F409660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 329 | 192 | 329 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10038578|Ga0157369_100385783 |
| Length | 462 |
| Sequence | VAERELEVGNTDHAADPLAAFATDRHGDAARSGSSRKRAIGRAGKSPAPDVESMPRKRLSDMRVCFLFNHDQVHQVAHSLPIALALADHAPDVQVILAPTNPRIQTEVVRLAGSRLRDNLILHPLHLNRFRSRALAMLTEPFAPAHKLLIYGDNLDFFRSLDTLVVAEKTSLVLKTRYDLDRLKIIHTRHGAGDRAIGFNPASAQFDHVLVSGDKIRRRLIADAGVAPEKISVVGYPKFDLNGMSRPHALIDSGRPVVLYNPHVSPHLSSWYKMGREVLDWFVEHDEYQLIFAPHVMLFERSFALTVDKLRIDRPGRIDERYLRAPNIHIDLGSRASSNMTYTNRADIYLGDVSSQIYEFLLNPRPCVFLDAHETDWVDDQNYAHWRSGPVIDDPDRLEDALSEAMRDPGGRYAAAQKQLFDDTFDLTDKPSSLRAAEAVARVTGFELSAPEPRTARRRINA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 118 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 119 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 134 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 135 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 136 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 166 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 167 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 172 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 181 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 182 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 184 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 185 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 186 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 188 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 190 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.81 |
| Nodule | 0 |
| Rhizoplane | 2.43 |
| Rhizosphere | 82.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002398 | 3300001976 | Bacteria | 2492 |
| 2 | JGI24737J22298_10003417 | 3300001990 | Bacteria | 5615 |
| 3 | JGI24737J22298_10006083 | 3300001990 | Bacteria | 4136 |
| 4 | JGI24737J22298_10008821 | 3300001990 | Bacteria | 3366 |
| 5 | JGI24735J21928_10005746 | 3300002067 | Bacteria | 4102 |
| 6 | JGI24735J21928_10007217 | 3300002067 | Bacteria | 3626 |
| 7 | JGI24735J21928_10014977 | 3300002067 | Bacteria | 2423 |
| 8 | JGI24738J21930_10000070 | 3300002075 | Bacteria | 21714 |
| 9 | JGI24034J26672_10009761 | 3300002239 | Bacteria | 1419 |
| 10 | JGI25164J39214_1004248 | 3300002772 | Bacteria | 1671 |
| 11 | JGI25165J46597_1000350 | 3300003214 | Bacteria | 52046 |
| 12 | rootH1_10146678 | 3300003323 | Bacteria | 1877 |
| 13 | Ga0055542_1001554 | 3300003762 | Bacteria | 10815 |
| 14 | Ga0055530_10000026 | 3300003791 | Bacteria | 129960 |
| 15 | Ga0055531_10001705 | 3300003794 | Bacteria | 15761 |
| 16 | Ga0058860_10028125 | 3300004801 | Unclassified | 2754 |
| 17 | Ga0065165_1000803 | 3300005262 | Bacteria | 41890 |
| 18 | Ga0070658_10000265 | 3300005327 | Bacteria | 46194 |
| 19 | Ga0070658_10005263 | 3300005327 | Bacteria | 10509 |
| 20 | Ga0070670_100020256 | 3300005331 | Bacteria | 5715 |
| 21 | Ga0070670_100024122 | 3300005331 | Bacteria | 5233 |
| 22 | Ga0070670_100046938 | 3300005331 | Bacteria | 3716 |
| 23 | Ga0070666_10000098 | 3300005335 | Bacteria | 59878 |
| 24 | Ga0070666_10031536 | 3300005335 | Bacteria | 3498 |
| 25 | Ga0070680_100001930 | 3300005336 | Bacteria | 15238 |
| 26 | Ga0070680_100216293 | 3300005336 | Bacteria | 1617 |
| 27 | Ga0068868_100000102 | 3300005338 | Bacteria | 52814 |
| 28 | Ga0070660_100002070 | 3300005339 | Bacteria | 13857 |
| 29 | Ga0070660_100004060 | 3300005339 | Bacteria | 10097 |
| 30 | Ga0070660_100013777 | 3300005339 | Bacteria | 5816 |
| 31 | Ga0070660_100059743 | 3300005339 | Bacteria | 2957 |
| 32 | Ga0070668_100000005 | 3300005347 | Bacteria | 187511 |
| 33 | Ga0070668_100000159 | 3300005347 | Bacteria | 42625 |
| 34 | Ga0070668_100002375 | 3300005347 | Bacteria | 13824 |
| 35 | Ga0070668_100009484 | 3300005347 | Bacteria | 7222 |
| 36 | Ga0070668_100012390 | 3300005347 | Bacteria | 6349 |
| 37 | Ga0070669_100000029 | 3300005353 | Bacteria | 163005 |
| 38 | Ga0070669_100004604 | 3300005353 | Bacteria | 9958 |
| 39 | Ga0070671_100000016 | 3300005355 | Bacteria | 156166 |
| 40 | Ga0070671_100000027 | 3300005355 | Bacteria | 114189 |
| 41 | Ga0070671_100000365 | 3300005355 | Bacteria | 31264 |
| 42 | Ga0070671_100021975 | 3300005355 | Bacteria | 5211 |
| 43 | Ga0070671_100045111 | 3300005355 | Bacteria | 3664 |
| 44 | Ga0070674_100167118 | 3300005356 | Bacteria | 1674 |
| 45 | Ga0070673_100149660 | 3300005364 | Bacteria | 1976 |
| 46 | Ga0070659_100008170 | 3300005366 | Bacteria | 7634 |
| 47 | Ga0070659_100021934 | 3300005366 | Bacteria | 4872 |
| 48 | Ga0070659_100183190 | 3300005366 | Bacteria | 1719 |
| 49 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 50 | Ga0070667_100000120 | 3300005367 | Bacteria | 99936 |
| 51 | Ga0070667_100005241 | 3300005367 | Bacteria | 10839 |
| 52 | Ga0070667_100039525 | 3300005367 | Bacteria | 3954 |
| 53 | Ga0070708_100023434 | 3300005445 | Bacteria | 5250 |
| 54 | Ga0070663_100002287 | 3300005455 | Bacteria | 10737 |
| 55 | Ga0070678_100003080 | 3300005456 | Bacteria | 9241 |
| 56 | Ga0070681_10001467 | 3300005458 | Bacteria | 20801 |
| 57 | Ga0070679_100010790 | 3300005530 | Bacteria | 8675 |
| 58 | Ga0068853_100009038 | 3300005539 | Bacteria | 8025 |
| 59 | Ga0068853_100076752 | 3300005539 | Bacteria | 2918 |
| 60 | Ga0068853_100089829 | 3300005539 | Bacteria | 2699 |
| 61 | Ga0068853_100302130 | 3300005539 | Bacteria | 1479 |
| 62 | Ga0070672_100046080 | 3300005543 | Bacteria | 3377 |
| 63 | Ga0070686_100029286 | 3300005544 | Bacteria | 3348 |
| 64 | Ga0070665_100000884 | 3300005548 | Bacteria | 38426 |
| 65 | Ga0070665_100023804 | 3300005548 | Bacteria | 6169 |
| 66 | Ga0070665_100033359 | 3300005548 | Bacteria | 5181 |
| 67 | Ga0068855_100000036 | 3300005563 | Bacteria | 162849 |
| 68 | Ga0068855_100006244 | 3300005563 | Bacteria | 14529 |
| 69 | Ga0068855_100072830 | 3300005563 | Bacteria | 3993 |
| 70 | Ga0068855_100162136 | 3300005563 | Bacteria | 2537 |
| 71 | Ga0070664_100091423 | 3300005564 | Bacteria | 2634 |
| 72 | Ga0068857_100127383 | 3300005577 | Bacteria | 2295 |
| 73 | Ga0068854_100000445 | 3300005578 | Bacteria | 25570 |
| 74 | Ga0068854_100004266 | 3300005578 | Bacteria | 9007 |
| 75 | Ga0068854_100011660 | 3300005578 | Bacteria | 5733 |
| 76 | Ga0068856_100004545 | 3300005614 | Bacteria | 13792 |
| 77 | Ga0068856_100033631 | 3300005614 | Bacteria | 5021 |
| 78 | Ga0068852_100000383 | 3300005616 | Bacteria | 29748 |
| 79 | Ga0068859_100000093 | 3300005617 | Bacteria | 82384 |
| 80 | Ga0068859_100003218 | 3300005617 | Bacteria | 16624 |
| 81 | Ga0068859_100047324 | 3300005617 | Bacteria | 4321 |
| 82 | Ga0068864_100000616 | 3300005618 | Bacteria | 29988 |
| 83 | Ga0068864_100002750 | 3300005618 | Bacteria | 14504 |
| 84 | Ga0068864_100007265 | 3300005618 | Bacteria | 9110 |
| 85 | Ga0068861_100017816 | 3300005719 | Bacteria | 5047 |
| 86 | Ga0068863_100000053 | 3300005841 | Bacteria | 125195 |
| 87 | Ga0068863_100000180 | 3300005841 | Bacteria | 67219 |
| 88 | Ga0068863_100000282 | 3300005841 | Bacteria | 52485 |
| 89 | Ga0068863_100034391 | 3300005841 | Bacteria | 4828 |
| 90 | Ga0068863_100052405 | 3300005841 | Bacteria | 3867 |
| 91 | Ga0068858_100000219 | 3300005842 | Bacteria | 61717 |
| 92 | Ga0068858_100007702 | 3300005842 | Bacteria | 10395 |
| 93 | Ga0068858_100010802 | 3300005842 | Bacteria | 8632 |
| 94 | Ga0068858_100018870 | 3300005842 | Bacteria | 6453 |
| 95 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 96 | Ga0068860_100007191 | 3300005843 | Bacteria | 11131 |
| 97 | Ga0068860_100023577 | 3300005843 | Bacteria | 5948 |
| 98 | Ga0068860_100027357 | 3300005843 | Bacteria | 5494 |
| 99 | Ga0068862_100000577 | 3300005844 | Bacteria | 38216 |
| 100 | Ga0068862_100000606 | 3300005844 | Bacteria | 37254 |
| 101 | Ga0068862_100001608 | 3300005844 | Bacteria | 20576 |
| 102 | Ga0068862_100004057 | 3300005844 | Bacteria | 12414 |
| 103 | Ga0097621_100159864 | 3300006237 | Bacteria | 1936 |
| 104 | Ga0075370_10082189 | 3300006353 | Bacteria | 1852 |
| 105 | Ga0068871_100027792 | 3300006358 | Bacteria | 4428 |
| 106 | Ga0097620_100000093 | 3300006931 | Bacteria | 82384 |
| 107 | Ga0097620_100003218 | 3300006931 | Bacteria | 16624 |
| 108 | Ga0097620_100047324 | 3300006931 | Bacteria | 4321 |
| 109 | Ga0105240_10034214 | 3300009093 | Bacteria | 6557 |
| 110 | Ga0105240_10173228 | 3300009093 | Bacteria | 2553 |
| 111 | Ga0105247_10000521 | 3300009101 | Bacteria | 31494 |
| 112 | Ga0114129_10373974 | 3300009147 | Unclassified | 1883 |
| 113 | Ga0105241_10070428 | 3300009174 | Bacteria | 2713 |
| 114 | Ga0105248_10004083 | 3300009177 | Bacteria | 16147 |
| 115 | Ga0105248_10014533 | 3300009177 | Bacteria | 8666 |
| 116 | Ga0105248_10104685 | 3300009177 | Bacteria | 3190 |
| 117 | Ga0105238_10009868 | 3300009551 | Bacteria | 9568 |
| 118 | Ga0105238_10247551 | 3300009551 | Bacteria | 1760 |
| 119 | Ga0105249_10012133 | 3300009553 | Bacteria | 7585 |
| 120 | Ga0105239_10026072 | 3300010375 | Bacteria | 6435 |
| 121 | Ga0157370_10000140 | 3300013104 | Bacteria | 87498 |
| 122 | Ga0157370_10078577 | 3300013104 | Bacteria | 3107 |
| 123 | Ga0157369_10038578 | 3300013105 | Bacteria | 5223 |
| 124 | Ga0157369_10120641 | 3300013105 | Bacteria | 2782 |
| 125 | Ga0157372_10001499 | 3300013307 | Bacteria | 25376 |
| 126 | Ga0157372_10105546 | 3300013307 | Bacteria | 3222 |
| 127 | Ga0157372_10163715 | 3300013307 | Bacteria | 2571 |
| 128 | Ga0157372_10209061 | 3300013307 | Bacteria | 2261 |
| 129 | Ga0163163_10006973 | 3300014325 | Bacteria | 9926 |
| 130 | Ga0163163_10027728 | 3300014325 | Bacteria | 5430 |
| 131 | Ga0163163_10130113 | 3300014325 | Bacteria | 2557 |
| 132 | Ga0157379_10013898 | 3300014968 | Bacteria | 7057 |
| 133 | Ga0157379_10022527 | 3300014968 | Bacteria | 5579 |
| 134 | Ga0207427_101805 | 3300025231 | Bacteria | 6867 |
| 135 | Ga0209026_1006687 | 3300025250 | Bacteria | 2767 |
| 136 | Ga0209148_1000114 | 3300025254 | Bacteria | 192073 |
| 137 | Ga0209148_1000579 | 3300025254 | Bacteria | 33716 |
| 138 | Ga0209233_1000319 | 3300025261 | Bacteria | 52404 |
| 139 | Ga0209455_1000804 | 3300025272 | Bacteria | 17250 |
| 140 | Ga0209758_1000261 | 3300025297 | Bacteria | 104423 |
| 141 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 142 | Ga0209257_1000152 | 3300025304 | Bacteria | 189432 |
| 143 | Ga0207697_10000164 | 3300025315 | Bacteria | 33417 |
| 144 | Ga0207710_10002428 | 3300025900 | Bacteria | 8663 |
| 145 | Ga0207680_10000130 | 3300025903 | Bacteria | 35102 |
| 146 | Ga0207680_10019694 | 3300025903 | Bacteria | 3614 |
| 147 | Ga0207680_10042019 | 3300025903 | Bacteria | 2672 |
| 148 | Ga0207647_10002272 | 3300025904 | Bacteria | 14639 |
| 149 | Ga0207647_10052468 | 3300025904 | Bacteria | 2517 |
| 150 | Ga0207647_10064154 | 3300025904 | Bacteria | 2232 |
| 151 | Ga0207705_10000014 | 3300025909 | Bacteria | 434286 |
| 152 | Ga0207705_10000244 | 3300025909 | Bacteria | 53451 |
| 153 | Ga0207705_10001275 | 3300025909 | Bacteria | 20220 |
| 154 | Ga0207705_10018191 | 3300025909 | Bacteria | 5024 |
| 155 | Ga0207707_10031964 | 3300025912 | Bacteria | 4607 |
| 156 | Ga0207695_10201366 | 3300025913 | Bacteria | 1905 |
| 157 | Ga0207671_10168487 | 3300025914 | Bacteria | 1699 |
| 158 | Ga0207660_10009044 | 3300025917 | Bacteria | 6450 |
| 159 | Ga0207660_10100676 | 3300025917 | Bacteria | 2158 |
| 160 | Ga0207657_10000103 | 3300025919 | Bacteria | 82031 |
| 161 | Ga0207657_10000314 | 3300025919 | Bacteria | 51222 |
| 162 | Ga0207657_10018618 | 3300025919 | Bacteria | 6620 |
| 163 | Ga0207657_10057869 | 3300025919 | Bacteria | 3339 |
| 164 | Ga0207657_10068970 | 3300025919 | Bacteria | 3002 |
| 165 | Ga0207652_10009397 | 3300025921 | Bacteria | 7863 |
| 166 | Ga0207681_10000040 | 3300025923 | Bacteria | 147547 |
| 167 | Ga0207681_10003306 | 3300025923 | Bacteria | 10093 |
| 168 | Ga0207694_10080593 | 3300025924 | Bacteria | 2555 |
| 169 | Ga0207650_10004812 | 3300025925 | Bacteria | 9223 |
| 170 | Ga0207650_10005576 | 3300025925 | Bacteria | 8596 |
| 171 | Ga0207650_10008678 | 3300025925 | Bacteria | 6943 |
| 172 | Ga0207650_10010011 | 3300025925 | Bacteria | 6491 |
| 173 | Ga0207650_10230189 | 3300025925 | Unclassified | 1494 |
| 174 | Ga0207644_10000023 | 3300025931 | Bacteria | 156180 |
| 175 | Ga0207644_10000029 | 3300025931 | Bacteria | 139264 |
| 176 | Ga0207644_10000931 | 3300025931 | Bacteria | 18604 |
| 177 | Ga0207644_10085621 | 3300025931 | Bacteria | 2338 |
| 178 | Ga0207690_10012940 | 3300025932 | Bacteria | 5000 |
| 179 | Ga0207690_10072096 | 3300025932 | Bacteria | 2385 |
| 180 | Ga0207706_10012389 | 3300025933 | Bacteria | 7768 |
| 181 | Ga0207669_10042877 | 3300025937 | Bacteria | 2645 |
| 182 | Ga0207669_10055215 | 3300025937 | Bacteria | 2404 |
| 183 | Ga0207711_10006265 | 3300025941 | Bacteria | 10037 |
| 184 | Ga0207711_10018479 | 3300025941 | Bacteria | 5796 |
| 185 | Ga0207679_10090367 | 3300025945 | Bacteria | 2367 |
| 186 | Ga0207679_10096532 | 3300025945 | Bacteria | 2300 |
| 187 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 188 | Ga0207667_10004546 | 3300025949 | Bacteria | 16998 |
| 189 | Ga0207667_10094970 | 3300025949 | Bacteria | 3078 |
| 190 | Ga0207712_10033277 | 3300025961 | Bacteria | 3484 |
| 191 | Ga0207712_10077120 | 3300025961 | Bacteria | 2414 |
| 192 | Ga0207668_10000008 | 3300025972 | Bacteria | 189904 |
| 193 | Ga0207668_10000027 | 3300025972 | Bacteria | 125575 |
| 194 | Ga0207668_10000046 | 3300025972 | Bacteria | 102051 |
| 195 | Ga0207668_10000754 | 3300025972 | Bacteria | 19803 |
| 196 | Ga0207668_10002237 | 3300025972 | Bacteria | 11293 |
| 197 | Ga0207668_10159338 | 3300025972 | Unclassified | 1757 |
| 198 | Ga0207640_10001005 | 3300025981 | Bacteria | 15622 |
| 199 | Ga0207640_10008159 | 3300025981 | Bacteria | 5800 |
| 200 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 201 | Ga0207658_10000091 | 3300025986 | Bacteria | 99970 |
| 202 | Ga0207658_10003130 | 3300025986 | Bacteria | 11838 |
| 203 | Ga0207658_10030731 | 3300025986 | Bacteria | 3806 |
| 204 | Ga0207677_10000168 | 3300026023 | Bacteria | 52215 |
| 205 | Ga0207703_10000675 | 3300026035 | Bacteria | 34030 |
| 206 | Ga0207703_10007167 | 3300026035 | Bacteria | 8871 |
| 207 | Ga0207703_10009218 | 3300026035 | Bacteria | 7763 |
| 208 | Ga0207639_10034889 | 3300026041 | Bacteria | 3721 |
| 209 | Ga0207639_10226275 | 3300026041 | Bacteria | 1618 |
| 210 | Ga0207678_10010133 | 3300026067 | Bacteria | 8270 |
| 211 | Ga0207702_10206646 | 3300026078 | Bacteria | 1823 |
| 212 | Ga0207641_10000093 | 3300026088 | Bacteria | 125747 |
| 213 | Ga0207641_10000376 | 3300026088 | Bacteria | 53079 |
| 214 | Ga0207641_10004749 | 3300026088 | Bacteria | 11713 |
| 215 | Ga0207648_10208820 | 3300026089 | Bacteria | 1733 |
| 216 | Ga0207676_10000933 | 3300026095 | Bacteria | 22598 |
| 217 | Ga0207676_10002964 | 3300026095 | Bacteria | 12109 |
| 218 | Ga0207676_10004142 | 3300026095 | Bacteria | 10239 |
| 219 | Ga0207674_10144108 | 3300026116 | Bacteria | 2341 |
| 220 | Ga0207675_100000582 | 3300026118 | Bacteria | 35705 |
| 221 | Ga0207683_10027500 | 3300026121 | Bacteria | 4914 |
| 222 | Ga0207698_10000314 | 3300026142 | Bacteria | 28948 |
| 223 | Ga0268266_10061870 | 3300028379 | Bacteria | 3229 |
| 224 | Ga0268265_10000098 | 3300028380 | Bacteria | 110108 |
| 225 | Ga0268265_10000441 | 3300028380 | Bacteria | 43786 |
| 226 | Ga0268265_10000872 | 3300028380 | Bacteria | 28294 |
| 227 | Ga0268265_10003990 | 3300028380 | Bacteria | 10391 |
| 228 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 229 | Ga0268264_10000141 | 3300028381 | Bacteria | 170966 |
| 230 | Ga0268264_10192322 | 3300028381 | Bacteria | 1861 |
| 231 | Ga0307517_10076569 | 3300028786 | Bacteria | 2920 |
| 232 | Ga0307513_10009979 | 3300031456 | Bacteria | 11979 |
| 233 | Ga0307408_100055922 | 3300031548 | Bacteria | 2859 |
| 234 | Ga0316576_10065479 | 3300031727 | Bacteria | 2671 |
| 235 | Ga0316578_10039740 | 3300031728 | Bacteria | 2718 |
| 236 | Ga0307516_10000006 | 3300031730 | Bacteria | 298586 |
| 237 | Ga0307413_10017701 | 3300031824 | Bacteria | 3718 |
| 238 | Ga0307409_100046712 | 3300031995 | Bacteria | 3280 |
| 239 | Ga0307416_100026897 | 3300032002 | Bacteria | 4248 |
| 240 | Ga0307411_10038097 | 3300032005 | Bacteria | 3029 |
| 241 | Ga0307415_100046983 | 3300032126 | Bacteria | 2903 |
| 242 | Ga0307510_10014136 | 3300033180 | Bacteria | 9454 |
| 243 | Ga0316574_0022693 | 3300035398 | Bacteria | 3741 |
| 244 | Ga0316584_0040614 | 3300036712 | Bacteria | 3467 |
| 245 | Ga0395899_0000730 | 3300037312 | Bacteria | 32812 |
| 246 | Ga0395899_0002840 | 3300037312 | Bacteria | 13955 |
| 247 | Ga0395900_0017495 | 3300037418 | Bacteria | 7315 |
| 248 | Ga0395905_0011424 | 3300037471 | Bacteria | 8580 |
| 249 | Ga0395901_0025052 | 3300038443 | Bacteria | 6124 |
| 250 | Ga0395901_0043531 | 3300038443 | Bacteria | 4657 |
| 251 | Ga0436365_1136680 | 3300039437 | Bacteria | 7894 |
| 252 | Ga0451807_0455910 | 3300041486 | Bacteria | 5209 |
| 253 | Ga0439448_0000224 | 3300042005 | Bacteria | 12036 |
| 254 | Ga0439448_0001905 | 3300042005 | Bacteria | 5555 |
| 255 | Ga0439455_0000045 | 3300042012 | Bacteria | 10891 |
| 256 | Ga0439455_0000134 | 3300042012 | Bacteria | 7861 |
| 257 | Ga0439458_0000076 | 3300042157 | Bacteria | 18372 |
| 258 | Ga0466972_0003004 | 3300044658 | Bacteria | 8359 |
| 259 | Ga0466966_0076795 | 3300044684 | Bacteria | 2085 |
| 260 | Ga0466961_0011620 | 3300044693 | Bacteria | 5627 |
| 261 | Ga0466963_0067190 | 3300044694 | Bacteria | 2406 |
| 262 | Ga0466971_0068117 | 3300044719 | Bacteria | 1614 |
| 263 | Ga0466957_0009785 | 3300044842 | Bacteria | 5480 |
| 264 | Ga0466957_0098555 | 3300044842 | Bacteria | 1839 |
| 265 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 266 | Ga0466958_0011829 | 3300045836 | Bacteria | 4927 |
| 267 | Ga0466967_0027268 | 3300045976 | Bacteria | 4749 |
| 268 | Ga0495638_0000487 | 3300046460 | Bacteria | 47499 |
| 269 | Ga0495650_0006928 | 3300046471 | Bacteria | 6937 |
| 270 | Ga0495606_0074289 | 3300046507 | Bacteria | 2130 |
| 271 | Ga0495610_0001057 | 3300046512 | Bacteria | 25299 |
| 272 | Ga0495610_0051292 | 3300046512 | Bacteria | 2009 |
| 273 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 274 | Ga0495648_0000229 | 3300046524 | Bacteria | 64205 |
| 275 | Ga0495654_0030904 | 3300046530 | Bacteria | 2721 |
| 276 | Ga0495622_0005805 | 3300046557 | Bacteria | 5726 |
| 277 | Ga0495668_0033502 | 3300046616 | Bacteria | 2886 |
| 278 | Ga0495668_0114598 | 3300046616 | Bacteria | 1474 |
| 279 | Ga0495625_0044857 | 3300046660 | Bacteria | 3199 |
| 280 | Ga0495669_0001201 | 3300046684 | Bacteria | 10769 |
| 281 | Ga0495677_0009866 | 3300047445 | Bacteria | 3517 |
| 282 | Ga0495673_0000921 | 3300047469 | Bacteria | 26699 |
| 283 | Ga0495686_0025376 | 3300047472 | Bacteria | 3885 |
| 284 | Ga0495593_0077950 | 3300047673 | Bacteria | 1716 |
| 285 | Ga0496102_0001662 | 3300048905 | Bacteria | 19559 |
| 286 | Ga0496102_0142485 | 3300048905 | Bacteria | 2248 |
| 287 | Ga0496103_0001024 | 3300048906 | Bacteria | 19559 |
| 288 | Ga0496103_0107335 | 3300048906 | Bacteria | 1771 |
| 289 | Ga0496112_0049555 | 3300048915 | Bacteria | 4117 |
| 290 | Ga0496112_0349843 | 3300048915 | Bacteria | 1420 |
| 291 | Ga0496113_0032980 | 3300048916 | Bacteria | 3767 |
| 292 | Ga0496116_0002969 | 3300048919 | Bacteria | 17240 |
| 293 | Ga0496117_0003167 | 3300048920 | Bacteria | 19559 |
| 294 | Ga0496117_0009859 | 3300048920 | Bacteria | 8796 |
| 295 | Ga0496117_0047793 | 3300048920 | Bacteria | 3064 |
| 296 | Ga0496117_0053381 | 3300048920 | Bacteria | 2840 |
| 297 | Ga0496118_0003535 | 3300048921 | Bacteria | 19559 |
| 298 | Ga0496118_0016059 | 3300048921 | Bacteria | 6891 |
| 299 | Ga0496118_0114920 | 3300048921 | Bacteria | 1773 |
| 300 | Ga0496119_0032100 | 3300048922 | Bacteria | 3506 |
| 301 | Ga0496119_0043883 | 3300048922 | Bacteria | 2821 |
| 302 | Ga0496120_0068468 | 3300048923 | Bacteria | 1958 |
| 303 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 304 | Ga0496121_0009552 | 3300048924 | Bacteria | 11113 |
| 305 | Ga0496124_0003394 | 3300048927 | Bacteria | 19559 |
| 306 | Ga0495678_000627 | 3300049459 | Bacteria | 32832 |
| 307 | Ga0501224_004003 | 3300049664 | Bacteria | 2076 |
| 308 | Ga0501249_000547 | 3300049679 | Bacteria | 9057 |
| 309 | Ga0501249_000593 | 3300049679 | Bacteria | 8439 |
| 310 | Ga0501035_0005422 | 3300049822 | Bacteria | 12061 |
| 311 | Ga0501044_0230681 | 3300049823 | Bacteria | 1799 |
| 312 | Ga0501204_000532 | 3300049850 | Bacteria | 3316 |
| 313 | Ga0501204_000686 | 3300049850 | Bacteria | 3072 |
| 314 | nmdc:mga05p37_357719_c1 | 3300050507 | Unclassified | 1717 |
| 315 | nmdc:mga08y16_112842_c1 | 3300050511 | Bacteria | 2829 |
| 316 | Ga0500578_0000030 | 3300053086 | Bacteria | 140063 |
| 317 | Ga0500643_031092 | 3300053087 | Bacteria | 1631 |
| 318 | Ga0500644_0000298 | 3300053088 | Bacteria | 26695 |
| 319 | Ga0500644_0011034 | 3300053088 | Bacteria | 2459 |
| 320 | Ga0500641_0001952 | 3300053096 | Bacteria | 7327 |
| 321 | Ga0500594_0000091 | 3300053118 | Bacteria | 27343 |
| 322 | Ga0500559_0013689 | 3300053136 | Bacteria | 3432 |
| 323 | Ga0500564_000014 | 3300053138 | Bacteria | 53518 |
| 324 | Ga0500604_0025273 | 3300053151 | Bacteria | 1706 |
| 325 | Ga0500627_0000398 | 3300053158 | Bacteria | 11691 |
| 326 | Ga0500639_043114 | 3300053163 | Bacteria | 2366 |
| 327 | Ga0500576_015240 | 3300053725 | Bacteria | 3473 |
| 328 | Ga0500645_003841 | 3300053730 | Bacteria | 5955 |
| 329 | Ga0500596_001495 | 3300053735 | Bacteria | 4733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0044857 | Ga0495625_0044857_19_1011 | 314 |
| 2 | 3300031728 | Ga0316578_10039740 | Ga0316578_100397402 | 319 |
| 3 | 3300049823 | Ga0501044_0230681 | Ga0501044_0230681_286_1452 | 343 |
| 4 | 3300035398 | Ga0316574_0022693 | Ga0316574_0022693_2221_3372 | 348 |
| 5 | 3300036712 | Ga0316584_0040614 | Ga0316584_0040614_1279_2430 | 348 |
| 6 | 3300049850 | Ga0501204_000532 | Ga0501204_000532_592_1755 | 348 |
| 7 | 3300031727 | Ga0316576_10065479 | Ga0316576_100654792 | 350 |
| 8 | 3300038443 | Ga0395901_0043531 | Ga0395901_0043531_21_1130 | 352 |
| 9 | 3300005539 | Ga0068853_100302130 | Ga0068853_1003021302 | 354 |
| 10 | 3300046460 | Ga0495638_0000487 | Ga0495638_0000487_13157_14329 | 354 |
| 11 | 3300046512 | Ga0495610_0001057 | Ga0495610_0001057_9133_10305 | 354 |
| 12 | 3300046524 | Ga0495648_0000229 | Ga0495648_0000229_48094_49272 | 354 |
| 13 | 3300046530 | Ga0495654_0030904 | Ga0495654_0030904_234_1412 | 354 |
| 14 | 3300046616 | Ga0495668_0033502 | Ga0495668_0033502_1081_2259 | 354 |
| 15 | 3300047469 | Ga0495673_0000921 | Ga0495673_0000921_14788_15966 | 354 |
| 16 | 3300049459 | Ga0495678_000627 | Ga0495678_000627_12958_14130 | 354 |
| 17 | 3300053086 | Ga0500578_0000030 | Ga0500578_0000030_81775_82947 | 354 |
| 18 | 3300053088 | Ga0500644_0000298 | Ga0500644_0000298_10723_11901 | 354 |
| 19 | 3300053088 | Ga0500644_0011034 | Ga0500644_0011034_534_1712 | 354 |
| 20 | 3300053118 | Ga0500594_0000091 | Ga0500594_0000091_18758_19930 | 354 |
| 21 | 3300053138 | Ga0500564_000014 | Ga0500564_000014_42773_43951 | 354 |
| 22 | 3300049822 | Ga0501035_0005422 | Ga0501035_0005422_4985_6124 | 355 |
| 23 | 3300053730 | Ga0500645_003841 | Ga0500645_003841_61_1275 | 361 |
| 24 | 3300005336 | Ga0070680_100001930 | Ga0070680_1000019304 | 362 |
| 25 | 3300005366 | Ga0070659_100008170 | Ga0070659_1000081704 | 362 |
| 26 | 3300005458 | Ga0070681_10001467 | Ga0070681_100014677 | 362 |
| 27 | 3300005530 | Ga0070679_100010790 | Ga0070679_1000107904 | 362 |
| 28 | 3300005577 | Ga0068857_100127383 | Ga0068857_1001273832 | 362 |
| 29 | 3300025909 | Ga0207705_10001275 | Ga0207705_100012754 | 362 |
| 30 | 3300025912 | Ga0207707_10031964 | Ga0207707_100319644 | 362 |
| 31 | 3300025917 | Ga0207660_10009044 | Ga0207660_100090445 | 362 |
| 32 | 3300025919 | Ga0207657_10000314 | Ga0207657_1000031415 | 362 |
| 33 | 3300025921 | Ga0207652_10009397 | Ga0207652_100093974 | 362 |
| 34 | 3300025932 | Ga0207690_10072096 | Ga0207690_100720962 | 362 |
| 35 | 3300025949 | Ga0207667_10094970 | Ga0207667_100949703 | 362 |
| 36 | 3300026041 | Ga0207639_10226275 | Ga0207639_102262752 | 362 |
| 37 | 3300026116 | Ga0207674_10144108 | Ga0207674_101441082 | 362 |
| 38 | 3300048905 | Ga0496102_0001662 | Ga0496102_0001662_2749_3867 | 362 |
| 39 | 3300048906 | Ga0496103_0001024 | Ga0496103_0001024_15693_16811 | 362 |
| 40 | 3300048919 | Ga0496116_0002969 | Ga0496116_0002969_436_1554 | 362 |
| 41 | 3300048920 | Ga0496117_0003167 | Ga0496117_0003167_2749_3867 | 362 |
| 42 | 3300048921 | Ga0496118_0003535 | Ga0496118_0003535_2749_3867 | 362 |
| 43 | 3300048922 | Ga0496119_0043883 | Ga0496119_0043883_1589_2707 | 362 |
| 44 | 3300048927 | Ga0496124_0003394 | Ga0496124_0003394_2749_3867 | 362 |
| 45 | 3300049679 | Ga0501249_000593 | Ga0501249_000593_3162_4370 | 363 |
| 46 | 3300003791 | Ga0055530_10000026 | Ga0055530_10000026102 | 364 |
| 47 | 3300003794 | Ga0055531_10001705 | Ga0055531_1000170512 | 364 |
| 48 | 3300005262 | Ga0065165_1000803 | Ga0065165_100080310 | 364 |
| 49 | 3300025297 | Ga0209758_1000261 | Ga0209758_100026143 | 364 |
| 50 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029195 | 364 |
| 51 | 3300025304 | Ga0209257_1000152 | Ga0209257_1000152121 | 364 |
| 52 | 3300005563 | Ga0068855_100162136 | Ga0068855_1001621362 | 365 |
| 53 | 3300009147 | Ga0114129_10373974 | Ga0114129_103739741 | 365 |
| 54 | 3300025904 | Ga0207647_10052468 | Ga0207647_100524682 | 365 |
| 55 | 3300025919 | Ga0207657_10057869 | Ga0207657_100578692 | 365 |
| 56 | 3300041486 | Ga0451807_0455910 | Ga0451807_0455910_3967_5094 | 365 |
| 57 | 3300050507 | nmdc:mga05p37_357719_c1 | nmdc:mga05p37_357719_c1_502_1689 | 365 |
| 58 | 3300046471 | Ga0495650_0006928 | Ga0495650_0006928_2262_3446 | 367 |
| 59 | 3300044719 | Ga0466971_0068117 | Ga0466971_0068117_24_1184 | 368 |
| 60 | 3300053087 | Ga0500643_031092 | Ga0500643_031092_16_1221 | 368 |
| 61 | 3300053096 | Ga0500641_0001952 | Ga0500641_0001952_1299_2507 | 368 |
| 62 | 3300049664 | Ga0501224_004003 | Ga0501224_004003_27_1262 | 369 |
| 63 | 3300049679 | Ga0501249_000547 | Ga0501249_000547_7611_8879 | 369 |
| 64 | 3300049850 | Ga0501204_000686 | Ga0501204_000686_115_1383 | 369 |
| 65 | 3300004801 | Ga0058860_10028125 | Ga0058860_100281252 | 370 |
| 66 | 3300005347 | Ga0070668_100000005 | Ga0070668_10000000562 | 370 |
| 67 | 3300005355 | Ga0070671_100000027 | Ga0070671_10000002753 | 370 |
| 68 | 3300005367 | Ga0070667_100000004 | Ga0070667_100000004108 | 370 |
| 69 | 3300005564 | Ga0070664_100091423 | Ga0070664_1000914232 | 370 |
| 70 | 3300005617 | Ga0068859_100047324 | Ga0068859_1000473243 | 370 |
| 71 | 3300005618 | Ga0068864_100002750 | Ga0068864_1000027507 | 370 |
| 72 | 3300005841 | Ga0068863_100000180 | Ga0068863_10000018028 | 370 |
| 73 | 3300005842 | Ga0068858_100010802 | Ga0068858_1000108024 | 370 |
| 74 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000294 | 370 |
| 75 | 3300005844 | Ga0068862_100000577 | Ga0068862_10000057721 | 370 |
| 76 | 3300006931 | Ga0097620_100047324 | Ga0097620_1000473243 | 370 |
| 77 | 3300014325 | Ga0163163_10027728 | Ga0163163_100277282 | 370 |
| 78 | 3300025903 | Ga0207680_10042019 | Ga0207680_100420193 | 370 |
| 79 | 3300025925 | Ga0207650_10004812 | Ga0207650_100048127 | 370 |
| 80 | 3300025925 | Ga0207650_10010011 | Ga0207650_100100114 | 370 |
| 81 | 3300025925 | Ga0207650_10230189 | Ga0207650_102301891 | 370 |
| 82 | 3300025931 | Ga0207644_10000029 | Ga0207644_10000029110 | 370 |
| 83 | 3300025945 | Ga0207679_10090367 | Ga0207679_100903671 | 370 |
| 84 | 3300025972 | Ga0207668_10000008 | Ga0207668_1000000822 | 370 |
| 85 | 3300025972 | Ga0207668_10159338 | Ga0207668_101593381 | 370 |
| 86 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002401 | 370 |
| 87 | 3300026035 | Ga0207703_10009218 | Ga0207703_100092186 | 370 |
| 88 | 3300026088 | Ga0207641_10004749 | Ga0207641_100047494 | 370 |
| 89 | 3300026095 | Ga0207676_10004142 | Ga0207676_100041425 | 370 |
| 90 | 3300028380 | Ga0268265_10000872 | Ga0268265_1000087224 | 370 |
| 91 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001726 | 370 |
| 92 | 3300031548 | Ga0307408_100055922 | Ga0307408_1000559222 | 370 |
| 93 | 3300031824 | Ga0307413_10017701 | Ga0307413_100177012 | 370 |
| 94 | 3300031995 | Ga0307409_100046712 | Ga0307409_1000467122 | 370 |
| 95 | 3300032002 | Ga0307416_100026897 | Ga0307416_1000268973 | 370 |
| 96 | 3300032005 | Ga0307411_10038097 | Ga0307411_100380972 | 370 |
| 97 | 3300032126 | Ga0307415_100046983 | Ga0307415_1000469832 | 370 |
| 98 | 3300046684 | Ga0495669_0001201 | Ga0495669_0001201_312_1526 | 370 |
| 99 | 3300047445 | Ga0495677_0009866 | Ga0495677_0009866_1972_3186 | 370 |
| 100 | 3300048915 | Ga0496112_0349843 | Ga0496112_0349843_94_1299 | 370 |
| 101 | 3300050511 | nmdc:mga08y16_112842_c1 | nmdc:mga08y16_112842_c1_574_1761 | 370 |
| 102 | 3300005336 | Ga0070680_100216293 | Ga0070680_1002162932 | 371 |
| 103 | 3300005339 | Ga0070660_100059743 | Ga0070660_1000597432 | 371 |
| 104 | 3300005539 | Ga0068853_100009038 | Ga0068853_1000090384 | 371 |
| 105 | 3300005563 | Ga0068855_100006244 | Ga0068855_1000062449 | 371 |
| 106 | 3300009093 | Ga0105240_10034214 | Ga0105240_100342145 | 371 |
| 107 | 3300009174 | Ga0105241_10070428 | Ga0105241_100704282 | 371 |
| 108 | 3300009551 | Ga0105238_10247551 | Ga0105238_102475512 | 371 |
| 109 | 3300025917 | Ga0207660_10100676 | Ga0207660_101006762 | 371 |
| 110 | 3300025919 | Ga0207657_10068970 | Ga0207657_100689702 | 371 |
| 111 | 3300025924 | Ga0207694_10080593 | Ga0207694_100805932 | 371 |
| 112 | 3300025949 | Ga0207667_10004546 | Ga0207667_100045467 | 371 |
| 113 | 3300026041 | Ga0207639_10034889 | Ga0207639_100348892 | 371 |
| 114 | 3300005578 | Ga0068854_100004266 | Ga0068854_1000042662 | 372 |
| 115 | 3300026089 | Ga0207648_10208820 | Ga0207648_102088201 | 372 |
| 116 | 3300025914 | Ga0207671_10168487 | Ga0207671_101684872 | 375 |
| 117 | 3300005331 | Ga0070670_100024122 | Ga0070670_1000241225 | 379 |
| 118 | 3300005347 | Ga0070668_100002375 | Ga0070668_10000237512 | 379 |
| 119 | 3300005355 | Ga0070671_100000365 | Ga0070671_1000003658 | 379 |
| 120 | 3300005367 | Ga0070667_100005241 | Ga0070667_1000052417 | 379 |
| 121 | 3300005548 | Ga0070665_100023804 | Ga0070665_1000238044 | 379 |
| 122 | 3300005617 | Ga0068859_100000093 | Ga0068859_10000009371 | 379 |
| 123 | 3300005841 | Ga0068863_100052405 | Ga0068863_1000524054 | 379 |
| 124 | 3300005842 | Ga0068858_100018870 | Ga0068858_1000188706 | 379 |
| 125 | 3300005843 | Ga0068860_100027357 | Ga0068860_1000273572 | 379 |
| 126 | 3300006931 | Ga0097620_100000093 | Ga0097620_10000009371 | 379 |
| 127 | 3300009177 | Ga0105248_10004083 | Ga0105248_1000408310 | 379 |
| 128 | 3300014325 | Ga0163163_10006973 | Ga0163163_100069732 | 379 |
| 129 | 3300025925 | Ga0207650_10005576 | Ga0207650_100055767 | 379 |
| 130 | 3300025931 | Ga0207644_10000931 | Ga0207644_1000093120 | 379 |
| 131 | 3300025941 | Ga0207711_10018479 | Ga0207711_100184793 | 379 |
| 132 | 3300025972 | Ga0207668_10002237 | Ga0207668_100022376 | 379 |
| 133 | 3300025986 | Ga0207658_10003130 | Ga0207658_100031308 | 379 |
| 134 | 3300039437 | Ga0436365_1136680 | Ga0436365_1136680_278_1507 | 379 |
| 135 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_412882_414051 | 380 |
| 136 | 3300005335 | Ga0070666_10031536 | Ga0070666_100315363 | 381 |
| 137 | 3300005347 | Ga0070668_100000159 | Ga0070668_10000015928 | 381 |
| 138 | 3300005353 | Ga0070669_100004604 | Ga0070669_1000046047 | 381 |
| 139 | 3300005367 | Ga0070667_100000120 | Ga0070667_10000012044 | 381 |
| 140 | 3300005841 | Ga0068863_100000053 | Ga0068863_10000005345 | 381 |
| 141 | 3300005843 | Ga0068860_100023577 | Ga0068860_1000235772 | 381 |
| 142 | 3300025903 | Ga0207680_10019694 | Ga0207680_100196942 | 381 |
| 143 | 3300025923 | Ga0207681_10003306 | Ga0207681_100033066 | 381 |
| 144 | 3300025972 | Ga0207668_10000027 | Ga0207668_1000002745 | 381 |
| 145 | 3300025986 | Ga0207658_10000091 | Ga0207658_1000009144 | 381 |
| 146 | 3300026088 | Ga0207641_10000093 | Ga0207641_1000009377 | 381 |
| 147 | 3300028381 | Ga0268264_10192322 | Ga0268264_101923222 | 381 |
| 148 | 3300046513 | Ga0495616_0000010 | Ga0495616_0000010_36926_38113 | 381 |
| 149 | 3300053151 | Ga0500604_0025273 | Ga0500604_0025273_338_1525 | 381 |
| 150 | 3300053158 | Ga0500627_0000398 | Ga0500627_0000398_5652_6839 | 381 |
| 151 | 3300001990 | JGI24737J22298_10003417 | JGI24737J22298_100034175 | 382 |
| 152 | 3300001990 | JGI24737J22298_10006083 | JGI24737J22298_100060832 | 382 |
| 153 | 3300002075 | JGI24738J21930_10000070 | JGI24738J21930_1000007021 | 382 |
| 154 | 3300005327 | Ga0070658_10005263 | Ga0070658_100052637 | 382 |
| 155 | 3300025909 | Ga0207705_10018191 | Ga0207705_100181912 | 382 |
| 156 | 3300025933 | Ga0207706_10012389 | Ga0207706_100123892 | 382 |
| 157 | 3300044658 | Ga0466972_0003004 | Ga0466972_0003004_2663_3937 | 382 |
| 158 | 3300044684 | Ga0466966_0076795 | Ga0466966_0076795_153_1427 | 382 |
| 159 | 3300044693 | Ga0466961_0011620 | Ga0466961_0011620_912_2186 | 382 |
| 160 | 3300045836 | Ga0466958_0011829 | Ga0466958_0011829_601_1875 | 382 |
| 161 | 3300001990 | JGI24737J22298_10008821 | JGI24737J22298_100088212 | 383 |
| 162 | 3300002067 | JGI24735J21928_10005746 | JGI24735J21928_100057463 | 383 |
| 163 | 3300002067 | JGI24735J21928_10007217 | JGI24735J21928_100072172 | 383 |
| 164 | 3300002067 | JGI24735J21928_10014977 | JGI24735J21928_100149772 | 383 |
| 165 | 3300002772 | JGI25164J39214_1004248 | JGI25164J39214_10042482 | 383 |
| 166 | 3300003214 | JGI25165J46597_1000350 | JGI25165J46597_100035010 | 383 |
| 167 | 3300003323 | rootH1_10146678 | rootH1_101466782 | 383 |
| 168 | 3300003762 | Ga0055542_1001554 | Ga0055542_10015544 | 383 |
| 169 | 3300005327 | Ga0070658_10000265 | Ga0070658_100002656 | 383 |
| 170 | 3300005331 | Ga0070670_100046938 | Ga0070670_1000469382 | 383 |
| 171 | 3300005338 | Ga0068868_100000102 | Ga0068868_10000010242 | 383 |
| 172 | 3300005339 | Ga0070660_100002070 | Ga0070660_10000207012 | 383 |
| 173 | 3300005339 | Ga0070660_100004060 | Ga0070660_1000040602 | 383 |
| 174 | 3300005339 | Ga0070660_100013777 | Ga0070660_1000137773 | 383 |
| 175 | 3300005347 | Ga0070668_100009484 | Ga0070668_1000094843 | 383 |
| 176 | 3300005355 | Ga0070671_100021975 | Ga0070671_1000219754 | 383 |
| 177 | 3300005355 | Ga0070671_100045111 | Ga0070671_1000451113 | 383 |
| 178 | 3300005356 | Ga0070674_100167118 | Ga0070674_1001671182 | 383 |
| 179 | 3300005364 | Ga0070673_100149660 | Ga0070673_1001496602 | 383 |
| 180 | 3300005366 | Ga0070659_100021934 | Ga0070659_1000219342 | 383 |
| 181 | 3300005366 | Ga0070659_100183190 | Ga0070659_1001831902 | 383 |
| 182 | 3300005455 | Ga0070663_100002287 | Ga0070663_1000022876 | 383 |
| 183 | 3300005456 | Ga0070678_100003080 | Ga0070678_1000030805 | 383 |
| 184 | 3300005539 | Ga0068853_100089829 | Ga0068853_1000898292 | 383 |
| 185 | 3300005543 | Ga0070672_100046080 | Ga0070672_1000460802 | 383 |
| 186 | 3300005548 | Ga0070665_100000884 | Ga0070665_10000088440 | 383 |
| 187 | 3300005563 | Ga0068855_100000036 | Ga0068855_10000003660 | 383 |
| 188 | 3300005563 | Ga0068855_100072830 | Ga0068855_1000728303 | 383 |
| 189 | 3300005578 | Ga0068854_100000445 | Ga0068854_1000004453 | 383 |
| 190 | 3300005578 | Ga0068854_100011660 | Ga0068854_1000116603 | 383 |
| 191 | 3300005614 | Ga0068856_100004545 | Ga0068856_10000454513 | 383 |
| 192 | 3300005614 | Ga0068856_100033631 | Ga0068856_1000336312 | 383 |
| 193 | 3300005616 | Ga0068852_100000383 | Ga0068852_10000038313 | 383 |
| 194 | 3300005618 | Ga0068864_100000616 | Ga0068864_1000006165 | 383 |
| 195 | 3300005841 | Ga0068863_100000282 | Ga0068863_10000028243 | 383 |
| 196 | 3300005842 | Ga0068858_100000219 | Ga0068858_10000021960 | 383 |
| 197 | 3300005844 | Ga0068862_100001608 | Ga0068862_1000016086 | 383 |
| 198 | 3300005844 | Ga0068862_100004057 | Ga0068862_1000040579 | 383 |
| 199 | 3300006237 | Ga0097621_100159864 | Ga0097621_1001598642 | 383 |
| 200 | 3300006353 | Ga0075370_10082189 | Ga0075370_100821892 | 383 |
| 201 | 3300006358 | Ga0068871_100027792 | Ga0068871_1000277922 | 383 |
| 202 | 3300009093 | Ga0105240_10173228 | Ga0105240_101732282 | 383 |
| 203 | 3300009177 | Ga0105248_10014533 | Ga0105248_100145339 | 383 |
| 204 | 3300009551 | Ga0105238_10009868 | Ga0105238_100098688 | 383 |
| 205 | 3300010375 | Ga0105239_10026072 | Ga0105239_100260727 | 383 |
| 206 | 3300013104 | Ga0157370_10000140 | Ga0157370_1000014052 | 383 |
| 207 | 3300013104 | Ga0157370_10078577 | Ga0157370_100785772 | 383 |
| 208 | 3300013307 | Ga0157372_10209061 | Ga0157372_102090611 | 383 |
| 209 | 3300014968 | Ga0157379_10022527 | Ga0157379_100225274 | 383 |
| 210 | 3300025231 | Ga0207427_101805 | Ga0207427_1018052 | 383 |
| 211 | 3300025250 | Ga0209026_1006687 | Ga0209026_10066872 | 383 |
| 212 | 3300025254 | Ga0209148_1000114 | Ga0209148_1000114140 | 383 |
| 213 | 3300025254 | Ga0209148_1000579 | Ga0209148_100057930 | 383 |
| 214 | 3300025261 | Ga0209233_1000319 | Ga0209233_100031910 | 383 |
| 215 | 3300025272 | Ga0209455_1000804 | Ga0209455_10008046 | 383 |
| 216 | 3300025904 | Ga0207647_10002272 | Ga0207647_100022728 | 383 |
| 217 | 3300025904 | Ga0207647_10064154 | Ga0207647_100641542 | 383 |
| 218 | 3300025909 | Ga0207705_10000014 | Ga0207705_1000001436 | 383 |
| 219 | 3300025909 | Ga0207705_10000244 | Ga0207705_100002445 | 383 |
| 220 | 3300025913 | Ga0207695_10201366 | Ga0207695_102013661 | 383 |
| 221 | 3300025919 | Ga0207657_10000103 | Ga0207657_1000010314 | 383 |
| 222 | 3300025919 | Ga0207657_10018618 | Ga0207657_100186184 | 383 |
| 223 | 3300025931 | Ga0207644_10085621 | Ga0207644_100856212 | 383 |
| 224 | 3300025932 | Ga0207690_10012940 | Ga0207690_100129403 | 383 |
| 225 | 3300025937 | Ga0207669_10042877 | Ga0207669_100428772 | 383 |
| 226 | 3300025937 | Ga0207669_10055215 | Ga0207669_100552151 | 383 |
| 227 | 3300025941 | Ga0207711_10006265 | Ga0207711_100062652 | 383 |
| 228 | 3300025945 | Ga0207679_10096532 | Ga0207679_100965322 | 383 |
| 229 | 3300025949 | Ga0207667_10000007 | Ga0207667_10000007304 | 383 |
| 230 | 3300025961 | Ga0207712_10077120 | Ga0207712_100771202 | 383 |
| 231 | 3300025972 | Ga0207668_10000046 | Ga0207668_100000469 | 383 |
| 232 | 3300025981 | Ga0207640_10001005 | Ga0207640_1000100513 | 383 |
| 233 | 3300025981 | Ga0207640_10008159 | Ga0207640_100081593 | 383 |
| 234 | 3300026023 | Ga0207677_10000168 | Ga0207677_1000016833 | 383 |
| 235 | 3300026035 | Ga0207703_10000675 | Ga0207703_1000067521 | 383 |
| 236 | 3300026067 | Ga0207678_10010133 | Ga0207678_100101335 | 383 |
| 237 | 3300026078 | Ga0207702_10206646 | Ga0207702_102066462 | 383 |
| 238 | 3300026088 | Ga0207641_10000376 | Ga0207641_100003765 | 383 |
| 239 | 3300026095 | Ga0207676_10000933 | Ga0207676_1000093317 | 383 |
| 240 | 3300026121 | Ga0207683_10027500 | Ga0207683_100275002 | 383 |
| 241 | 3300026142 | Ga0207698_10000314 | Ga0207698_1000031414 | 383 |
| 242 | 3300028380 | Ga0268265_10000441 | Ga0268265_1000044113 | 383 |
| 243 | 3300028380 | Ga0268265_10003990 | Ga0268265_100039908 | 383 |
| 244 | 3300028786 | Ga0307517_10076569 | Ga0307517_100765692 | 383 |
| 245 | 3300031730 | Ga0307516_10000006 | Ga0307516_10000006285 | 383 |
| 246 | 3300033180 | Ga0307510_10014136 | Ga0307510_100141366 | 383 |
| 247 | 3300042005 | Ga0439448_0001905 | Ga0439448_0001905_2868_4073 | 383 |
| 248 | 3300042012 | Ga0439455_0000134 | Ga0439455_0000134_495_1700 | 383 |
| 249 | 3300042157 | Ga0439458_0000076 | Ga0439458_0000076_5865_7070 | 383 |
| 250 | 3300044694 | Ga0466963_0067190 | Ga0466963_0067190_399_1604 | 383 |
| 251 | 3300044842 | Ga0466957_0009785 | Ga0466957_0009785_3999_5204 | 383 |
| 252 | 3300044842 | Ga0466957_0098555 | Ga0466957_0098555_534_1739 | 383 |
| 253 | 3300045976 | Ga0466967_0027268 | Ga0466967_0027268_2972_4177 | 383 |
| 254 | 3300046507 | Ga0495606_0074289 | Ga0495606_0074289_85_1290 | 383 |
| 255 | 3300046512 | Ga0495610_0051292 | Ga0495610_0051292_691_1896 | 383 |
| 256 | 3300046557 | Ga0495622_0005805 | Ga0495622_0005805_1560_2834 | 383 |
| 257 | 3300046616 | Ga0495668_0114598 | Ga0495668_0114598_67_1269 | 383 |
| 258 | 3300047472 | Ga0495686_0025376 | Ga0495686_0025376_535_1728 | 383 |
| 259 | 3300047673 | Ga0495593_0077950 | Ga0495593_0077950_87_1361 | 383 |
| 260 | 3300048905 | Ga0496102_0142485 | Ga0496102_0142485_763_1965 | 383 |
| 261 | 3300048906 | Ga0496103_0107335 | Ga0496103_0107335_121_1323 | 383 |
| 262 | 3300048920 | Ga0496117_0009859 | Ga0496117_0009859_1898_3100 | 383 |
| 263 | 3300048920 | Ga0496117_0047793 | Ga0496117_0047793_960_2195 | 383 |
| 264 | 3300048920 | Ga0496117_0053381 | Ga0496117_0053381_719_1924 | 383 |
| 265 | 3300048921 | Ga0496118_0016059 | Ga0496118_0016059_4475_5680 | 383 |
| 266 | 3300048921 | Ga0496118_0114920 | Ga0496118_0114920_53_1255 | 383 |
| 267 | 3300048922 | Ga0496119_0032100 | Ga0496119_0032100_666_1871 | 383 |
| 268 | 3300048923 | Ga0496120_0068468 | Ga0496120_0068468_21_1226 | 383 |
| 269 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_348076_349278 | 383 |
| 270 | 3300048924 | Ga0496121_0009552 | Ga0496121_0009552_2020_3225 | 383 |
| 271 | 3300053136 | Ga0500559_0013689 | Ga0500559_0013689_109_1302 | 383 |
| 272 | 3300053163 | Ga0500639_043114 | Ga0500639_043114_124_1398 | 383 |
| 273 | 3300053725 | Ga0500576_015240 | Ga0500576_015240_1557_2831 | 383 |
| 274 | 3300053735 | Ga0500596_001495 | Ga0500596_001495_2759_4033 | 383 |
| 275 | 3300005539 | Ga0068853_100076752 | Ga0068853_1000767522 | 384 |
| 276 | 3300005548 | Ga0070665_100033359 | Ga0070665_1000333592 | 384 |
| 277 | 3300013307 | Ga0157372_10105546 | Ga0157372_101055462 | 384 |
| 278 | 3300028379 | Ga0268266_10061870 | Ga0268266_100618702 | 384 |
| 279 | 3300031456 | Ga0307513_10009979 | Ga0307513_100099798 | 384 |
| 280 | 3300037312 | Ga0395899_0002840 | Ga0395899_0002840_4976_6169 | 384 |
| 281 | 3300037418 | Ga0395900_0017495 | Ga0395900_0017495_6091_7284 | 384 |
| 282 | 3300037471 | Ga0395905_0011424 | Ga0395905_0011424_5357_6550 | 384 |
| 283 | 3300038443 | Ga0395901_0025052 | Ga0395901_0025052_1302_2495 | 384 |
| 284 | 3300048915 | Ga0496112_0049555 | Ga0496112_0049555_2352_3545 | 384 |
| 285 | 3300048916 | Ga0496113_0032980 | Ga0496113_0032980_1996_3189 | 384 |
| 286 | 3300013105 | Ga0157369_10038578 | Ga0157369_100385783 | 385 |
| 287 | 3300013105 | Ga0157369_10120641 | Ga0157369_101206412 | 385 |
| 288 | 3300013307 | Ga0157372_10001499 | Ga0157372_1000149922 | 385 |
| 289 | 3300013307 | Ga0157372_10163715 | Ga0157372_101637152 | 385 |
| 290 | 3300037312 | Ga0395899_0000730 | Ga0395899_0000730_18834_20222 | 385 |
| 291 | 3300042005 | Ga0439448_0000224 | Ga0439448_0000224_3377_4753 | 385 |
| 292 | 3300042012 | Ga0439455_0000045 | Ga0439455_0000045_3532_4908 | 385 |
| 293 | 3300001976 | JGI24752J21851_1002398 | JGI24752J21851_10023983 | 387 |
| 294 | 3300002239 | JGI24034J26672_10009761 | JGI24034J26672_100097611 | 387 |
| 295 | 3300005331 | Ga0070670_100020256 | Ga0070670_1000202563 | 387 |
| 296 | 3300005335 | Ga0070666_10000098 | Ga0070666_1000009812 | 387 |
| 297 | 3300005347 | Ga0070668_100012390 | Ga0070668_1000123902 | 387 |
| 298 | 3300005353 | Ga0070669_100000029 | Ga0070669_10000002986 | 387 |
| 299 | 3300005355 | Ga0070671_100000016 | Ga0070671_10000001670 | 387 |
| 300 | 3300005367 | Ga0070667_100039525 | Ga0070667_1000395253 | 387 |
| 301 | 3300005445 | Ga0070708_100023434 | Ga0070708_1000234345 | 387 |
| 302 | 3300005544 | Ga0070686_100029286 | Ga0070686_1000292862 | 387 |
| 303 | 3300005617 | Ga0068859_100003218 | Ga0068859_10000321810 | 387 |
| 304 | 3300005618 | Ga0068864_100007265 | Ga0068864_1000072655 | 387 |
| 305 | 3300005719 | Ga0068861_100017816 | Ga0068861_1000178162 | 387 |
| 306 | 3300005841 | Ga0068863_100034391 | Ga0068863_1000343912 | 387 |
| 307 | 3300005842 | Ga0068858_100007702 | Ga0068858_1000077026 | 387 |
| 308 | 3300005843 | Ga0068860_100007191 | Ga0068860_10000719110 | 387 |
| 309 | 3300005844 | Ga0068862_100000606 | Ga0068862_10000060620 | 387 |
| 310 | 3300006931 | Ga0097620_100003218 | Ga0097620_10000321810 | 387 |
| 311 | 3300009101 | Ga0105247_10000521 | Ga0105247_100005219 | 387 |
| 312 | 3300009177 | Ga0105248_10104685 | Ga0105248_101046852 | 387 |
| 313 | 3300009553 | Ga0105249_10012133 | Ga0105249_100121334 | 387 |
| 314 | 3300014325 | Ga0163163_10130113 | Ga0163163_101301133 | 387 |
| 315 | 3300014968 | Ga0157379_10013898 | Ga0157379_100138985 | 387 |
| 316 | 3300025315 | Ga0207697_10000164 | Ga0207697_1000016424 | 387 |
| 317 | 3300025900 | Ga0207710_10002428 | Ga0207710_100024286 | 387 |
| 318 | 3300025903 | Ga0207680_10000130 | Ga0207680_1000013015 | 387 |
| 319 | 3300025923 | Ga0207681_10000040 | Ga0207681_1000004085 | 387 |
| 320 | 3300025925 | Ga0207650_10008678 | Ga0207650_100086782 | 387 |
| 321 | 3300025931 | Ga0207644_10000023 | Ga0207644_1000002370 | 387 |
| 322 | 3300025961 | Ga0207712_10033277 | Ga0207712_100332772 | 387 |
| 323 | 3300025972 | Ga0207668_10000754 | Ga0207668_100007545 | 387 |
| 324 | 3300025986 | Ga0207658_10030731 | Ga0207658_100307313 | 387 |
| 325 | 3300026035 | Ga0207703_10007167 | Ga0207703_100071673 | 387 |
| 326 | 3300026095 | Ga0207676_10002964 | Ga0207676_100029649 | 387 |
| 327 | 3300026118 | Ga0207675_100000582 | Ga0207675_10000058226 | 387 |
| 328 | 3300028380 | Ga0268265_10000098 | Ga0268265_1000009856 | 387 |
| 329 | 3300028381 | Ga0268264_10000141 | Ga0268264_1000014194 | 387 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5enz-assembly1.cif.gz_A | s. aureus mnaa-udp co-structure | 0.6598 | 3 | 387 |
| 3l7l-assembly3.cif.gz_D | structure of the wall teichoic acid polymerase tagf, h444n + cdpg (30 minute soak) | 0.6577 | 1 | 380 |
| 5tzk-assembly1.cif.gz_C | crystal structure of s. aureus tars 1-349 in complex with udp | 0.654 | 1 | 65 |
| 7nzj-assembly3.cif.gz_E | structure of bstrmb apo | 0.6526 | 2 | 105 |
| 5enz-assembly1.cif.gz_A | s. aureus mnaa-udp co-structure | 0.6505 | 3 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HXJ0_290_600_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7318 | 33 | 63 | 3.40.50.150 |
| af_Q2FWE1_84_278_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6981 | 4 | 105 | 3.40.50.150 |
| af_A0A0R4J2U6_3_172_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6855 | 3 | 105 | 3.40.50.150 |
| af_I1MQ93_5_170_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6707 | 3 | 123 | 3.40.50.150 |
| af_Q2G1J3_4_329_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6669 | 6 | 310 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G5TTA0-F1-model_v4 | CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase | 0.9694 | 3 | 381 |
GO:0016740
|
| AF-A0A6M8HUE0-F1-model_v4 | Uncharacterized protein | 0.9617 | 2 | 383 |
|
| AF-A0A1G5TTA0-F1-model_v4 | CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase | 0.9594 | 3 | 381 |
GO:0016740
|
| AF-A0A3A0ES31-F1-model_v4 | Glycosyl transferase | 0.9583 | 1 | 387 |
GO:0016020
GO:0047355 |
| AF-A0A3A0ES31-F1-model_v4 | Glycosyl transferase | 0.9559 | 1 | 387 |
GO:0016020
GO:0047355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar