0316584_0125831_1168_1884 237
55 3300037312 Ga0395899_0030276 Ga0395899_0030276_3237_3953 237
56 3300037418 Ga0395900_0037133 Ga0395900_0037133_3518_4234 237
57 3300037466 Ga0395898_0250656 Ga0395898_0250656_560_1276 237
58 3300037471 Ga0395905_0140022 Ga0395905_0140022_1180_1896 237
59 3300038443 Ga0395901_0077751 Ga0395901_0077751_413_1129 237
60 3300003373 JGI25407J50210_10027364 JGI25407J50210_100273641 238
61 3300005535 Ga0070684_100483672 Ga0070684_1004836722 238
62 3300005548 Ga0070665_100064533 Ga0070665_1000645333 238
63 3300005841 Ga0068863_100386488 Ga0068863_1003864882 238
64 3300005937 Ga0081455_10003758 Ga0081455_1000375814 238
65 3300005981 Ga0081538_10001042 Ga0081538_1000104211 238
66 3300005981 Ga0081538_10070880 Ga0081538_100708803 238
67 3300005985 Ga0081539_10013216 Ga0081539_100132162 238
68 3300006871 Ga0075434_100206152 Ga0075434_1002061525 238
69 3300009094 Ga0111539_10145661 Ga0111539_101456611 238
70 3300009553 Ga0105249_10907389 Ga0105249_109073891 238
71 3300013307 Ga0157372_10615321 Ga0157372_106153212 238
72 3300013307 Ga0157372_10788554 Ga0157372_107885541 238
73 3300014325 Ga0163163_10162604 Ga0163163_101626041 238
74 3300021388 Ga0213875_10047562 Ga0213875_100475622 238
75 3300025915 Ga0207693_10206767 Ga0207693_102067672 238
76 3300025927 Ga0207687_10221459 Ga0207687_102214592 238
77 3300025934 Ga0207686_10151692 Ga0207686_101516922 238
78 3300026142 Ga0207698_10587128 Ga0207698_105871282 238
79 3300028379 Ga0268266_10048879 Ga0268266_100488794 238
80 3300028563 Ga0265319_1000062 Ga0265319_10000626 238
81 3300028563 Ga0265319_1000711 Ga0265319_10007118 238
82 3300028577 Ga0265318_10006420 Ga0265318_100064204 238
83 3300028800 Ga0265338_10044366 Ga0265338_100443665 238
84 3300031240 Ga0265320_10018550 Ga0265320_100185505 238
85 3300031241 Ga0265325_10139196 Ga0265325_101391962 238
86 3300031251 Ga0265327_10145429 Ga0265327_101454291 238
87 3300031595 Ga0265313_10026603 Ga0265313_100266035 238
88 3300031711 Ga0265314_10025765 Ga0265314_100257653 238
89 3300037068 Ga0373925_0086623 Ga0373925_0086623_1384_2106 238
90 3300037418 Ga0395900_0052064 Ga0395900_0052064_2166_2885 238
91 3300037418 Ga0395900_0406386 Ga0395900_0406386_457_1176 238
92 3300037466 Ga0395898_0009706 Ga0395898_0009706_333_1052 238
93 3300037466 Ga0395898_0054752 Ga0395898_0054752_507_1226 238
94 3300037466 Ga0395898_0162095 Ga0395898_0162095_1063_1782 238
95 3300037466 Ga0395898_0317536 Ga0395898_0317536_483_1202 238
96 3300037466 Ga0395898_0350756 Ga0395898_0350756_236_955 238
97 3300037466 Ga0395898_0467918 Ga0395898_0467918_404_1123 238
98 3300037471 Ga0395905_0003142 Ga0395905_0003142_8831_9550 238
99 3300037471 Ga0395905_0125442 Ga0395905_0125442_652_1371 238
100 3300038443 Ga0395901_0001828 Ga0395901_0001828_12202_12921 238
101 3300038443 Ga0395901_0026868 Ga0395901_0026868_3970_4689 238
102 3300038443 Ga0395901_0042505 Ga0395901_0042505_3659_4384 238
103 3300038443 Ga0395901_0181090 Ga0395901_0181090_1080_1799 238
104 3300038443 Ga0395901_0414225 Ga0395901_0414225_608_1330 238
105 3300046454 Ga0495592_0095484 Ga0495592_0095484_1163_1882 238
106 3300046477 Ga0495664_0076467 Ga0495664_0076467_1199_1918 238
107 3300046517 Ga0495630_0068062 Ga0495630_0068062_538_1257 238
108 3300046531 Ga0495665_0160337 Ga0495665_0160337_148_870 238
109 3300046660 Ga0495625_0000787 Ga0495625_0000787_27903_28622 238
110 3300047321 Ga0495676_0059428 Ga0495676_0059428_828_1550 238
111 3300048903 Ga0496100_0033861 Ga0496100_0033861_1117_1836 238
112 3300048904 Ga0496101_0269366 Ga0496101_0269366_340_1059 238
113 3300048905 Ga0496102_0133289 Ga0496102_0133289_1025_1744 238
114 3300048905 Ga0496102_0352904 Ga0496102_0352904_352_1077 238
115 3300048907 Ga0496104_0105868 Ga0496104_0105868_45_764 238
116 3300048908 Ga0496105_0046864 Ga0496105_0046864_2154_2873 238
117 3300048909 Ga0496106_0022070 Ga0496106_0022070_3767_4486 238
118 3300048910 Ga0496107_0060036 Ga0496107_0060036_1219_1938 238
119 3300048911 Ga0496108_0000894 Ga0496108_0000894_8394_9113 238
120 3300048911 Ga0496108_0097078 Ga0496108_0097078_876_1595 238
121 3300048912 Ga0496109_0006929 Ga0496109_0006929_4471_5190 238
122 3300048912 Ga0496109_0082049 Ga0496109_0082049_1431_2150 238
123 3300048913 Ga0496110_0012777 Ga0496110_0012777_2085_2804 238
124 3300048914 Ga0496111_0115397 Ga0496111_0115397_865_1584 238
125 3300048915 Ga0496112_0133083 Ga0496112_0133083_1053_1772 238
126 3300048915 Ga0496112_0139993 Ga0496112_0139993_1295_2014 238
127 3300048916 Ga0496113_0013478 Ga0496113_0013478_88_807 238
128 3300049592 Ga0501076_0222410 Ga0501076_0222410_658_1377 238
129 3300049741 Ga0501079_0706335 Ga0501079_0706335_63_782 238
130 3300050515 nmdc:mga0a205_244245_c1 nmdc:mga0a205_244245_c1_835_1560 238
131 3300053077 Ga0495601_0082194 Ga0495601_0082194_925_1644 238
132 3300053078 Ga0495612_0005746 Ga0495612_0005746_3445_4164 238
133 3300053078 Ga0495612_0036566 Ga0495612_0036566_901_1623 238
134 3300053085 Ga0495619_0182537 Ga0495619_0182537_601_1320 238
135 3300061734 Ga0530510_0482484 Ga0530510_0482484_26_745 238
136 3300003373 JGI25407J50210_10011530 JGI25407J50210_100115303 239
137 3300005329 Ga0070683_100002447 Ga0070683_10000244712 239
138 3300005334 Ga0068869_100466992 Ga0068869_1004669922 239
139 3300005337 Ga0070682_100021448 Ga0070682_1000214482 239
140 3300005338 Ga0068868_100017751 Ga0068868_1000177514 239
141 3300005338 Ga0068868_100106993 Ga0068868_1001069932 239
142 3300005341 Ga0070691_10086620 Ga0070691_100866202 239
143 3300005347 Ga0070668_100147630 Ga0070668_1001476302 239
144 3300005347 Ga0070668_100169826 Ga0070668_1001698261 239
145 3300005354 Ga0070675_100028969 Ga0070675_1000289694 239
146 3300005367 Ga0070667_100769747 Ga0070667_1007697471 239
147 3300005435 Ga0070714_100318058 Ga0070714_1003180581 239
148 3300005437 Ga0070710_10061184 Ga0070710_100611843 239
149 3300005441 Ga0070700_100081711 Ga0070700_1000817113 239
150 3300005455 Ga0070663_100127951 Ga0070663_1001279513 239
151 3300005456 Ga0070678_100109670 Ga0070678_1001096703 239
152 3300005457 Ga0070662_100350335 Ga0070662_1003503352 239
153 3300005535 Ga0070684_100059444 Ga0070684_1000594442 239
154 3300005539 Ga0068853_100355298 Ga0068853_1003552983 239
155 3300005543 Ga0070672_100624293 Ga0070672_1006242932 239
156 3300005548 Ga0070665_100136066 Ga0070665_1001360662 239
157 3300005614 Ga0068856_100036475 Ga0068856_1000364757 239
158 3300005615 Ga0070702_100009158 Ga0070702_1000091583 239
159 3300005618 Ga0068864_100004551 Ga0068864_1000045513 239
160 3300005719 Ga0068861_100037255 Ga0068861_1000372554 239
161 3300005842 Ga0068858_100154194 Ga0068858_1001541942 239
162 3300005843 Ga0068860_100986410 Ga0068860_1009864101 239
163 3300005844 Ga0068862_100021830 Ga0068862_1000218306 239
164 3300005937 Ga0081455_10259521 Ga0081455_102595212 239
165 3300005981 Ga0081538_10002361 Ga0081538_1000236114 239
166 3300005981 Ga0081538_10010362 Ga0081538_100103623 239
167 3300006058 Ga0075432_10031466 Ga0075432_100314661 239
168 3300006173 Ga0070716_100110409 Ga0070716_1001104092 239
169 3300006175 Ga0070712_100009980 Ga0070712_1000099803 239
170 3300006175 Ga0070712_100030243 Ga0070712_1000302434 239
171 3300006175 Ga0070712_100168462 Ga0070712_1001684622 239
172 3300006847 Ga0075431_100020305 Ga0075431_1000203056 239
173 3300006871 Ga0075434_100123029 Ga0075434_1001230293 239
174 3300006881 Ga0068865_100055468 Ga0068865_1000554684 239
175 3300006881 Ga0068865_100113836 Ga0068865_1001138364 239
176 3300006914 Ga0075436_100154156 Ga0075436_1001541562 239
177 3300009094 Ga0111539_10056477 Ga0111539_100564773 239
178 3300009098 Ga0105245_10020165 Ga0105245_100201654 239
179 3300009147 Ga0114129_10492555 Ga0114129_104925552 239
180 3300009148 Ga0105243_10015197 Ga0105243_100151976 239
181 3300009174 Ga0105241_10108344 Ga0105241_101083442 239
182 3300009176 Ga0105242_10153008 Ga0105242_101530081 239
183 3300009176 Ga0105242_10288086 Ga0105242_102880861 239
184 3300009177 Ga0105248_10198120 Ga0105248_101981204 239
185 3300009545 Ga0105237_10000657 Ga0105237_1000065724 239
186 3300009545 Ga0105237_10623440 Ga0105237_106234401 239
187 3300009551 Ga0105238_10241515 Ga0105238_102415152 239
188 3300009553 Ga0105249_10027597 Ga0105249_100275973 239
189 3300009553 Ga0105249_10053091 Ga0105249_100530913 239
190 3300009553 Ga0105249_10308339 Ga0105249_103083392 239
191 3300010375 Ga0105239_10024017 Ga0105239_100240175 239
192 3300010375 Ga0105239_10071903 Ga0105239_100719036 239
193 3300011119 Ga0105246_10015182 Ga0105246_100151823 239
194 3300013105 Ga0157369_10533448 Ga0157369_105334482 239
195 3300013306 Ga0163162_10015840 Ga0163162_100158407 239
196 3300013307 Ga0157372_10128444 Ga0157372_101284444 239
197 3300013307 Ga0157372_10194529 Ga0157372_101945293 239
198 3300013307 Ga0157372_10541446 Ga0157372_105414463 239
199 3300013308 Ga0157375_10264449 Ga0157375_102644491 239
200 3300014326 Ga0157380_10507022 Ga0157380_105070221 239
201 3300014745 Ga0157377_10052627 Ga0157377_100526273 239
202 3300014745 Ga0157377_10215060 Ga0157377_102150602 239
203 3300014968 Ga0157379_10301602 Ga0157379_103016022 239
204 3300025898 Ga0207692_10134854 Ga0207692_101348541 239
205 3300025899 Ga0207642_10009991 Ga0207642_100099914 239
206 3300025901 Ga0207688_10045551 Ga0207688_100455513 239
207 3300025914 Ga0207671_10000926 Ga0207671_1000092618 239
208 3300025915 Ga0207693_10029817 Ga0207693_100298174 239
209 3300025915 Ga0207693_10086580 Ga0207693_100865803 239
210 3300025917 Ga0207660_10438950 Ga0207660_104389502 239
211 3300025918 Ga0207662_10173207 Ga0207662_101732071 239
212 3300025927 Ga0207687_10086272 Ga0207687_100862722 239
213 3300025927 Ga0207687_10154207 Ga0207687_101542071 239
214 3300025927 Ga0207687_10454875 Ga0207687_104548751 239
215 3300025929 Ga0207664_10455106 Ga0207664_104551062 239
216 3300025933 Ga0207706_10017699 Ga0207706_100176992 239
217 3300025933 Ga0207706_10236559 Ga0207706_102365592 239
218 3300025935 Ga0207709_10009725 Ga0207709_100097252 239
219 3300025936 Ga0207670_10375066 Ga0207670_103750661 239
220 3300025938 Ga0207704_10073723 Ga0207704_100737231 239
221 3300025940 Ga0207691_10648021 Ga0207691_106480211 239
222 3300025944 Ga0207661_10036293 Ga0207661_100362936 239
223 3300025944 Ga0207661_10113393 Ga0207661_101133931 239
224 3300025944 Ga0207661_10251726 Ga0207661_102517263 239
225 3300025945 Ga0207679_10247430 Ga0207679_102474303 239
226 3300025960 Ga0207651_10275389 Ga0207651_102753892 239
227 3300025972 Ga0207668_10242192 Ga0207668_102421923 239
228 3300025972 Ga0207668_10573558 Ga0207668_105735582 239
229 3300025981 Ga0207640_10007054 Ga0207640_100070547 239
230 3300025986 Ga0207658_10341333 Ga0207658_103413331 239
231 3300025986 Ga0207658_10705537 Ga0207658_107055371 239
232 3300026023 Ga0207677_10040228 Ga0207677_100402283 239
233 3300026035 Ga0207703_10690786 Ga0207703_106907862 239
234 3300026041 Ga0207639_10614526 Ga0207639_106145262 239
235 3300026075 Ga0207708_10000271 Ga0207708_1000027114 239
236 3300026078 Ga0207702_10150964 Ga0207702_101509642 239
237 3300026089 Ga0207648_10039960 Ga0207648_100399605 239
238 3300026089 Ga0207648_10192125 Ga0207648_101921253 239
239 3300026095 Ga0207676_10038215 Ga0207676_100382155 239
240 3300026118 Ga0207675_100001271 Ga0207675_10000127117 239
241 3300026118 Ga0207675_100533098 Ga0207675_1005330982 239
242 3300026121 Ga0207683_10029961 Ga0207683_100299614 239
243 3300027907 Ga0207428_10039285 Ga0207428_100392852 239
244 3300028379 Ga0268266_10425510 Ga0268266_104255102 239
245 3300028379 Ga0268266_10911346 Ga0268266_109113461 239
246 3300028556 Ga0265337_1000793 Ga0265337_10007938 239
247 3300028558 Ga0265326_10000759 Ga0265326_100007598 239
248 3300028563 Ga0265319_1009092 Ga0265319_10090922 239
249 3300028577 Ga0265318_10001005 Ga0265318_100010058 239
250 3300028666 Ga0265336_10000002 Ga0265336_10000002792 239
251 3300028800 Ga0265338_10000001 Ga0265338_1000000120 239
252 3300029957 Ga0265324_10002017 Ga0265324_100020177 239
253 3300031247 Ga0265340_10000001 Ga0265340_1000000120 239
254 3300031249 Ga0265339_10058266 Ga0265339_100582662 239
255 3300031344 Ga0265316_10106406 Ga0265316_101064063 239
256 3300031344 Ga0265316_10119166 Ga0265316_101191662 239
257 3300031824 Ga0307413_10084506 Ga0307413_100845063 239
258 3300031852 Ga0307410_10035101 Ga0307410_100351014 239
259 3300031901 Ga0307406_10088844 Ga0307406_100888442 239
260 3300031903 Ga0307407_10031031 Ga0307407_100310314 239
261 3300031995 Ga0307409_100212248 Ga0307409_1002122482 239
262 3300032002 Ga0307416_100046330 Ga0307416_1000463305 239
263 3300032002 Ga0307416_100225973 Ga0307416_1002259733 239
264 3300032126 Ga0307415_100082568 Ga0307415_1000825681 239
265 3300032126 Ga0307415_100255686 Ga0307415_1002556862 239
266 3300037312 Ga0395899_0045455 Ga0395899_0045455_2069_2791 239
267 3300037312 Ga0395899_0125075 Ga0395899_0125075_614_1339 239
268 3300037418 Ga0395900_0009689 Ga0395900_0009689_1998_2720 239
269 3300037418 Ga0395900_0181729 Ga0395900_0181729_1036_1758 239
270 3300037466 Ga0395898_0001341 Ga0395898_0001341_21955_22680 239
271 3300037466 Ga0395898_0005316 Ga0395898_0005316_2217_2939 239
272 3300037466 Ga0395898_0058361 Ga0395898_0058361_2575_3297 239
273 3300037466 Ga0395898_0211511 Ga0395898_0211511_688_1410 239
274 3300037466 Ga0395898_0341992 Ga0395898_0341992_408_1139 239
275 3300037471 Ga0395905_0005729 Ga0395905_0005729_3981_4706 239
276 3300037471 Ga0395905_0008408 Ga0395905_0008408_7246_7968 239
277 3300038443 Ga0395901_0002458 Ga0395901_0002458_15498_16223 239
278 3300038443 Ga0395901_0008767 Ga0395901_0008767_2258_2980 239
279 3300038443 Ga0395901_0020861 Ga0395901_0020861_4791_5522 239
280 3300038443 Ga0395901_0132425 Ga0395901_0132425_1118_1840 239
281 3300038443 Ga0395901_0236684 Ga0395901_0236684_1100_1825 239
282 3300038443 Ga0395901_0268496 Ga0395901_0268496_710_1435 239
283 3300038443 Ga0395901_0314197 Ga0395901_0314197_850_1572 239
284 3300042461 Ga0439460_0035035 Ga0439460_0035035_23_745 239
285 3300046454 Ga0495592_0100343 Ga0495592_0100343_691_1416 239
286 3300048903 Ga0496100_0013794 Ga0496100_0013794_3675_4415 239
287 3300048905 Ga0496102_0148943 Ga0496102_0148943_234_968 239
288 3300048905 Ga0496102_0221828 Ga0496102_0221828_77_811 239
289 3300048907 Ga0496104_0026687 Ga0496104_0026687_1933_2667 239
290 3300048909 Ga0496106_0452565 Ga0496106_0452565_79_813 239
291 3300048910 Ga0496107_0086120 Ga0496107_0086120_299_1033 239
292 3300048912 Ga0496109_0255807 Ga0496109_0255807_171_905 239
293 3300048913 Ga0496110_0096273 Ga0496110_0096273_334_1068 239
294 3300048915 Ga0496112_0021407 Ga0496112_0021407_5393_6127 239
295 3300048915 Ga0496112_0256506 Ga0496112_0256506_639_1364 239
296 3300048917 Ga0496114_0244027 Ga0496114_0244027_687_1421 239
297 3300049587 Ga0501071_0048246 Ga0501071_0048246_360_1136 239
298 3300049591 Ga0501075_0005673 Ga0501075_0005673_2263_3039 239
299 3300050507 nmdc:mga05p37_247397_c1 nmdc:mga05p37_247397_c1_1250_1990 239
300 3300050510 nmdc:mga06r32_47375_c1 nmdc:mga06r32_47375_c1_348_1088 239
301 3300050511 nmdc:mga08y16_60254_c1 nmdc:mga08y16_60254_c1_719_1459 239
302 3300050512 nmdc:mga0n895_402252_c1 nmdc:mga0n895_402252_c1_526_1266 239
303 3300050513 nmdc:mga0rr50_245943_c1 nmdc:mga0rr50_245943_c1_636_1376 239
304 3300050514 nmdc:mga08x19_40189_c1 nmdc:mga08x19_40189_c1_1575_2315 239
305 3300053077 Ga0495601_0000363 Ga0495601_0000363_20712_21437 239
306 3300053085 Ga0495619_0201928 Ga0495619_0201928_171_893 239
307 iso_pu_bacteria 2721755487 2722726849 239
308 3300005981 Ga0081538_10000391 Ga0081538_100003919 240
309 3300005981 Ga0081538_10000700 Ga0081538_1000070032 240
310 3300037312 Ga0395899_0002789 Ga0395899_0002789_12440_13171 240
311 3300037418 Ga0395900_0002952 Ga0395900_0002952_6615_7346 240
312 3300037418 Ga0395900_0399874 Ga0395900_0399874_380_1111 240
313 3300037466 Ga0395898_0004911 Ga0395898_0004911_4980_5711 240
314 3300037466 Ga0395898_0242324 Ga0395898_0242324_32_763 240
315 3300037471 Ga0395905_0003391 Ga0395905_0003391_5107_5838 240
316 3300038443 Ga0395901_0004024 Ga0395901_0004024_2959_3690 240
317 3300038443 Ga0395901_0313103 Ga0395901_0313103_93_824 240
318 3300049822 Ga0501035_0143020 Ga0501035_0143020_1132_1869 240
319 3300025304 Ga0209257_1000008 Ga0209257_1000008520 241
320 3300048919 Ga0496116_0002384 Ga0496116_0002384_2652_3389 243
321 3300048920 Ga0496117_0004082 Ga0496117_0004082_9851_10588 243
322 3300048925 Ga0496122_0017301 Ga0496122_0017301_4894_5631 243
323 3300048927 Ga0496124_0188309 Ga0496124_0188309_788_1525 243
324 3300048928 Ga0496125_0137475 Ga0496125_0137475_68_805 243
325 2162886007 SwRhRL2b_contig_1561607 SwRhRL2b_0005.00001300 246
326 2162886007 SwRhRL2b_contig_2107601 SwRhRL2b_0570.00007790 246
327 3300005289 Ga0065704_10090814 Ga0065704_100908142 246
328 3300009148 Ga0105243_10000006 Ga0105243_10000006191 246
329 3300025935 Ga0207709_10000007 Ga0207709_10000007430 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

31

230

0.9

PF00149

Metallophos

Calcineurin-like phosphoesterase

30

194

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8317 3 240
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8249 3 240
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8115 3 243
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8031 3 240
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7967 3 240
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8253 5 241 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8252 3 240 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8115 3 243 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.809 5 241 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7971 3 240 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1T5BY85-F1-model_v4 Predicted phosphodiesterase 0.9848 1 240 GO:0005737
GO:0016791
AF-A0A348Y657-F1-model_v4 deleted 0.983 3 242
AF-A0A4U9K1M3-F1-model_v4 deleted 0.9743 3 240
AF-A0A420CDM6-F1-model_v4 Putative phosphodiesterase 0.9734 3 236 GO:0005737
GO:0016791
AF-A0A1H5XIS1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9713 3 241 GO:0005737
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map