F409584

General Info

Members Datasets Scaffolds Average Seq Length
329 142 658 119

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100025719|Ga0070697_1000257194
Length 146
Sequence LYAGCVSRKFCRFNVVTLLTFVTITELMNASLRSAIIAEWRGLPEKKTRPDRFQRTAELLPQIMQRLGLRERLHETEVIDAWSKIVGEFIAAHSAPVALRESILYVRVLQPALHYELEQVSKIDILRKLKKRFGGKTIRDVRFRIG

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.12
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 43.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100025719 3300005536 Unclassified 4695
2 SwRhRL2b_contig_1853854 2162886007 Unclassified 1679
3 JGI25406J46586_10000002 3300003203 Bacteria 202415
4 Ga0065712_10087286 3300005290 Bacteria 2575
5 Ga0065712_10133406 3300005290 Unclassified 1523
6 Ga0065712_10832438 3300005290 Unclassified 502
7 Ga0065715_10409753 3300005293 Bacteria 871
8 Ga0065715_10631030 3300005293 Unclassified 689
9 Ga0065707_10371081 3300005295 Bacteria 890
10 Ga0070676_10333658 3300005328 Unclassified 1038
11 Ga0070676_11266773 3300005328 Unclassified 562
12 Ga0068869_100083569 3300005334 Bacteria 2388
13 Ga0068868_100055757 3300005338 Unclassified 3119
14 Ga0068868_100568894 3300005338 Unclassified 1001
15 Ga0070660_101249139 3300005339 Unclassified 630
16 Ga0070668_100392670 3300005347 Bacteria 1183
17 Ga0070669_100282800 3300005353 Unclassified 1330
18 Ga0070675_100129359 3300005354 Bacteria 2150
19 Ga0070675_100498047 3300005354 Bacteria 1098
20 Ga0070675_101902375 3300005354 Unclassified 549
21 Ga0070671_100032350 3300005355 Bacteria 4325
22 Ga0070674_100961117 3300005356 Unclassified 747
23 Ga0070673_100117494 3300005364 Unclassified 2213
24 Ga0070673_100315031 3300005364 Bacteria 1381
25 Ga0070659_100546160 3300005366 Bacteria 992
26 Ga0070667_100497059 3300005367 Bacteria 1118
27 Ga0070667_101463144 3300005367 Unclassified 641
28 Ga0070714_100423132 3300005435 Bacteria 1262
29 Ga0070714_101680447 3300005435 Unclassified 620
30 Ga0070713_100092124 3300005436 Unclassified 2609
31 Ga0070713_100283998 3300005436 Bacteria 1519
32 Ga0070713_100339570 3300005436 Bacteria 1391
33 Ga0070710_10075822 3300005437 Bacteria 1950
34 Ga0070710_10234717 3300005437 Bacteria 1172
35 Ga0070710_10647074 3300005437 Unclassified 741
36 Ga0070705_100153098 3300005440 Unclassified 1532
37 Ga0070705_100257721 3300005440 Unclassified 1228
38 Ga0070705_101771624 3300005440 Unclassified 523
39 Ga0070708_100078077 3300005445 Unclassified 2993
40 Ga0070708_100130795 3300005445 Bacteria 2323
41 Ga0070708_100531161 3300005445 Unclassified 1110
42 Ga0070708_101713812 3300005445 Unclassified 584
43 Ga0070678_100057191 3300005456 Bacteria 2856
44 Ga0070678_101168098 3300005456 Unclassified 713
45 Ga0070662_100175243 3300005457 Bacteria 1687
46 Ga0070662_100487856 3300005457 Unclassified 1026
47 Ga0070706_100000292 3300005467 Bacteria 60823
48 Ga0070706_100011508 3300005467 Bacteria 8225
49 Ga0070706_100031290 3300005467 Unclassified 4907
50 Ga0070706_100113197 3300005467 Bacteria 2527
51 Ga0070706_100129701 3300005467 Bacteria 2353
52 Ga0070706_100187481 3300005467 Bacteria 1933
53 Ga0070706_100594391 3300005467 Unclassified 1028
54 Ga0070706_101097225 3300005467 Unclassified 733
55 Ga0070706_101249080 3300005467 Unclassified 682
56 Ga0070707_100003140 3300005468 Bacteria 15631
57 Ga0070707_100006583 3300005468 Bacteria 10781
58 Ga0070707_100014980 3300005468 Bacteria 7276
59 Ga0070707_100043917 3300005468 Unclassified 4278
60 Ga0070707_100072664 3300005468 Bacteria 3315
61 Ga0070707_100116223 3300005468 Bacteria 2596
62 Ga0070707_100165820 3300005468 Unclassified 2153
63 Ga0070707_100214036 3300005468 Unclassified 1878
64 Ga0070707_100459727 3300005468 Bacteria 1234
65 Ga0070707_100702757 3300005468 Unclassified 974
66 Ga0070707_100899608 3300005468 Bacteria 850
67 Ga0070698_100040664 3300005471 Bacteria 4777
68 Ga0070698_100095543 3300005471 Bacteria 2950
69 Ga0070698_100153961 3300005471 Bacteria 2245
70 Ga0070699_100077538 3300005518 Bacteria 2893
71 Ga0070699_100135079 3300005518 Unclassified 2176
72 Ga0070699_101007203 3300005518 Bacteria 764
73 Ga0070699_101055577 3300005518 Unclassified 745
74 Ga0070697_100003585 3300005536 Bacteria 11931
75 Ga0070697_100006841 3300005536 Bacteria 8856
76 Ga0070697_100028683 3300005536 Bacteria 4458
77 Ga0070697_100045833 3300005536 Bacteria 3544
78 Ga0070697_100072133 3300005536 Bacteria 2833
79 Ga0070697_100117215 3300005536 Bacteria 2225
80 Ga0070697_100606041 3300005536 Unclassified 963
81 Ga0070672_100032819 3300005543 Bacteria 3924
82 Ga0070672_100617721 3300005543 Unclassified 945
83 Ga0070672_101969557 3300005543 Unclassified 526
84 Ga0070695_100024954 3300005545 Bacteria 3687
85 Ga0070665_100298399 3300005548 Unclassified 1614
86 Ga0070704_100801459 3300005549 Unclassified 842
87 Ga0068855_101423132 3300005563 Bacteria 714
88 Ga0068866_10135469 3300005718 Bacteria 1407
89 Ga0068863_102399064 3300005841 Unclassified 537
90 Ga0068860_100208894 3300005843 Unclassified 1893
91 Ga0068862_100461035 3300005844 Unclassified 1200
92 Ga0081455_10003939 3300005937 Bacteria 16880
93 Ga0081455_10331734 3300005937 Bacteria 1080
94 Ga0081455_10545833 3300005937 Unclassified 768
95 Ga0081540_1000020 3300005983 Bacteria 163043
96 Ga0081540_1020657 3300005983 Unclassified 3951
97 Ga0081540_1072477 3300005983 Bacteria 1586
98 Ga0081540_1169890 3300005983 Unclassified 832
99 Ga0081539_10000061 3300005985 Bacteria 250890
100 Ga0070717_10020916 3300006028 Bacteria 5151
101 Ga0070717_10023412 3300006028 Bacteria 4893
102 Ga0070717_10111359 3300006028 Bacteria 2336
103 Ga0070717_10968994 3300006028 Bacteria 774
104 Ga0070717_10978232 3300006028 Bacteria 770
105 Ga0070715_10073194 3300006163 Bacteria 1536
106 Ga0070715_10153732 3300006163 Unclassified 1130
107 Ga0070716_100066323 3300006173 Unclassified 2105
108 Ga0070716_100170538 3300006173 Unclassified 1420
109 Ga0070716_100662273 3300006173 Unclassified 793
110 Ga0070712_100014698 3300006175 Bacteria 5025
111 Ga0070712_100028906 3300006175 Bacteria 3712
112 Ga0070712_100069777 3300006175 Bacteria 2508
113 Ga0070712_100139783 3300006175 Bacteria 1846
114 Ga0070712_100323418 3300006175 Bacteria 1255
115 Ga0070712_101425545 3300006175 Unclassified 605
116 Ga0075428_101231401 3300006844 Bacteria 788
117 Ga0075436_100118388 3300006914 Unclassified 1852
118 Ga0099794_10331779 3300007265 Bacteria 790
119 Ga0105250_10375315 3300009092 Unclassified 627
120 Ga0105245_10271493 3300009098 Bacteria 1654
121 Ga0114129_10010599 3300009147 Bacteria 13142
122 Ga0114129_10476215 3300009147 Bacteria 1634
123 Ga0105243_11149893 3300009148 Bacteria 787
124 Ga0105242_10143452 3300009176 Unclassified 2075
125 Ga0105242_10978729 3300009176 Bacteria 852
126 Ga0105237_10677609 3300009545 Bacteria 1038
127 Ga0105237_10771889 3300009545 Unclassified 968
128 Ga0105249_10093111 3300009553 Bacteria 2822
129 Ga0105239_10251871 3300010375 Bacteria 1983
130 Ga0105239_10642464 3300010375 Unclassified 1212
131 Ga0105239_12673665 3300010375 Unclassified 582
132 Ga0157374_10038818 3300013296 Bacteria 4379
133 Ga0157374_10066423 3300013296 Unclassified 3389
134 Ga0157374_10138193 3300013296 Bacteria 2363
135 Ga0157374_10453509 3300013296 Bacteria 1284
136 Ga0157374_10830675 3300013296 Unclassified 940
137 Ga0157378_10022371 3300013297 Bacteria 5566
138 Ga0157378_10063325 3300013297 Bacteria 3304
139 Ga0157378_10100472 3300013297 Bacteria 2641
140 Ga0157378_10153817 3300013297 Unclassified 2145
141 Ga0157378_10407465 3300013297 Bacteria 1341
142 Ga0157378_10456341 3300013297 Bacteria 1269
143 Ga0157378_10487181 3300013297 Bacteria 1230
144 Ga0157378_10576077 3300013297 Unclassified 1134
145 Ga0157378_11169156 3300013297 Unclassified 808
146 Ga0163162_10024026 3300013306 Bacteria 6015
147 Ga0163162_10241926 3300013306 Bacteria 1936
148 Ga0163162_10852357 3300013306 Unclassified 1026
149 Ga0157372_10350369 3300013307 Bacteria 1720
150 Ga0157375_10017982 3300013308 Bacteria 6401
151 Ga0157375_10089261 3300013308 Bacteria 3138
152 Ga0157376_10543138 3300014969 Bacteria 1149
153 Ga0163161_11422525 3300017792 Unclassified 606
154 Ga0207666_1010576 3300025271 Unclassified 1264
155 Ga0207673_1053433 3300025290 Unclassified 573
156 Ga0207697_10003519 3300025315 Bacteria 7721
157 Ga0207697_10025134 3300025315 Unclassified 2436
158 Ga0207697_10091090 3300025315 Bacteria 1292
159 Ga0207688_10225134 3300025901 Bacteria 1131
160 Ga0207680_10641714 3300025903 Unclassified 760
161 Ga0207685_10101192 3300025905 Bacteria 1232
162 Ga0207685_10247966 3300025905 Unclassified 860
163 Ga0207685_10383255 3300025905 Bacteria 717
164 Ga0207699_10301210 3300025906 Bacteria 1119
165 Ga0207699_10411957 3300025906 Unclassified 964
166 Ga0207645_10050640 3300025907 Bacteria 2652
167 Ga0207645_10106709 3300025907 Unclassified 1811
168 Ga0207645_10130783 3300025907 Bacteria 1634
169 Ga0207645_10531788 3300025907 Unclassified 797
170 Ga0207684_10000347 3300025910 Bacteria 64001
171 Ga0207684_10018413 3300025910 Bacteria 5979
172 Ga0207684_10043718 3300025910 Bacteria 3798
173 Ga0207684_10145436 3300025910 Bacteria 2039
174 Ga0207684_10186743 3300025910 Bacteria 1787
175 Ga0207684_10267631 3300025910 Bacteria 1475
176 Ga0207684_11041635 3300025910 Unclassified 683
177 Ga0207684_11177396 3300025910 Unclassified 635
178 Ga0207684_11365656 3300025910 Unclassified 581
179 Ga0207684_11422792 3300025910 Bacteria 567
180 Ga0207684_11441396 3300025910 Unclassified 562
181 Ga0207684_11478713 3300025910 Unclassified 553
182 Ga0207693_10006676 3300025915 Bacteria 9531
183 Ga0207693_10027511 3300025915 Bacteria 4495
184 Ga0207693_10035098 3300025915 Bacteria 3955
185 Ga0207693_10035214 3300025915 Unclassified 3947
186 Ga0207693_10060119 3300025915 Bacteria 2976
187 Ga0207693_10367792 3300025915 Bacteria 1125
188 Ga0207663_10042824 3300025916 Unclassified 2768
189 Ga0207663_10157910 3300025916 Unclassified 1597
190 Ga0207663_10221386 3300025916 Unclassified 1377
191 Ga0207663_10308877 3300025916 Unclassified 1184
192 Ga0207657_10899290 3300025919 Unclassified 682
193 Ga0207646_10000411 3300025922 Bacteria 57429
194 Ga0207646_10007714 3300025922 Bacteria 10893
195 Ga0207646_10051703 3300025922 Bacteria 3676
196 Ga0207646_10080328 3300025922 Bacteria 2916
197 Ga0207646_10082291 3300025922 Unclassified 2879
198 Ga0207646_10092867 3300025922 Bacteria 2702
199 Ga0207646_10099138 3300025922 Unclassified 2611
200 Ga0207646_10208088 3300025922 Bacteria 1767
201 Ga0207646_10550532 3300025922 Bacteria 1037
202 Ga0207646_10672673 3300025922 Bacteria 927
203 Ga0207646_11305388 3300025922 Unclassified 634
204 Ga0207681_10033603 3300025923 Bacteria 3364
205 Ga0207681_10224003 3300025923 Unclassified 1456
206 Ga0207659_10116557 3300025926 Bacteria 2040
207 Ga0207659_10178333 3300025926 Bacteria 1681
208 Ga0207659_10660961 3300025926 Bacteria 893
209 Ga0207687_10831143 3300025927 Bacteria 789
210 Ga0207700_10057436 3300025928 Bacteria 2934
211 Ga0207700_10068746 3300025928 Bacteria 2716
212 Ga0207664_10155637 3300025929 Unclassified 1945
213 Ga0207644_10034214 3300025931 Bacteria 3555
214 Ga0207644_10066796 3300025931 Bacteria 2619
215 Ga0207644_10335944 3300025931 Bacteria 1224
216 Ga0207690_11788010 3300025932 Unclassified 513
217 Ga0207706_10005432 3300025933 Bacteria 11875
218 Ga0207706_10024037 3300025933 Bacteria 5468
219 Ga0207706_10359050 3300025933 Unclassified 1266
220 Ga0207706_10611867 3300025933 Unclassified 935
221 Ga0207706_10984010 3300025933 Bacteria 709
222 Ga0207669_10604281 3300025937 Unclassified 892
223 Ga0207704_10734709 3300025938 Unclassified 820
224 Ga0207665_10059679 3300025939 Unclassified 2582
225 Ga0207665_10220427 3300025939 Bacteria 1390
226 Ga0207665_10664451 3300025939 Unclassified 817
227 Ga0207665_11081696 3300025939 Unclassified 639
228 Ga0207691_10101470 3300025940 Bacteria 2568
229 Ga0207691_10173235 3300025940 Bacteria 1889
230 Ga0207691_10754889 3300025940 Unclassified 819
231 Ga0207689_10111184 3300025942 Bacteria 2252
232 Ga0207667_11573680 3300025949 Unclassified 627
233 Ga0207651_10190547 3300025960 Bacteria 1635
234 Ga0207651_10480039 3300025960 Unclassified 1071
235 Ga0207668_10051582 3300025972 Bacteria 2842
236 Ga0207668_10673555 3300025972 Bacteria 907
237 Ga0207658_10403922 3300025986 Unclassified 1201
238 Ga0207683_10043644 3300026121 Unclassified 3918
239 Ga0207683_10051556 3300026121 Bacteria 3605
240 Ga0209974_10003971 3300027876 Bacteria 5292
241 Ga0268266_10515199 3300028379 Unclassified 1143
242 Ga0268266_11534597 3300028379 Unclassified 642
243 Ga0373926_0334238 3300035083 Unclassified 594
244 Ga0373945_0133835 3300035116 Unclassified 995
245 Ga0373945_0158168 3300035116 Unclassified 922
246 Ga0373943_0056900 3300035170 Unclassified 1942
247 Ga0373943_0198257 3300035170 Bacteria 1110
248 Ga0373946_0172526 3300035171 Bacteria 1022
249 Ga0373946_0249189 3300035171 Unclassified 866
250 Ga0373946_0713292 3300035171 Unclassified 525
251 Ga0373931_0022412 3300035691 Bacteria 3179
252 Ga0373931_0325377 3300035691 Bacteria 956
253 Ga0373935_0111771 3300035692 Bacteria 1814
254 Ga0373935_0176178 3300035692 Bacteria 1466
255 Ga0373935_0947661 3300035692 Unclassified 638
256 Ga0373927_0215023 3300035695 Unclassified 1263
257 Ga0373927_0974328 3300035695 Unclassified 559
258 Ga0373947_0024096 3300035725 Bacteria 3544
259 Ga0373947_0052982 3300035725 Unclassified 2445
260 Ga0373947_0272702 3300035725 Unclassified 1123
261 Ga0373925_1234089 3300037068 Bacteria 614
262 Ga0395899_0052102 3300037312 Bacteria 3035
263 Ga0395899_0074346 3300037312 Bacteria 2483
264 Ga0395899_0315643 3300037312 Unclassified 1054
265 Ga0395899_0460721 3300037312 Bacteria 831
266 Ga0395900_0045398 3300037418 Bacteria 4526
267 Ga0395900_0047187 3300037418 Bacteria 4435
268 Ga0395900_0071125 3300037418 Bacteria 3576
269 Ga0395900_0356594 3300037418 Unclassified 1435
270 Ga0395900_0947645 3300037418 Unclassified 782
271 Ga0395898_0005651 3300037466 Bacteria 13480
272 Ga0395898_0136235 3300037466 Bacteria 2351
273 Ga0395898_1258088 3300037466 Unclassified 670
274 Ga0395898_1892719 3300037466 Unclassified 517
275 Ga0395905_0006645 3300037471 Bacteria 11598
276 Ga0395905_1205413 3300037471 Unclassified 660
277 Ga0395901_0000532 3300038443 Bacteria 43915
278 Ga0395901_0096790 3300038443 Bacteria 3093
279 Ga0395901_0229435 3300038443 Unclassified 1939
280 Ga0395901_1098381 3300038443 Unclassified 766
281 Ga0395901_1361762 3300038443 Bacteria 669
282 Ga0436363_0175827 3300039450 Bacteria 918
283 Ga0495629_0351853 3300046459 Unclassified 1005
284 Ga0495580_1022779 3300046472 Unclassified 526
285 Ga0495662_0048118 3300046476 Bacteria 2059
286 Ga0495584_0566514 3300046491 Unclassified 579
287 Ga0495630_0003022 3300046517 Bacteria 11663
288 Ga0495642_0384929 3300046528 Unclassified 618
289 Ga0495598_0006715 3300046537 Bacteria 2609
290 Ga0495609_0298158 3300046538 Unclassified 657
291 Ga0495635_0623113 3300046663 Unclassified 703
292 Ga0495659_0247781 3300046664 Unclassified 742
293 Ga0495669_0033482 3300046684 Bacteria 2261
294 Ga0495624_0105764 3300046690 Bacteria 1732
295 Ga0495589_0326442 3300046794 Unclassified 709
296 Ga0495674_0390254 3300047319 Bacteria 1125
297 Ga0495684_0041915 3300047471 Bacteria 3507
298 Ga0496100_0083038 3300048903 Bacteria 2168
299 Ga0496101_0030642 3300048904 Bacteria 3774
300 Ga0496101_0209422 3300048904 Bacteria 1510
301 Ga0496101_0342936 3300048904 Bacteria 1173
302 Ga0496102_0064686 3300048905 Bacteria 3350
303 Ga0496102_0303065 3300048905 Bacteria 1506
304 Ga0496103_0276226 3300048906 Bacteria 1081
305 Ga0496104_0482192 3300048907 Unclassified 1151
306 Ga0496104_1048346 3300048907 Bacteria 719
307 Ga0496104_1819287 3300048907 Unclassified 511
308 Ga0496105_0616114 3300048908 Bacteria 841
309 Ga0496105_0617934 3300048908 Unclassified 839
310 Ga0496106_0006323 3300048909 Bacteria 8773
311 Ga0496107_0002054 3300048910 Bacteria 12870
312 Ga0496108_0500211 3300048911 Bacteria 1061
313 Ga0496108_1302478 3300048911 Unclassified 611
314 Ga0496109_0008632 3300048912 Bacteria 8674
315 Ga0496109_0016996 3300048912 Bacteria 6369
316 Ga0496109_0298170 3300048912 Bacteria 1520
317 Ga0496109_0372064 3300048912 Bacteria 1350
318 Ga0496109_1088686 3300048912 Unclassified 736
319 Ga0496110_0125265 3300048913 Unclassified 2318
320 Ga0496110_0838610 3300048913 Bacteria 824
321 Ga0496112_0288190 3300048915 Bacteria 1588
322 Ga0496112_0590781 3300048915 Unclassified 1043
323 Ga0496112_1225492 3300048915 Unclassified 667
324 Ga0496113_0190194 3300048916 Unclassified 1629
325 Ga0496113_0320997 3300048916 Unclassified 1241
326 Ga0496115_0003162 3300048918 Bacteria 11841
327 Ga0496115_0049409 3300048918 Bacteria 3367
328 nmdc:mga05p37_9278_c1 3300050507 Bacteria 11634
329 nmdc:mga0n895_1769112_c1 3300050512 Unclassified 579
330 Ga0070697_100025719
331 SwRhRL2b_contig_1853854
332 JGI25406J46586_10000002
333 Ga0065712_10087286
334 Ga0065712_10133406
335 Ga0065712_10832438
336 Ga0065715_10409753
337 Ga0065715_10631030
338 Ga0065707_10371081
339 Ga0070676_10333658
340 Ga0070676_11266773
341 Ga0068869_100083569
342 Ga0068868_100055757
343 Ga0068868_100568894
344 Ga0070660_101249139
345 Ga0070668_100392670
346 Ga0070669_100282800
347 Ga0070675_100129359
348 Ga0070675_100498047
349 Ga0070675_101902375
350 Ga0070671_100032350
351 Ga0070674_100961117
352 Ga0070673_100117494
353 Ga0070673_100315031
354 Ga0070659_100546160
355 Ga0070667_100497059
356 Ga0070667_101463144
357 Ga0070714_100423132
358 Ga0070714_101680447
359 Ga0070713_100092124
360 Ga0070713_100283998
361 Ga0070713_100339570
362 Ga0070710_10075822
363 Ga0070710_10234717
364 Ga0070710_10647074
365 Ga0070705_100153098
366 Ga0070705_100257721
367 Ga0070705_101771624
368 Ga0070708_100078077
369 Ga0070708_100130795
370 Ga0070708_100531161
371 Ga0070708_101713812
372 Ga0070678_100057191
373 Ga0070678_101168098
374 Ga0070662_100175243
375 Ga0070662_100487856
376 Ga0070706_100000292
377 Ga0070706_100011508
378 Ga0070706_100031290
379 Ga0070706_100113197
380 Ga0070706_100129701
381 Ga0070706_100187481
382 Ga0070706_100594391
383 Ga0070706_101097225
384 Ga0070706_101249080
385 Ga0070707_100003140
386 Ga0070707_100006583
387 Ga0070707_100014980
388 Ga0070707_100043917
389 Ga0070707_100072664
390 Ga0070707_100116223
391 Ga0070707_100165820
392 Ga0070707_100214036
393 Ga0070707_100459727
394 Ga0070707_100702757
395 Ga0070707_100899608
396 Ga0070698_100040664
397 Ga0070698_100095543
398 Ga0070698_100153961
399 Ga0070699_100077538
400 Ga0070699_100135079
401 Ga0070699_101007203
402 Ga0070699_101055577
403 Ga0070697_100003585
404 Ga0070697_100006841
405 Ga0070697_100028683
406 Ga0070697_100045833
407 Ga0070697_100072133
408 Ga0070697_100117215
409 Ga0070697_100606041
410 Ga0070672_100032819
411 Ga0070672_100617721
412 Ga0070672_101969557
413 Ga0070695_100024954
414 Ga0070665_100298399
415 Ga0070704_100801459
416 Ga0068855_101423132
417 Ga0068866_10135469
418 Ga0068863_102399064
419 Ga0068860_100208894
420 Ga0068862_100461035
421 Ga0081455_10003939
422 Ga0081455_10331734
423 Ga0081455_10545833
424 Ga0081540_1000020
425 Ga0081540_1020657
426 Ga0081540_1072477
427 Ga0081540_1169890
428 Ga0081539_10000061
429 Ga0070717_10020916
430 Ga0070717_10023412
431 Ga0070717_10111359
432 Ga0070717_10968994
433 Ga0070717_10978232
434 Ga0070715_10073194
435 Ga0070715_10153732
436 Ga0070716_100066323
437 Ga0070716_100170538
438 Ga0070716_100662273
439 Ga0070712_100014698
440 Ga0070712_100028906
441 Ga0070712_100069777
442 Ga0070712_100139783
443 Ga0070712_100323418
444 Ga0070712_101425545
445 Ga0075428_101231401
446 Ga0075436_100118388
447 Ga0099794_10331779
448 Ga0105250_10375315
449 Ga0105245_10271493
450 Ga0114129_10010599
451 Ga0114129_10476215
452 Ga0105243_11149893
453 Ga0105242_10143452
454 Ga0105242_10978729
455 Ga0105237_10677609
456 Ga0105237_10771889
457 Ga0105249_10093111
458 Ga0105239_10251871
459 Ga0105239_10642464
460 Ga0105239_12673665
461 Ga0157374_10038818
462 Ga0157374_10066423
463 Ga0157374_10138193
464 Ga0157374_10453509
465 Ga0157374_10830675
466 Ga0157378_10022371
467 Ga0157378_10063325
468 Ga0157378_10100472
469 Ga0157378_10153817
470 Ga0157378_10407465
471 Ga0157378_10456341
472 Ga0157378_10487181
473 Ga0157378_10576077
474 Ga0157378_11169156
475 Ga0163162_10024026
476 Ga0163162_10241926
477 Ga0163162_10852357
478 Ga0157372_10350369
479 Ga0157375_10017982
480 Ga0157375_10089261
481 Ga0157376_10543138
482 Ga0163161_11422525
483 Ga0207666_1010576
484 Ga0207673_1053433
485 Ga0207697_10003519
486 Ga0207697_10025134
487 Ga0207697_10091090
488 Ga0207688_10225134
489 Ga0207680_10641714
490 Ga0207685_10101192
491 Ga0207685_10247966
492 Ga0207685_10383255
493 Ga0207699_10301210
494 Ga0207699_10411957
495 Ga0207645_10050640
496 Ga0207645_10106709
497 Ga0207645_10130783
498 Ga0207645_10531788
499 Ga0207684_10000347
500 Ga0207684_10018413
501 Ga0207684_10043718
502 Ga0207684_10145436
503 Ga0207684_10186743
504 Ga0207684_10267631
505 Ga0207684_11041635
506 Ga0207684_11177396
507 Ga0207684_11365656
508 Ga0207684_11422792
509 Ga0207684_11441396
510 Ga0207684_11478713
511 Ga0207693_10006676
512 Ga0207693_10027511
513 Ga0207693_10035098
514 Ga0207693_10035214
515 Ga0207693_10060119
516 Ga0207693_10367792
517 Ga0207663_10042824
518 Ga0207663_10157910
519 Ga0207663_10221386
520 Ga0207663_10308877
521 Ga0207657_10899290
522 Ga0207646_10000411
523 Ga0207646_10007714
524 Ga0207646_10051703
525 Ga0207646_10080328
526 Ga0207646_10082291
527 Ga0207646_10092867
528 Ga0207646_10099138
529 Ga0207646_10208088
530 Ga0207646_10550532
531 Ga0207646_10672673
532 Ga0207646_11305388
533 Ga0207681_10033603
534 Ga0207681_10224003
535 Ga0207659_10116557
536 Ga0207659_10178333
537 Ga0207659_10660961
538 Ga0207687_10831143
539 Ga0207700_10057436
540 Ga0207700_10068746
541 Ga0207664_10155637
542 Ga0207644_10034214
543 Ga0207644_10066796
544 Ga0207644_10335944
545 Ga0207690_11788010
546 Ga0207706_10005432
547 Ga0207706_10024037
548 Ga0207706_10359050
549 Ga0207706_10611867
550 Ga0207706_10984010
551 Ga0207669_10604281
552 Ga0207704_10734709
553 Ga0207665_10059679
554 Ga0207665_10220427
555 Ga0207665_10664451
556 Ga0207665_11081696
557 Ga0207691_10101470
558 Ga0207691_10173235
559 Ga0207691_10754889
560 Ga0207689_10111184
561 Ga0207667_11573680
562 Ga0207651_10190547
563 Ga0207651_10480039
564 Ga0207668_10051582
565 Ga0207668_10673555
566 Ga0207658_10403922
567 Ga0207683_10043644
568 Ga0207683_10051556
569 Ga0209974_10003971
570 Ga0268266_10515199
571 Ga0268266_11534597
572 Ga0373926_0334238
573 Ga0373945_0133835
574 Ga0373945_0158168
575 Ga0373943_0056900
576 Ga0373943_0198257
577 Ga0373946_0172526
578 Ga0373946_0249189
579 Ga0373946_0713292
580 Ga0373931_0022412
581 Ga0373931_0325377
582 Ga0373935_0111771
583 Ga0373935_0176178
584 Ga0373935_0947661
585 Ga0373927_0215023
586 Ga0373927_0974328
587 Ga0373947_0024096
588 Ga0373947_0052982
589 Ga0373947_0272702
590 Ga0373925_1234089
591 Ga0395899_0052102
592 Ga0395899_0074346
593 Ga0395899_0315643
594 Ga0395899_0460721
595 Ga0395900_0045398
596 Ga0395900_0047187
597 Ga0395900_0071125
598 Ga0395900_0356594
599 Ga0395900_0947645
600 Ga0395898_0005651
601 Ga0395898_0136235
602 Ga0395898_1258088
603 Ga0395898_1892719
604 Ga0395905_0006645
605 Ga0395905_1205413
606 Ga0395901_0000532
607 Ga0395901_0096790
608 Ga0395901_0229435
609 Ga0395901_1098381
610 Ga0395901_1361762
611 Ga0436363_0175827
612 Ga0495629_0351853
613 Ga0495580_1022779
614 Ga0495662_0048118
615 Ga0495584_0566514
616 Ga0495630_0003022
617 Ga0495642_0384929
618 Ga0495598_0006715
619 Ga0495609_0298158
620 Ga0495635_0623113
621 Ga0495659_0247781
622 Ga0495669_0033482
623 Ga0495624_0105764
624 Ga0495589_0326442
625 Ga0495674_0390254
626 Ga0495684_0041915
627 Ga0496100_0083038
628 Ga0496101_0030642
629 Ga0496101_0209422
630 Ga0496101_0342936
631 Ga0496102_0064686
632 Ga0496102_0303065
633 Ga0496103_0276226
634 Ga0496104_0482192
635 Ga0496104_1048346
636 Ga0496104_1819287
637 Ga0496105_0616114
638 Ga0496105_0617934
639 Ga0496106_0006323
640 Ga0496107_0002054
641 Ga0496108_0500211
642 Ga0496108_1302478
643 Ga0496109_0008632
644 Ga0496109_0016996
645 Ga0496109_0298170
646 Ga0496109_0372064
647 Ga0496109_1088686
648 Ga0496110_0125265
649 Ga0496110_0838610
650 Ga0496112_0288190
651 Ga0496112_0590781
652 Ga0496112_1225492
653 Ga0496113_0190194
654 Ga0496113_0320997
655 Ga0496115_0003162
656 Ga0496115_0049409
657 nmdc:mga05p37_9278_c1
658 nmdc:mga0n895_1769112_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

55

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8643 42 119
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8264 42 119
2jmp-assembly1.cif.gz_A structure for the n-terminus of chromosomal replication initiation protein dnaa from m. genitalium 0.8116 71 116
4tps-assembly1.cif.gz_B sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa 0.7626 49 119
2z51-assembly1.cif.gz_A-2 crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis 0.6983 48 117
ID Description Score Start End Superfamily
2jmpA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8116 71 116 3.30.300.20
af_P9WNW3_9_100_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8023 65 118 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7973 30 115 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7646 30 115 3.30.300.180
af_C0H578_105_189_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7638 49 118 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A2V5XT74-F1-model_v4 DUF721 domain-containing protein 0.9924 47 119
AF-A0A2V5QP05-F1-model_v4 DUF721 domain-containing protein 0.9921 44 119
AF-A0A6M1ZTE5-F1-model_v4 RNA-binding protein 0.9682 50 119
AF-A0A2V5XT74-F1-model_v4 DUF721 domain-containing protein 0.9535 47 119
AF-A0A517S792-F1-model_v4 DUF721 domain-containing protein 0.949 48 119

Map