F409660

General Info

Members Datasets Scaffolds Average Seq Length
329 192 329 398

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10038578|Ga0157369_100385783
Length 462
Sequence VAERELEVGNTDHAADPLAAFATDRHGDAARSGSSRKRAIGRAGKSPAPDVESMPRKRLSDMRVCFLFNHDQVHQVAHSLPIALALADHAPDVQVILAPTNPRIQTEVVRLAGSRLRDNLILHPLHLNRFRSRALAMLTEPFAPAHKLLIYGDNLDFFRSLDTLVVAEKTSLVLKTRYDLDRLKIIHTRHGAGDRAIGFNPASAQFDHVLVSGDKIRRRLIADAGVAPEKISVVGYPKFDLNGMSRPHALIDSGRPVVLYNPHVSPHLSSWYKMGREVLDWFVEHDEYQLIFAPHVMLFERSFALTVDKLRIDRPGRIDERYLRAPNIHIDLGSRASSNMTYTNRADIYLGDVSSQIYEFLLNPRPCVFLDAHETDWVDDQNYAHWRSGPVIDDPDRLEDALSEAMRDPGGRYAAAQKQLFDDTFDLTDKPSSLRAAEAVARVTGFELSAPEPRTARRRINA

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
190 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0
Rhizoplane 2.43
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002398 3300001976 Bacteria 2492
2 JGI24737J22298_10003417 3300001990 Bacteria 5615
3 JGI24737J22298_10006083 3300001990 Bacteria 4136
4 JGI24737J22298_10008821 3300001990 Bacteria 3366
5 JGI24735J21928_10005746 3300002067 Bacteria 4102
6 JGI24735J21928_10007217 3300002067 Bacteria 3626
7 JGI24735J21928_10014977 3300002067 Bacteria 2423
8 JGI24738J21930_10000070 3300002075 Bacteria 21714
9 JGI24034J26672_10009761 3300002239 Bacteria 1419
10 JGI25164J39214_1004248 3300002772 Bacteria 1671
11 JGI25165J46597_1000350 3300003214 Bacteria 52046
12 rootH1_10146678 3300003323 Bacteria 1877
13 Ga0055542_1001554 3300003762 Bacteria 10815
14 Ga0055530_10000026 3300003791 Bacteria 129960
15 Ga0055531_10001705 3300003794 Bacteria 15761
16 Ga0058860_10028125 3300004801 Unclassified 2754
17 Ga0065165_1000803 3300005262 Bacteria 41890
18 Ga0070658_10000265 3300005327 Bacteria 46194
19 Ga0070658_10005263 3300005327 Bacteria 10509
20 Ga0070670_100020256 3300005331 Bacteria 5715
21 Ga0070670_100024122 3300005331 Bacteria 5233
22 Ga0070670_100046938 3300005331 Bacteria 3716
23 Ga0070666_10000098 3300005335 Bacteria 59878
24 Ga0070666_10031536 3300005335 Bacteria 3498
25 Ga0070680_100001930 3300005336 Bacteria 15238
26 Ga0070680_100216293 3300005336 Bacteria 1617
27 Ga0068868_100000102 3300005338 Bacteria 52814
28 Ga0070660_100002070 3300005339 Bacteria 13857
29 Ga0070660_100004060 3300005339 Bacteria 10097
30 Ga0070660_100013777 3300005339 Bacteria 5816
31 Ga0070660_100059743 3300005339 Bacteria 2957
32 Ga0070668_100000005 3300005347 Bacteria 187511
33 Ga0070668_100000159 3300005347 Bacteria 42625
34 Ga0070668_100002375 3300005347 Bacteria 13824
35 Ga0070668_100009484 3300005347 Bacteria 7222
36 Ga0070668_100012390 3300005347 Bacteria 6349
37 Ga0070669_100000029 3300005353 Bacteria 163005
38 Ga0070669_100004604 3300005353 Bacteria 9958
39 Ga0070671_100000016 3300005355 Bacteria 156166
40 Ga0070671_100000027 3300005355 Bacteria 114189
41 Ga0070671_100000365 3300005355 Bacteria 31264
42 Ga0070671_100021975 3300005355 Bacteria 5211
43 Ga0070671_100045111 3300005355 Bacteria 3664
44 Ga0070674_100167118 3300005356 Bacteria 1674
45 Ga0070673_100149660 3300005364 Bacteria 1976
46 Ga0070659_100008170 3300005366 Bacteria 7634
47 Ga0070659_100021934 3300005366 Bacteria 4872
48 Ga0070659_100183190 3300005366 Bacteria 1719
49 Ga0070667_100000004 3300005367 Bacteria 444091
50 Ga0070667_100000120 3300005367 Bacteria 99936
51 Ga0070667_100005241 3300005367 Bacteria 10839
52 Ga0070667_100039525 3300005367 Bacteria 3954
53 Ga0070708_100023434 3300005445 Bacteria 5250
54 Ga0070663_100002287 3300005455 Bacteria 10737
55 Ga0070678_100003080 3300005456 Bacteria 9241
56 Ga0070681_10001467 3300005458 Bacteria 20801
57 Ga0070679_100010790 3300005530 Bacteria 8675
58 Ga0068853_100009038 3300005539 Bacteria 8025
59 Ga0068853_100076752 3300005539 Bacteria 2918
60 Ga0068853_100089829 3300005539 Bacteria 2699
61 Ga0068853_100302130 3300005539 Bacteria 1479
62 Ga0070672_100046080 3300005543 Bacteria 3377
63 Ga0070686_100029286 3300005544 Bacteria 3348
64 Ga0070665_100000884 3300005548 Bacteria 38426
65 Ga0070665_100023804 3300005548 Bacteria 6169
66 Ga0070665_100033359 3300005548 Bacteria 5181
67 Ga0068855_100000036 3300005563 Bacteria 162849
68 Ga0068855_100006244 3300005563 Bacteria 14529
69 Ga0068855_100072830 3300005563 Bacteria 3993
70 Ga0068855_100162136 3300005563 Bacteria 2537
71 Ga0070664_100091423 3300005564 Bacteria 2634
72 Ga0068857_100127383 3300005577 Bacteria 2295
73 Ga0068854_100000445 3300005578 Bacteria 25570
74 Ga0068854_100004266 3300005578 Bacteria 9007
75 Ga0068854_100011660 3300005578 Bacteria 5733
76 Ga0068856_100004545 3300005614 Bacteria 13792
77 Ga0068856_100033631 3300005614 Bacteria 5021
78 Ga0068852_100000383 3300005616 Bacteria 29748
79 Ga0068859_100000093 3300005617 Bacteria 82384
80 Ga0068859_100003218 3300005617 Bacteria 16624
81 Ga0068859_100047324 3300005617 Bacteria 4321
82 Ga0068864_100000616 3300005618 Bacteria 29988
83 Ga0068864_100002750 3300005618 Bacteria 14504
84 Ga0068864_100007265 3300005618 Bacteria 9110
85 Ga0068861_100017816 3300005719 Bacteria 5047
86 Ga0068863_100000053 3300005841 Bacteria 125195
87 Ga0068863_100000180 3300005841 Bacteria 67219
88 Ga0068863_100000282 3300005841 Bacteria 52485
89 Ga0068863_100034391 3300005841 Bacteria 4828
90 Ga0068863_100052405 3300005841 Bacteria 3867
91 Ga0068858_100000219 3300005842 Bacteria 61717
92 Ga0068858_100007702 3300005842 Bacteria 10395
93 Ga0068858_100010802 3300005842 Bacteria 8632
94 Ga0068858_100018870 3300005842 Bacteria 6453
95 Ga0068860_100000002 3300005843 Bacteria 627849
96 Ga0068860_100007191 3300005843 Bacteria 11131
97 Ga0068860_100023577 3300005843 Bacteria 5948
98 Ga0068860_100027357 3300005843 Bacteria 5494
99 Ga0068862_100000577 3300005844 Bacteria 38216
100 Ga0068862_100000606 3300005844 Bacteria 37254
101 Ga0068862_100001608 3300005844 Bacteria 20576
102 Ga0068862_100004057 3300005844 Bacteria 12414
103 Ga0097621_100159864 3300006237 Bacteria 1936
104 Ga0075370_10082189 3300006353 Bacteria 1852
105 Ga0068871_100027792 3300006358 Bacteria 4428
106 Ga0097620_100000093 3300006931 Bacteria 82384
107 Ga0097620_100003218 3300006931 Bacteria 16624
108 Ga0097620_100047324 3300006931 Bacteria 4321
109 Ga0105240_10034214 3300009093 Bacteria 6557
110 Ga0105240_10173228 3300009093 Bacteria 2553
111 Ga0105247_10000521 3300009101 Bacteria 31494
112 Ga0114129_10373974 3300009147 Unclassified 1883
113 Ga0105241_10070428 3300009174 Bacteria 2713
114 Ga0105248_10004083 3300009177 Bacteria 16147
115 Ga0105248_10014533 3300009177 Bacteria 8666
116 Ga0105248_10104685 3300009177 Bacteria 3190
117 Ga0105238_10009868 3300009551 Bacteria 9568
118 Ga0105238_10247551 3300009551 Bacteria 1760
119 Ga0105249_10012133 3300009553 Bacteria 7585
120 Ga0105239_10026072 3300010375 Bacteria 6435
121 Ga0157370_10000140 3300013104 Bacteria 87498
122 Ga0157370_10078577 3300013104 Bacteria 3107
123 Ga0157369_10038578 3300013105 Bacteria 5223
124 Ga0157369_10120641 3300013105 Bacteria 2782
125 Ga0157372_10001499 3300013307 Bacteria 25376
126 Ga0157372_10105546 3300013307 Bacteria 3222
127 Ga0157372_10163715 3300013307 Bacteria 2571
128 Ga0157372_10209061 3300013307 Bacteria 2261
129 Ga0163163_10006973 3300014325 Bacteria 9926
130 Ga0163163_10027728 3300014325 Bacteria 5430
131 Ga0163163_10130113 3300014325 Bacteria 2557
132 Ga0157379_10013898 3300014968 Bacteria 7057
133 Ga0157379_10022527 3300014968 Bacteria 5579
134 Ga0207427_101805 3300025231 Bacteria 6867
135 Ga0209026_1006687 3300025250 Bacteria 2767
136 Ga0209148_1000114 3300025254 Bacteria 192073
137 Ga0209148_1000579 3300025254 Bacteria 33716
138 Ga0209233_1000319 3300025261 Bacteria 52404
139 Ga0209455_1000804 3300025272 Bacteria 17250
140 Ga0209758_1000261 3300025297 Bacteria 104423
141 Ga0209050_1000029 3300025298 Bacteria 465801
142 Ga0209257_1000152 3300025304 Bacteria 189432
143 Ga0207697_10000164 3300025315 Bacteria 33417
144 Ga0207710_10002428 3300025900 Bacteria 8663
145 Ga0207680_10000130 3300025903 Bacteria 35102
146 Ga0207680_10019694 3300025903 Bacteria 3614
147 Ga0207680_10042019 3300025903 Bacteria 2672
148 Ga0207647_10002272 3300025904 Bacteria 14639
149 Ga0207647_10052468 3300025904 Bacteria 2517
150 Ga0207647_10064154 3300025904 Bacteria 2232
151 Ga0207705_10000014 3300025909 Bacteria 434286
152 Ga0207705_10000244 3300025909 Bacteria 53451
153 Ga0207705_10001275 3300025909 Bacteria 20220
154 Ga0207705_10018191 3300025909 Bacteria 5024
155 Ga0207707_10031964 3300025912 Bacteria 4607
156 Ga0207695_10201366 3300025913 Bacteria 1905
157 Ga0207671_10168487 3300025914 Bacteria 1699
158 Ga0207660_10009044 3300025917 Bacteria 6450
159 Ga0207660_10100676 3300025917 Bacteria 2158
160 Ga0207657_10000103 3300025919 Bacteria 82031
161 Ga0207657_10000314 3300025919 Bacteria 51222
162 Ga0207657_10018618 3300025919 Bacteria 6620
163 Ga0207657_10057869 3300025919 Bacteria 3339
164 Ga0207657_10068970 3300025919 Bacteria 3002
165 Ga0207652_10009397 3300025921 Bacteria 7863
166 Ga0207681_10000040 3300025923 Bacteria 147547
167 Ga0207681_10003306 3300025923 Bacteria 10093
168 Ga0207694_10080593 3300025924 Bacteria 2555
169 Ga0207650_10004812 3300025925 Bacteria 9223
170 Ga0207650_10005576 3300025925 Bacteria 8596
171 Ga0207650_10008678 3300025925 Bacteria 6943
172 Ga0207650_10010011 3300025925 Bacteria 6491
173 Ga0207650_10230189 3300025925 Unclassified 1494
174 Ga0207644_10000023 3300025931 Bacteria 156180
175 Ga0207644_10000029 3300025931 Bacteria 139264
176 Ga0207644_10000931 3300025931 Bacteria 18604
177 Ga0207644_10085621 3300025931 Bacteria 2338
178 Ga0207690_10012940 3300025932 Bacteria 5000
179 Ga0207690_10072096 3300025932 Bacteria 2385
180 Ga0207706_10012389 3300025933 Bacteria 7768
181 Ga0207669_10042877 3300025937 Bacteria 2645
182 Ga0207669_10055215 3300025937 Bacteria 2404
183 Ga0207711_10006265 3300025941 Bacteria 10037
184 Ga0207711_10018479 3300025941 Bacteria 5796
185 Ga0207679_10090367 3300025945 Bacteria 2367
186 Ga0207679_10096532 3300025945 Bacteria 2300
187 Ga0207667_10000007 3300025949 Bacteria 630590
188 Ga0207667_10004546 3300025949 Bacteria 16998
189 Ga0207667_10094970 3300025949 Bacteria 3078
190 Ga0207712_10033277 3300025961 Bacteria 3484
191 Ga0207712_10077120 3300025961 Bacteria 2414
192 Ga0207668_10000008 3300025972 Bacteria 189904
193 Ga0207668_10000027 3300025972 Bacteria 125575
194 Ga0207668_10000046 3300025972 Bacteria 102051
195 Ga0207668_10000754 3300025972 Bacteria 19803
196 Ga0207668_10002237 3300025972 Bacteria 11293
197 Ga0207668_10159338 3300025972 Unclassified 1757
198 Ga0207640_10001005 3300025981 Bacteria 15622
199 Ga0207640_10008159 3300025981 Bacteria 5800
200 Ga0207658_10000002 3300025986 Bacteria 1364188
201 Ga0207658_10000091 3300025986 Bacteria 99970
202 Ga0207658_10003130 3300025986 Bacteria 11838
203 Ga0207658_10030731 3300025986 Bacteria 3806
204 Ga0207677_10000168 3300026023 Bacteria 52215
205 Ga0207703_10000675 3300026035 Bacteria 34030
206 Ga0207703_10007167 3300026035 Bacteria 8871
207 Ga0207703_10009218 3300026035 Bacteria 7763
208 Ga0207639_10034889 3300026041 Bacteria 3721
209 Ga0207639_10226275 3300026041 Bacteria 1618
210 Ga0207678_10010133 3300026067 Bacteria 8270
211 Ga0207702_10206646 3300026078 Bacteria 1823
212 Ga0207641_10000093 3300026088 Bacteria 125747
213 Ga0207641_10000376 3300026088 Bacteria 53079
214 Ga0207641_10004749 3300026088 Bacteria 11713
215 Ga0207648_10208820 3300026089 Bacteria 1733
216 Ga0207676_10000933 3300026095 Bacteria 22598
217 Ga0207676_10002964 3300026095 Bacteria 12109
218 Ga0207676_10004142 3300026095 Bacteria 10239
219 Ga0207674_10144108 3300026116 Bacteria 2341
220 Ga0207675_100000582 3300026118 Bacteria 35705
221 Ga0207683_10027500 3300026121 Bacteria 4914
222 Ga0207698_10000314 3300026142 Bacteria 28948
223 Ga0268266_10061870 3300028379 Bacteria 3229
224 Ga0268265_10000098 3300028380 Bacteria 110108
225 Ga0268265_10000441 3300028380 Bacteria 43786
226 Ga0268265_10000872 3300028380 Bacteria 28294
227 Ga0268265_10003990 3300028380 Bacteria 10391
228 Ga0268264_10000001 3300028381 Bacteria 1221000
229 Ga0268264_10000141 3300028381 Bacteria 170966
230 Ga0268264_10192322 3300028381 Bacteria 1861
231 Ga0307517_10076569 3300028786 Bacteria 2920
232 Ga0307513_10009979 3300031456 Bacteria 11979
233 Ga0307408_100055922 3300031548 Bacteria 2859
234 Ga0316576_10065479 3300031727 Bacteria 2671
235 Ga0316578_10039740 3300031728 Bacteria 2718
236 Ga0307516_10000006 3300031730 Bacteria 298586
237 Ga0307413_10017701 3300031824 Bacteria 3718
238 Ga0307409_100046712 3300031995 Bacteria 3280
239 Ga0307416_100026897 3300032002 Bacteria 4248
240 Ga0307411_10038097 3300032005 Bacteria 3029
241 Ga0307415_100046983 3300032126 Bacteria 2903
242 Ga0307510_10014136 3300033180 Bacteria 9454
243 Ga0316574_0022693 3300035398 Bacteria 3741
244 Ga0316584_0040614 3300036712 Bacteria 3467
245 Ga0395899_0000730 3300037312 Bacteria 32812
246 Ga0395899_0002840 3300037312 Bacteria 13955
247 Ga0395900_0017495 3300037418 Bacteria 7315
248 Ga0395905_0011424 3300037471 Bacteria 8580
249 Ga0395901_0025052 3300038443 Bacteria 6124
250 Ga0395901_0043531 3300038443 Bacteria 4657
251 Ga0436365_1136680 3300039437 Bacteria 7894
252 Ga0451807_0455910 3300041486 Bacteria 5209
253 Ga0439448_0000224 3300042005 Bacteria 12036
254 Ga0439448_0001905 3300042005 Bacteria 5555
255 Ga0439455_0000045 3300042012 Bacteria 10891
256 Ga0439455_0000134 3300042012 Bacteria 7861
257 Ga0439458_0000076 3300042157 Bacteria 18372
258 Ga0466972_0003004 3300044658 Bacteria 8359
259 Ga0466966_0076795 3300044684 Bacteria 2085
260 Ga0466961_0011620 3300044693 Bacteria 5627
261 Ga0466963_0067190 3300044694 Bacteria 2406
262 Ga0466971_0068117 3300044719 Bacteria 1614
263 Ga0466957_0009785 3300044842 Bacteria 5480
264 Ga0466957_0098555 3300044842 Bacteria 1839
265 Ga0451576_0000023 3300045051 Bacteria 477965
266 Ga0466958_0011829 3300045836 Bacteria 4927
267 Ga0466967_0027268 3300045976 Bacteria 4749
268 Ga0495638_0000487 3300046460 Bacteria 47499
269 Ga0495650_0006928 3300046471 Bacteria 6937
270 Ga0495606_0074289 3300046507 Bacteria 2130
271 Ga0495610_0001057 3300046512 Bacteria 25299
272 Ga0495610_0051292 3300046512 Bacteria 2009
273 Ga0495616_0000010 3300046513 Bacteria 224378
274 Ga0495648_0000229 3300046524 Bacteria 64205
275 Ga0495654_0030904 3300046530 Bacteria 2721
276 Ga0495622_0005805 3300046557 Bacteria 5726
277 Ga0495668_0033502 3300046616 Bacteria 2886
278 Ga0495668_0114598 3300046616 Bacteria 1474
279 Ga0495625_0044857 3300046660 Bacteria 3199
280 Ga0495669_0001201 3300046684 Bacteria 10769
281 Ga0495677_0009866 3300047445 Bacteria 3517
282 Ga0495673_0000921 3300047469 Bacteria 26699
283 Ga0495686_0025376 3300047472 Bacteria 3885
284 Ga0495593_0077950 3300047673 Bacteria 1716
285 Ga0496102_0001662 3300048905 Bacteria 19559
286 Ga0496102_0142485 3300048905 Bacteria 2248
287 Ga0496103_0001024 3300048906 Bacteria 19559
288 Ga0496103_0107335 3300048906 Bacteria 1771
289 Ga0496112_0049555 3300048915 Bacteria 4117
290 Ga0496112_0349843 3300048915 Bacteria 1420
291 Ga0496113_0032980 3300048916 Bacteria 3767
292 Ga0496116_0002969 3300048919 Bacteria 17240
293 Ga0496117_0003167 3300048920 Bacteria 19559
294 Ga0496117_0009859 3300048920 Bacteria 8796
295 Ga0496117_0047793 3300048920 Bacteria 3064
296 Ga0496117_0053381 3300048920 Bacteria 2840
297 Ga0496118_0003535 3300048921 Bacteria 19559
298 Ga0496118_0016059 3300048921 Bacteria 6891
299 Ga0496118_0114920 3300048921 Bacteria 1773
300 Ga0496119_0032100 3300048922 Bacteria 3506
301 Ga0496119_0043883 3300048922 Bacteria 2821
302 Ga0496120_0068468 3300048923 Bacteria 1958
303 Ga0496121_0000009 3300048924 Bacteria 836971
304 Ga0496121_0009552 3300048924 Bacteria 11113
305 Ga0496124_0003394 3300048927 Bacteria 19559
306 Ga0495678_000627 3300049459 Bacteria 32832
307 Ga0501224_004003 3300049664 Bacteria 2076
308 Ga0501249_000547 3300049679 Bacteria 9057
309 Ga0501249_000593 3300049679 Bacteria 8439
310 Ga0501035_0005422 3300049822 Bacteria 12061
311 Ga0501044_0230681 3300049823 Bacteria 1799
312 Ga0501204_000532 3300049850 Bacteria 3316
313 Ga0501204_000686 3300049850 Bacteria 3072
314 nmdc:mga05p37_357719_c1 3300050507 Unclassified 1717
315 nmdc:mga08y16_112842_c1 3300050511 Bacteria 2829
316 Ga0500578_0000030 3300053086 Bacteria 140063
317 Ga0500643_031092 3300053087 Bacteria 1631
318 Ga0500644_0000298 3300053088 Bacteria 26695
319 Ga0500644_0011034 3300053088 Bacteria 2459
320 Ga0500641_0001952 3300053096 Bacteria 7327
321 Ga0500594_0000091 3300053118 Bacteria 27343
322 Ga0500559_0013689 3300053136 Bacteria 3432
323 Ga0500564_000014 3300053138 Bacteria 53518
324 Ga0500604_0025273 3300053151 Bacteria 1706
325 Ga0500627_0000398 3300053158 Bacteria 11691
326 Ga0500639_043114 3300053163 Bacteria 2366
327 Ga0500576_015240 3300053725 Bacteria 3473
328 Ga0500645_003841 3300053730 Bacteria 5955
329 Ga0500596_001495 3300053735 Bacteria 4733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0044857 Ga0495625_0044857_19_1011 314
2 3300031728 Ga0316578_10039740 Ga0316578_100397402 319
3 3300049823 Ga0501044_0230681 Ga0501044_0230681_286_1452 343
4 3300035398 Ga0316574_0022693 Ga0316574_0022693_2221_3372 348
5 3300036712 Ga0316584_0040614 Ga0316584_0040614_1279_2430 348
6 3300049850 Ga0501204_000532 Ga0501204_000532_592_1755 348
7 3300031727 Ga0316576_10065479 Ga0316576_100654792 350
8 3300038443 Ga0395901_0043531 Ga0395901_0043531_21_1130 352
9 3300005539 Ga0068853_100302130 Ga0068853_1003021302 354
10 3300046460 Ga0495638_0000487 Ga0495638_0000487_13157_14329 354
11 3300046512 Ga0495610_0001057 Ga0495610_0001057_9133_10305 354
12 3300046524 Ga0495648_0000229 Ga0495648_0000229_48094_49272 354
13 3300046530 Ga0495654_0030904 Ga0495654_0030904_234_1412 354
14 3300046616 Ga0495668_0033502 Ga0495668_0033502_1081_2259 354
15 3300047469 Ga0495673_0000921 Ga0495673_0000921_14788_15966 354
16 3300049459 Ga0495678_000627 Ga0495678_000627_12958_14130 354
17 3300053086 Ga0500578_0000030 Ga0500578_0000030_81775_82947 354
18 3300053088 Ga0500644_0000298 Ga0500644_0000298_10723_11901 354
19 3300053088 Ga0500644_0011034 Ga0500644_0011034_534_1712 354
20 3300053118 Ga0500594_0000091 Ga0500594_0000091_18758_19930 354
21 3300053138 Ga0500564_000014 Ga0500564_000014_42773_43951 354
22 3300049822 Ga0501035_0005422 Ga0501035_0005422_4985_6124 355
23 3300053730 Ga0500645_003841 Ga0500645_003841_61_1275 361
24 3300005336 Ga0070680_100001930 Ga0070680_1000019304 362
25 3300005366 Ga0070659_100008170 Ga0070659_1000081704 362
26 3300005458 Ga0070681_10001467 Ga0070681_100014677 362
27 3300005530 Ga0070679_100010790 Ga0070679_1000107904 362
28 3300005577 Ga0068857_100127383 Ga0068857_1001273832 362
29 3300025909 Ga0207705_10001275 Ga0207705_100012754 362
30 3300025912 Ga0207707_10031964 Ga0207707_100319644 362
31 3300025917 Ga0207660_10009044 Ga0207660_100090445 362
32 3300025919 Ga0207657_10000314 Ga0207657_1000031415 362
33 3300025921 Ga0207652_10009397 Ga0207652_100093974 362
34 3300025932 Ga0207690_10072096 Ga0207690_100720962 362
35 3300025949 Ga0207667_10094970 Ga0207667_100949703 362
36 3300026041 Ga0207639_10226275 Ga0207639_102262752 362
37 3300026116 Ga0207674_10144108 Ga0207674_101441082 362
38 3300048905 Ga0496102_0001662 Ga0496102_0001662_2749_3867 362
39 3300048906 Ga0496103_0001024 Ga0496103_0001024_15693_16811 362
40 3300048919 Ga0496116_0002969 Ga0496116_0002969_436_1554 362
41 3300048920 Ga0496117_0003167 Ga0496117_0003167_2749_3867 362
42 3300048921 Ga0496118_0003535 Ga0496118_0003535_2749_3867 362
43 3300048922 Ga0496119_0043883 Ga0496119_0043883_1589_2707 362
44 3300048927 Ga0496124_0003394 Ga0496124_0003394_2749_3867 362
45 3300049679 Ga0501249_000593 Ga0501249_000593_3162_4370 363
46 3300003791 Ga0055530_10000026 Ga0055530_10000026102 364
47 3300003794 Ga0055531_10001705 Ga0055531_1000170512 364
48 3300005262 Ga0065165_1000803 Ga0065165_100080310 364
49 3300025297 Ga0209758_1000261 Ga0209758_100026143 364
50 3300025298 Ga0209050_1000029 Ga0209050_1000029195 364
51 3300025304 Ga0209257_1000152 Ga0209257_1000152121 364
52 3300005563 Ga0068855_100162136 Ga0068855_1001621362 365
53 3300009147 Ga0114129_10373974 Ga0114129_103739741 365
54 3300025904 Ga0207647_10052468 Ga0207647_100524682 365
55 3300025919 Ga0207657_10057869 Ga0207657_100578692 365
56 3300041486 Ga0451807_0455910 Ga0451807_0455910_3967_5094 365
57 3300050507 nmdc:mga05p37_357719_c1 nmdc:mga05p37_357719_c1_502_1689 365
58 3300046471 Ga0495650_0006928 Ga0495650_0006928_2262_3446 367
59 3300044719 Ga0466971_0068117 Ga0466971_0068117_24_1184 368
60 3300053087 Ga0500643_031092 Ga0500643_031092_16_1221 368
61 3300053096 Ga0500641_0001952 Ga0500641_0001952_1299_2507 368
62 3300049664 Ga0501224_004003 Ga0501224_004003_27_1262 369
63 3300049679 Ga0501249_000547 Ga0501249_000547_7611_8879 369
64 3300049850 Ga0501204_000686 Ga0501204_000686_115_1383 369
65 3300004801 Ga0058860_10028125 Ga0058860_100281252 370
66 3300005347 Ga0070668_100000005 Ga0070668_10000000562 370
67 3300005355 Ga0070671_100000027 Ga0070671_10000002753 370
68 3300005367 Ga0070667_100000004 Ga0070667_100000004108 370
69 3300005564 Ga0070664_100091423 Ga0070664_1000914232 370
70 3300005617 Ga0068859_100047324 Ga0068859_1000473243 370
71 3300005618 Ga0068864_100002750 Ga0068864_1000027507 370
72 3300005841 Ga0068863_100000180 Ga0068863_10000018028 370
73 3300005842 Ga0068858_100010802 Ga0068858_1000108024 370
74 3300005843 Ga0068860_100000002 Ga0068860_10000000294 370
75 3300005844 Ga0068862_100000577 Ga0068862_10000057721 370
76 3300006931 Ga0097620_100047324 Ga0097620_1000473243 370
77 3300014325 Ga0163163_10027728 Ga0163163_100277282 370
78 3300025903 Ga0207680_10042019 Ga0207680_100420193 370
79 3300025925 Ga0207650_10004812 Ga0207650_100048127 370
80 3300025925 Ga0207650_10010011 Ga0207650_100100114 370
81 3300025925 Ga0207650_10230189 Ga0207650_102301891 370
82 3300025931 Ga0207644_10000029 Ga0207644_10000029110 370
83 3300025945 Ga0207679_10090367 Ga0207679_100903671 370
84 3300025972 Ga0207668_10000008 Ga0207668_1000000822 370
85 3300025972 Ga0207668_10159338 Ga0207668_101593381 370
86 3300025986 Ga0207658_10000002 Ga0207658_10000002401 370
87 3300026035 Ga0207703_10009218 Ga0207703_100092186 370
88 3300026088 Ga0207641_10004749 Ga0207641_100047494 370
89 3300026095 Ga0207676_10004142 Ga0207676_100041425 370
90 3300028380 Ga0268265_10000872 Ga0268265_1000087224 370
91 3300028381 Ga0268264_10000001 Ga0268264_10000001726 370
92 3300031548 Ga0307408_100055922 Ga0307408_1000559222 370
93 3300031824 Ga0307413_10017701 Ga0307413_100177012 370
94 3300031995 Ga0307409_100046712 Ga0307409_1000467122 370
95 3300032002 Ga0307416_100026897 Ga0307416_1000268973 370
96 3300032005 Ga0307411_10038097 Ga0307411_100380972 370
97 3300032126 Ga0307415_100046983 Ga0307415_1000469832 370
98 3300046684 Ga0495669_0001201 Ga0495669_0001201_312_1526 370
99 3300047445 Ga0495677_0009866 Ga0495677_0009866_1972_3186 370
100 3300048915 Ga0496112_0349843 Ga0496112_0349843_94_1299 370
101 3300050511 nmdc:mga08y16_112842_c1 nmdc:mga08y16_112842_c1_574_1761 370
102 3300005336 Ga0070680_100216293 Ga0070680_1002162932 371
103 3300005339 Ga0070660_100059743 Ga0070660_1000597432 371
104 3300005539 Ga0068853_100009038 Ga0068853_1000090384 371
105 3300005563 Ga0068855_100006244 Ga0068855_1000062449 371
106 3300009093 Ga0105240_10034214 Ga0105240_100342145 371
107 3300009174 Ga0105241_10070428 Ga0105241_100704282 371
108 3300009551 Ga0105238_10247551 Ga0105238_102475512 371
109 3300025917 Ga0207660_10100676 Ga0207660_101006762 371
110 3300025919 Ga0207657_10068970 Ga0207657_100689702 371
111 3300025924 Ga0207694_10080593 Ga0207694_100805932 371
112 3300025949 Ga0207667_10004546 Ga0207667_100045467 371
113 3300026041 Ga0207639_10034889 Ga0207639_100348892 371
114 3300005578 Ga0068854_100004266 Ga0068854_1000042662 372
115 3300026089 Ga0207648_10208820 Ga0207648_102088201 372
116 3300025914 Ga0207671_10168487 Ga0207671_101684872 375
117 3300005331 Ga0070670_100024122 Ga0070670_1000241225 379
118 3300005347 Ga0070668_100002375 Ga0070668_10000237512 379
119 3300005355 Ga0070671_100000365 Ga0070671_1000003658 379
120 3300005367 Ga0070667_100005241 Ga0070667_1000052417 379
121 3300005548 Ga0070665_100023804 Ga0070665_1000238044 379
122 3300005617 Ga0068859_100000093 Ga0068859_10000009371 379
123 3300005841 Ga0068863_100052405 Ga0068863_1000524054 379
124 3300005842 Ga0068858_100018870 Ga0068858_1000188706 379
125 3300005843 Ga0068860_100027357 Ga0068860_1000273572 379
126 3300006931 Ga0097620_100000093 Ga0097620_10000009371 379
127 3300009177 Ga0105248_10004083 Ga0105248_1000408310 379
128 3300014325 Ga0163163_10006973 Ga0163163_100069732 379
129 3300025925 Ga0207650_10005576 Ga0207650_100055767 379
130 3300025931 Ga0207644_10000931 Ga0207644_1000093120 379
131 3300025941 Ga0207711_10018479 Ga0207711_100184793 379
132 3300025972 Ga0207668_10002237 Ga0207668_100022376 379
133 3300025986 Ga0207658_10003130 Ga0207658_100031308 379
134 3300039437 Ga0436365_1136680 Ga0436365_1136680_278_1507 379
135 3300045051 Ga0451576_0000023 Ga0451576_0000023_412882_414051 380
136 3300005335 Ga0070666_10031536 Ga0070666_100315363 381
137 3300005347 Ga0070668_100000159 Ga0070668_10000015928 381
138 3300005353 Ga0070669_100004604 Ga0070669_1000046047 381
139 3300005367 Ga0070667_100000120 Ga0070667_10000012044 381
140 3300005841 Ga0068863_100000053 Ga0068863_10000005345 381
141 3300005843 Ga0068860_100023577 Ga0068860_1000235772 381
142 3300025903 Ga0207680_10019694 Ga0207680_100196942 381
143 3300025923 Ga0207681_10003306 Ga0207681_100033066 381
144 3300025972 Ga0207668_10000027 Ga0207668_1000002745 381
145 3300025986 Ga0207658_10000091 Ga0207658_1000009144 381
146 3300026088 Ga0207641_10000093 Ga0207641_1000009377 381
147 3300028381 Ga0268264_10192322 Ga0268264_101923222 381
148 3300046513 Ga0495616_0000010 Ga0495616_0000010_36926_38113 381
149 3300053151 Ga0500604_0025273 Ga0500604_0025273_338_1525 381
150 3300053158 Ga0500627_0000398 Ga0500627_0000398_5652_6839 381
151 3300001990 JGI24737J22298_10003417 JGI24737J22298_100034175 382
152 3300001990 JGI24737J22298_10006083 JGI24737J22298_100060832 382
153 3300002075 JGI24738J21930_10000070 JGI24738J21930_1000007021 382
154 3300005327 Ga0070658_10005263 Ga0070658_100052637 382
155 3300025909 Ga0207705_10018191 Ga0207705_100181912 382
156 3300025933 Ga0207706_10012389 Ga0207706_100123892 382
157 3300044658 Ga0466972_0003004 Ga0466972_0003004_2663_3937 382
158 3300044684 Ga0466966_0076795 Ga0466966_0076795_153_1427 382
159 3300044693 Ga0466961_0011620 Ga0466961_0011620_912_2186 382
160 3300045836 Ga0466958_0011829 Ga0466958_0011829_601_1875 382
161 3300001990 JGI24737J22298_10008821 JGI24737J22298_100088212 383
162 3300002067 JGI24735J21928_10005746 JGI24735J21928_100057463 383
163 3300002067 JGI24735J21928_10007217 JGI24735J21928_100072172 383
164 3300002067 JGI24735J21928_10014977 JGI24735J21928_100149772 383
165 3300002772 JGI25164J39214_1004248 JGI25164J39214_10042482 383
166 3300003214 JGI25165J46597_1000350 JGI25165J46597_100035010 383
167 3300003323 rootH1_10146678 rootH1_101466782 383
168 3300003762 Ga0055542_1001554 Ga0055542_10015544 383
169 3300005327 Ga0070658_10000265 Ga0070658_100002656 383
170 3300005331 Ga0070670_100046938 Ga0070670_1000469382 383
171 3300005338 Ga0068868_100000102 Ga0068868_10000010242 383
172 3300005339 Ga0070660_100002070 Ga0070660_10000207012 383
173 3300005339 Ga0070660_100004060 Ga0070660_1000040602 383
174 3300005339 Ga0070660_100013777 Ga0070660_1000137773 383
175 3300005347 Ga0070668_100009484 Ga0070668_1000094843 383
176 3300005355 Ga0070671_100021975 Ga0070671_1000219754 383
177 3300005355 Ga0070671_100045111 Ga0070671_1000451113 383
178 3300005356 Ga0070674_100167118 Ga0070674_1001671182 383
179 3300005364 Ga0070673_100149660 Ga0070673_1001496602 383
180 3300005366 Ga0070659_100021934 Ga0070659_1000219342 383
181 3300005366 Ga0070659_100183190 Ga0070659_1001831902 383
182 3300005455 Ga0070663_100002287 Ga0070663_1000022876 383
183 3300005456 Ga0070678_100003080 Ga0070678_1000030805 383
184 3300005539 Ga0068853_100089829 Ga0068853_1000898292 383
185 3300005543 Ga0070672_100046080 Ga0070672_1000460802 383
186 3300005548 Ga0070665_100000884 Ga0070665_10000088440 383
187 3300005563 Ga0068855_100000036 Ga0068855_10000003660 383
188 3300005563 Ga0068855_100072830 Ga0068855_1000728303 383
189 3300005578 Ga0068854_100000445 Ga0068854_1000004453 383
190 3300005578 Ga0068854_100011660 Ga0068854_1000116603 383
191 3300005614 Ga0068856_100004545 Ga0068856_10000454513 383
192 3300005614 Ga0068856_100033631 Ga0068856_1000336312 383
193 3300005616 Ga0068852_100000383 Ga0068852_10000038313 383
194 3300005618 Ga0068864_100000616 Ga0068864_1000006165 383
195 3300005841 Ga0068863_100000282 Ga0068863_10000028243 383
196 3300005842 Ga0068858_100000219 Ga0068858_10000021960 383
197 3300005844 Ga0068862_100001608 Ga0068862_1000016086 383
198 3300005844 Ga0068862_100004057 Ga0068862_1000040579 383
199 3300006237 Ga0097621_100159864 Ga0097621_1001598642 383
200 3300006353 Ga0075370_10082189 Ga0075370_100821892 383
201 3300006358 Ga0068871_100027792 Ga0068871_1000277922 383
202 3300009093 Ga0105240_10173228 Ga0105240_101732282 383
203 3300009177 Ga0105248_10014533 Ga0105248_100145339 383
204 3300009551 Ga0105238_10009868 Ga0105238_100098688 383
205 3300010375 Ga0105239_10026072 Ga0105239_100260727 383
206 3300013104 Ga0157370_10000140 Ga0157370_1000014052 383
207 3300013104 Ga0157370_10078577 Ga0157370_100785772 383
208 3300013307 Ga0157372_10209061 Ga0157372_102090611 383
209 3300014968 Ga0157379_10022527 Ga0157379_100225274 383
210 3300025231 Ga0207427_101805 Ga0207427_1018052 383
211 3300025250 Ga0209026_1006687 Ga0209026_10066872 383
212 3300025254 Ga0209148_1000114 Ga0209148_1000114140 383
213 3300025254 Ga0209148_1000579 Ga0209148_100057930 383
214 3300025261 Ga0209233_1000319 Ga0209233_100031910 383
215 3300025272 Ga0209455_1000804 Ga0209455_10008046 383
216 3300025904 Ga0207647_10002272 Ga0207647_100022728 383
217 3300025904 Ga0207647_10064154 Ga0207647_100641542 383
218 3300025909 Ga0207705_10000014 Ga0207705_1000001436 383
219 3300025909 Ga0207705_10000244 Ga0207705_100002445 383
220 3300025913 Ga0207695_10201366 Ga0207695_102013661 383
221 3300025919 Ga0207657_10000103 Ga0207657_1000010314 383
222 3300025919 Ga0207657_10018618 Ga0207657_100186184 383
223 3300025931 Ga0207644_10085621 Ga0207644_100856212 383
224 3300025932 Ga0207690_10012940 Ga0207690_100129403 383
225 3300025937 Ga0207669_10042877 Ga0207669_100428772 383
226 3300025937 Ga0207669_10055215 Ga0207669_100552151 383
227 3300025941 Ga0207711_10006265 Ga0207711_100062652 383
228 3300025945 Ga0207679_10096532 Ga0207679_100965322 383
229 3300025949 Ga0207667_10000007 Ga0207667_10000007304 383
230 3300025961 Ga0207712_10077120 Ga0207712_100771202 383
231 3300025972 Ga0207668_10000046 Ga0207668_100000469 383
232 3300025981 Ga0207640_10001005 Ga0207640_1000100513 383
233 3300025981 Ga0207640_10008159 Ga0207640_100081593 383
234 3300026023 Ga0207677_10000168 Ga0207677_1000016833 383
235 3300026035 Ga0207703_10000675 Ga0207703_1000067521 383
236 3300026067 Ga0207678_10010133 Ga0207678_100101335 383
237 3300026078 Ga0207702_10206646 Ga0207702_102066462 383
238 3300026088 Ga0207641_10000376 Ga0207641_100003765 383
239 3300026095 Ga0207676_10000933 Ga0207676_1000093317 383
240 3300026121 Ga0207683_10027500 Ga0207683_100275002 383
241 3300026142 Ga0207698_10000314 Ga0207698_1000031414 383
242 3300028380 Ga0268265_10000441 Ga0268265_1000044113 383
243 3300028380 Ga0268265_10003990 Ga0268265_100039908 383
244 3300028786 Ga0307517_10076569 Ga0307517_100765692 383
245 3300031730 Ga0307516_10000006 Ga0307516_10000006285 383
246 3300033180 Ga0307510_10014136 Ga0307510_100141366 383
247 3300042005 Ga0439448_0001905 Ga0439448_0001905_2868_4073 383
248 3300042012 Ga0439455_0000134 Ga0439455_0000134_495_1700 383
249 3300042157 Ga0439458_0000076 Ga0439458_0000076_5865_7070 383
250 3300044694 Ga0466963_0067190 Ga0466963_0067190_399_1604 383
251 3300044842 Ga0466957_0009785 Ga0466957_0009785_3999_5204 383
252 3300044842 Ga0466957_0098555 Ga0466957_0098555_534_1739 383
253 3300045976 Ga0466967_0027268 Ga0466967_0027268_2972_4177 383
254 3300046507 Ga0495606_0074289 Ga0495606_0074289_85_1290 383
255 3300046512 Ga0495610_0051292 Ga0495610_0051292_691_1896 383
256 3300046557 Ga0495622_0005805 Ga0495622_0005805_1560_2834 383
257 3300046616 Ga0495668_0114598 Ga0495668_0114598_67_1269 383
258 3300047472 Ga0495686_0025376 Ga0495686_0025376_535_1728 383
259 3300047673 Ga0495593_0077950 Ga0495593_0077950_87_1361 383
260 3300048905 Ga0496102_0142485 Ga0496102_0142485_763_1965 383
261 3300048906 Ga0496103_0107335 Ga0496103_0107335_121_1323 383
262 3300048920 Ga0496117_0009859 Ga0496117_0009859_1898_3100 383
263 3300048920 Ga0496117_0047793 Ga0496117_0047793_960_2195 383
264 3300048920 Ga0496117_0053381 Ga0496117_0053381_719_1924 383
265 3300048921 Ga0496118_0016059 Ga0496118_0016059_4475_5680 383
266 3300048921 Ga0496118_0114920 Ga0496118_0114920_53_1255 383
267 3300048922 Ga0496119_0032100 Ga0496119_0032100_666_1871 383
268 3300048923 Ga0496120_0068468 Ga0496120_0068468_21_1226 383
269 3300048924 Ga0496121_0000009 Ga0496121_0000009_348076_349278 383
270 3300048924 Ga0496121_0009552 Ga0496121_0009552_2020_3225 383
271 3300053136 Ga0500559_0013689 Ga0500559_0013689_109_1302 383
272 3300053163 Ga0500639_043114 Ga0500639_043114_124_1398 383
273 3300053725 Ga0500576_015240 Ga0500576_015240_1557_2831 383
274 3300053735 Ga0500596_001495 Ga0500596_001495_2759_4033 383
275 3300005539 Ga0068853_100076752 Ga0068853_1000767522 384
276 3300005548 Ga0070665_100033359 Ga0070665_1000333592 384
277 3300013307 Ga0157372_10105546 Ga0157372_101055462 384
278 3300028379 Ga0268266_10061870 Ga0268266_100618702 384
279 3300031456 Ga0307513_10009979 Ga0307513_100099798 384
280 3300037312 Ga0395899_0002840 Ga0395899_0002840_4976_6169 384
281 3300037418 Ga0395900_0017495 Ga0395900_0017495_6091_7284 384
282 3300037471 Ga0395905_0011424 Ga0395905_0011424_5357_6550 384
283 3300038443 Ga0395901_0025052 Ga0395901_0025052_1302_2495 384
284 3300048915 Ga0496112_0049555 Ga0496112_0049555_2352_3545 384
285 3300048916 Ga0496113_0032980 Ga0496113_0032980_1996_3189 384
286 3300013105 Ga0157369_10038578 Ga0157369_100385783 385
287 3300013105 Ga0157369_10120641 Ga0157369_101206412 385
288 3300013307 Ga0157372_10001499 Ga0157372_1000149922 385
289 3300013307 Ga0157372_10163715 Ga0157372_101637152 385
290 3300037312 Ga0395899_0000730 Ga0395899_0000730_18834_20222 385
291 3300042005 Ga0439448_0000224 Ga0439448_0000224_3377_4753 385
292 3300042012 Ga0439455_0000045 Ga0439455_0000045_3532_4908 385
293 3300001976 JGI24752J21851_1002398 JGI24752J21851_10023983 387
294 3300002239 JGI24034J26672_10009761 JGI24034J26672_100097611 387
295 3300005331 Ga0070670_100020256 Ga0070670_1000202563 387
296 3300005335 Ga0070666_10000098 Ga0070666_1000009812 387
297 3300005347 Ga0070668_100012390 Ga0070668_1000123902 387
298 3300005353 Ga0070669_100000029 Ga0070669_10000002986 387
299 3300005355 Ga0070671_100000016 Ga0070671_10000001670 387
300 3300005367 Ga0070667_100039525 Ga0070667_1000395253 387
301 3300005445 Ga0070708_100023434 Ga0070708_1000234345 387
302 3300005544 Ga0070686_100029286 Ga0070686_1000292862 387
303 3300005617 Ga0068859_100003218 Ga0068859_10000321810 387
304 3300005618 Ga0068864_100007265 Ga0068864_1000072655 387
305 3300005719 Ga0068861_100017816 Ga0068861_1000178162 387
306 3300005841 Ga0068863_100034391 Ga0068863_1000343912 387
307 3300005842 Ga0068858_100007702 Ga0068858_1000077026 387
308 3300005843 Ga0068860_100007191 Ga0068860_10000719110 387
309 3300005844 Ga0068862_100000606 Ga0068862_10000060620 387
310 3300006931 Ga0097620_100003218 Ga0097620_10000321810 387
311 3300009101 Ga0105247_10000521 Ga0105247_100005219 387
312 3300009177 Ga0105248_10104685 Ga0105248_101046852 387
313 3300009553 Ga0105249_10012133 Ga0105249_100121334 387
314 3300014325 Ga0163163_10130113 Ga0163163_101301133 387
315 3300014968 Ga0157379_10013898 Ga0157379_100138985 387
316 3300025315 Ga0207697_10000164 Ga0207697_1000016424 387
317 3300025900 Ga0207710_10002428 Ga0207710_100024286 387
318 3300025903 Ga0207680_10000130 Ga0207680_1000013015 387
319 3300025923 Ga0207681_10000040 Ga0207681_1000004085 387
320 3300025925 Ga0207650_10008678 Ga0207650_100086782 387
321 3300025931 Ga0207644_10000023 Ga0207644_1000002370 387
322 3300025961 Ga0207712_10033277 Ga0207712_100332772 387
323 3300025972 Ga0207668_10000754 Ga0207668_100007545 387
324 3300025986 Ga0207658_10030731 Ga0207658_100307313 387
325 3300026035 Ga0207703_10007167 Ga0207703_100071673 387
326 3300026095 Ga0207676_10002964 Ga0207676_100029649 387
327 3300026118 Ga0207675_100000582 Ga0207675_10000058226 387
328 3300028380 Ga0268265_10000098 Ga0268265_1000009856 387
329 3300028381 Ga0268264_10000141 Ga0268264_1000014194 387

Structural Annotation

Top 5 Hits

ID Description Score Start End
5enz-assembly1.cif.gz_A s. aureus mnaa-udp co-structure 0.6598 3 387
3l7l-assembly3.cif.gz_D structure of the wall teichoic acid polymerase tagf, h444n + cdpg (30 minute soak) 0.6577 1 380
5tzk-assembly1.cif.gz_C crystal structure of s. aureus tars 1-349 in complex with udp 0.654 1 65
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.6526 2 105
5enz-assembly1.cif.gz_A s. aureus mnaa-udp co-structure 0.6505 3 387
ID Description Score Start End Superfamily
af_A4HXJ0_290_600_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7318 33 63 3.40.50.150
af_Q2FWE1_84_278_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6981 4 105 3.40.50.150
af_A0A0R4J2U6_3_172_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6855 3 105 3.40.50.150
af_I1MQ93_5_170_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6707 3 123 3.40.50.150
af_Q2G1J3_4_329_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6669 6 310 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1G5TTA0-F1-model_v4 CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase 0.9694 3 381 GO:0016740
AF-A0A6M8HUE0-F1-model_v4 Uncharacterized protein 0.9617 2 383
AF-A0A1G5TTA0-F1-model_v4 CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase 0.9594 3 381 GO:0016740
AF-A0A3A0ES31-F1-model_v4 Glycosyl transferase 0.9583 1 387 GO:0016020
GO:0047355
AF-A0A3A0ES31-F1-model_v4 Glycosyl transferase 0.9559 1 387 GO:0016020
GO:0047355

Feature Viewer

pLDDT pTM Quality
85.9 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map