F409501

General Info

Members Datasets Scaffolds Average Seq Length
329 220 658 184

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10044226|rootH1_100442263
Length 214
Sequence MSLVELIGQADERGLAASGLACLDRCVPLLGGDDEVLRPLWAALATDTGRPEQWAELLDQARGKLGGGGEFGSAAEGVPEGAGADEAVSLARRMLEAAPAARSGAELRAWADACSVAALRIHQLLDPLKDTAGSLDERREGRTEGMSPLVAAELRRQITVLELLAGHGPAGVRPALEVSTEGRRVLRAVVSRRSRRERPHGSSHLTTASPYRAV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
50 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
51 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
52 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
55 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
56 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
59 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
170 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
171 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
172 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
173 2643221548 Streptomyces sp. Root55 Isolate Unclassified
174 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
175 2643221647 Streptomyces sp. Root369 Isolate Unclassified
176 2643221670 Streptomyces sp. Root431 Isolate Unclassified
177 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
178 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
179 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
180 2643221714 Streptomyces sp. Root264 Isolate Unclassified
181 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
182 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
183 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
184 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
185 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
186 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
187 2808606448 Streptomyces sp. 193411 Isolate Unclassified
188 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
189 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
190 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
191 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
192 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
193 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
194 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
195 2862574272 Streptomyces sp. AcE210 Isolate Nodule
196 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
197 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
198 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
199 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
200 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
201 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
202 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
203 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
204 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
205 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
206 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
207 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
208 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
209 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
210 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
211 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
212 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
213 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
214 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
215 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
216 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
217 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
218 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
219 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
220 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.19
Metatranscriptomes 0
Isolates 15.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 1.22
Rhizoplane 1.52
Rhizosphere 76.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10044226 3300003323 Bacteria 15301
2 JGI24735J21928_10078633 3300002067 Bacteria 944
3 rootH1_10027081 3300003316 Bacteria 12706
4 rootH1_10037465 3300003316 Bacteria 14290
5 rootL2_10115812 3300003322 Bacteria 3134
6 rootH1_10301428 3300003323 Bacteria 1427
7 Ga0070668_101400755 3300005347 Bacteria 637
8 Ga0068867_101166389 3300005459 Bacteria 706
9 Ga0068853_100034189 3300005539 Bacteria 4314
10 Ga0070672_100564727 3300005543 Bacteria 989
11 Ga0075365_10135172 3300006038 Bacteria 1708
12 Ga0075367_10000592 3300006178 Bacteria 13919
13 Ga0099826_10077957 3300006948 Bacteria 2077
14 Ga0105250_10040545 3300009092 Bacteria 1867
15 Ga0105245_10455797 3300009098 Bacteria 1288
16 Ga0105242_10554073 3300009176 Bacteria 1103
17 Ga0105248_10138522 3300009177 Bacteria 2745
18 Ga0105238_10360903 3300009551 Bacteria 1442
19 Ga0105249_11161205 3300009553 Bacteria 843
20 Ga0105246_10014438 3300011119 Bacteria 4967
21 Ga0182008_10003613 3300014497 Bacteria 9256
22 Ga0182007_10000822 3300015262 Bacteria 17292
23 Ga0183367_1002 3300015688 Bacteria 1101531
24 Ga0209758_1018086 3300025297 Bacteria 3473
25 Ga0207426_1047938 3300025302 Bacteria 1286
26 Ga0207647_10007709 3300025904 Bacteria 7749
27 Ga0207686_10198569 3300025934 Bacteria 1435
28 Ga0207691_10249547 3300025940 Bacteria 1532
29 Ga0207711_10767891 3300025941 Bacteria 898
30 Ga0207668_11168401 3300025972 Bacteria 691
31 Ga0207639_10012770 3300026041 Bacteria 5859
32 Ga0209371_1005545 3300027312 Bacteria 4980
33 Ga0307515_10000497 3300028794 Bacteria 94190
34 Ga0307515_10092530 3300028794 Bacteria 3762
35 Ga0268256_1012877 3300030500 Bacteria 2565
36 Ga0307511_10000238 3300030521 Bacteria 56455
37 Ga0307511_10012823 3300030521 Bacteria 8204
38 Ga0307512_10005779 3300030522 Bacteria 12751
39 Ga0307512_10010667 3300030522 Bacteria 8743
40 Ga0307513_10010529 3300031456 Bacteria 11575
41 Ga0307513_10084668 3300031456 Bacteria 3256
42 Ga0307509_10011503 3300031507 Bacteria 10700
43 Ga0307509_10048064 3300031507 Bacteria 4585
44 Ga0307508_10004630 3300031616 Bacteria 13355
45 Ga0307508_10009865 3300031616 Bacteria 8753
46 Ga0307514_10014652 3300031649 Bacteria 6485
47 Ga0307514_10078297 3300031649 Bacteria 2456
48 Ga0307514_10089940 3300031649 Bacteria 2241
49 Ga0307516_10003058 3300031730 Bacteria 21831
50 Ga0307516_10091801 3300031730 Bacteria 2864
51 Ga0307516_10413075 3300031730 Bacteria 1008
52 Ga0307518_10066362 3300031838 Bacteria 2617
53 Ga0307518_10217123 3300031838 Bacteria 1252
54 Ga0307410_10765684 3300031852 Bacteria 818
55 Ga0307507_10036682 3300033179 Bacteria 5006
56 Ga0307507_10319436 3300033179 Bacteria 936
57 Ga0307510_10026931 3300033180 Bacteria 6597
58 Ga0307510_10041691 3300033180 Bacteria 5013
59 Ga0307510_10161476 3300033180 Bacteria 1837
60 Ga0307510_10324782 3300033180 Bacteria 995
61 Ga0395901_0472586 3300038443 Bacteria 1280
62 Ga0436365_0479943 3300039437 Bacteria 877
63 Ga0439436_0005704 3300041404 Bacteria 3815
64 Ga0439439_0012518 3300041406 Bacteria 2052
65 Ga0451853_0121869 3300041512 Bacteria 4081
66 Ga0451853_2365576 3300041512 Bacteria 3137
67 Ga0439433_0001037 3300041999 Bacteria 5632
68 Ga0439448_0021828 3300042005 Bacteria 1985
69 Ga0439449_0002149 3300042007 Bacteria 7740
70 Ga0439449_0008310 3300042007 Bacteria 3949
71 Ga0439449_0034595 3300042007 Bacteria 1881
72 Ga0439455_0001256 3300042012 Bacteria 4159
73 Ga0439457_004910 3300042014 Bacteria 3425
74 Ga0439457_005657 3300042014 Bacteria 3118
75 Ga0450920_064240 3300042122 Bacteria 743
76 Ga0450894_000249 3300042131 Bacteria 9678
77 Ga0450899_000564 3300042135 Bacteria 4221
78 Ga0450903_000168 3300042138 Bacteria 14356
79 Ga0450906_001013 3300042145 Bacteria 6172
80 Ga0439458_0003846 3300042157 Bacteria 3470
81 Ga0466969_0101820 3300044656 Bacteria 1351
82 Ga0466972_0003635 3300044658 Bacteria 7661
83 Ga0466972_0026503 3300044658 Bacteria 2873
84 Ga0466972_0058488 3300044658 Bacteria 1850
85 Ga0466965_0005212 3300044683 Bacteria 5841
86 Ga0466965_0153952 3300044683 Bacteria 1203
87 Ga0466966_0000253 3300044684 Bacteria 35392
88 Ga0466966_0004617 3300044684 Bacteria 9073
89 Ga0466966_0050302 3300044684 Bacteria 2652
90 Ga0466961_0001187 3300044693 Bacteria 16059
91 Ga0466961_0015138 3300044693 Bacteria 4951
92 Ga0466961_0226069 3300044693 Bacteria 1152
93 Ga0466963_0000226 3300044694 Bacteria 24096
94 Ga0466964_0010850 3300044706 Bacteria 3441
95 Ga0466971_0001611 3300044719 Bacteria 9517
96 Ga0466968_0010482 3300044735 Bacteria 3595
97 Ga0466970_0003063 3300044765 Bacteria 8116
98 Ga0466970_0007932 3300044765 Bacteria 5332
99 Ga0466970_0475645 3300044765 Bacteria 718
100 Ga0466957_0028783 3300044842 Bacteria 3309
101 Ga0466960_0007060 3300044901 Bacteria 4540
102 Ga0466959_0003039 3300045049 Bacteria 10848
103 Ga0466959_0042782 3300045049 Bacteria 3341
104 Ga0466959_0630372 3300045049 Bacteria 720
105 Ga0466958_0003109 3300045836 Bacteria 8526
106 Ga0466967_0030674 3300045976 Bacteria 4514
107 Ga0466967_0079980 3300045976 Bacteria 2948
108 Ga0495592_0010626 3300046454 Bacteria 6941
109 Ga0495592_0062512 3300046454 Bacteria 2733
110 Ga0495603_0003400 3300046455 Bacteria 9475
111 Ga0495603_0030575 3300046455 Bacteria 3242
112 Ga0495603_0068212 3300046455 Bacteria 2092
113 Ga0495590_0069932 3300046457 Bacteria 1231
114 Ga0495590_0187761 3300046457 Bacteria 757
115 Ga0495629_0009394 3300046459 Bacteria 7154
116 Ga0495629_0010131 3300046459 Bacteria 6874
117 Ga0495629_0028951 3300046459 Bacteria 3931
118 Ga0495629_0029311 3300046459 Bacteria 3904
119 Ga0495629_0077405 3300046459 Bacteria 2321
120 Ga0495629_0223601 3300046459 Bacteria 1298
121 Ga0495638_0032566 3300046460 Bacteria 3341
122 Ga0495638_0087291 3300046460 Bacteria 1884
123 Ga0495638_0115575 3300046460 Bacteria 1590
124 Ga0495651_0001724 3300046462 Bacteria 16876
125 Ga0495582_0015397 3300046473 Bacteria 4201
126 Ga0495582_0496703 3300046473 Bacteria 705
127 Ga0495605_0002633 3300046474 Bacteria 11011
128 Ga0495605_0046170 3300046474 Bacteria 2143
129 Ga0495639_0225944 3300046475 Bacteria 921
130 Ga0495662_0002264 3300046476 Bacteria 9699
131 Ga0495662_0014482 3300046476 Bacteria 3834
132 Ga0495662_0051061 3300046476 Bacteria 1996
133 Ga0495664_0012765 3300046477 Bacteria 4759
134 Ga0495585_0038222 3300046492 Bacteria 2701
135 Ga0495594_0014090 3300046499 Bacteria 4186
136 Ga0495594_0038909 3300046499 Bacteria 2598
137 Ga0495594_0090510 3300046499 Bacteria 1714
138 Ga0495594_0448858 3300046499 Bacteria 733
139 Ga0495607_0130195 3300046501 Bacteria 1310
140 Ga0495583_0034312 3300046506 Bacteria 2432
141 Ga0495606_0006416 3300046507 Bacteria 10850
142 Ga0495608_0033468 3300046511 Bacteria 3473
143 Ga0495608_0212733 3300046511 Bacteria 1215
144 Ga0495608_0226873 3300046511 Bacteria 1170
145 Ga0495616_0019684 3300046513 Bacteria 3680
146 Ga0495618_0020238 3300046514 Bacteria 4098
147 Ga0495618_0029481 3300046514 Bacteria 3424
148 Ga0495620_0037222 3300046515 Bacteria 2169
149 Ga0495620_0048576 3300046515 Bacteria 1820
150 Ga0495628_0054756 3300046516 Bacteria 3144
151 Ga0495630_0023929 3300046517 Bacteria 4516
152 Ga0495631_0010965 3300046518 Bacteria 4474
153 Ga0495631_0161139 3300046518 Bacteria 962
154 Ga0495643_0102765 3300046522 Bacteria 1463
155 Ga0495666_0075284 3300046526 Bacteria 1600
156 Ga0495666_0137613 3300046526 Bacteria 1139
157 Ga0495666_0248377 3300046526 Bacteria 811
158 Ga0495652_0022380 3300046529 Bacteria 5607
159 Ga0495652_0065052 3300046529 Bacteria 3065
160 Ga0495654_0019700 3300046530 Bacteria 3527
161 Ga0495665_0387950 3300046531 Bacteria 709
162 Ga0495640_0022272 3300046533 Bacteria 4634
163 Ga0495587_0005704 3300046536 Bacteria 8112
164 Ga0495609_0039604 3300046538 Bacteria 2121
165 Ga0495597_0020283 3300046542 Bacteria 3097
166 Ga0495645_0010041 3300046543 Bacteria 6631
167 Ga0495645_0113026 3300046543 Bacteria 1920
168 Ga0495622_0037562 3300046557 Bacteria 2256
169 Ga0495622_0070786 3300046557 Bacteria 1609
170 Ga0495633_0009508 3300046558 Bacteria 5363
171 Ga0495667_0532274 3300046559 Bacteria 735
172 Ga0495668_0031467 3300046616 Bacteria 2990
173 Ga0495668_0040101 3300046616 Bacteria 2613
174 Ga0495634_0011255 3300046642 Bacteria 6518
175 Ga0495611_0108516 3300046648 Bacteria 1291
176 Ga0495625_0131174 3300046660 Bacteria 1697
177 Ga0495625_0239812 3300046660 Bacteria 1181
178 Ga0495635_0005226 3300046663 Bacteria 9030
179 Ga0495635_0196880 3300046663 Bacteria 1367
180 Ga0495588_0006667 3300046674 Bacteria 5214
181 Ga0495588_0029065 3300046674 Bacteria 2770
182 Ga0495588_0040811 3300046674 Bacteria 2368
183 Ga0495657_0003659 3300046675 Bacteria 12477
184 Ga0495657_0020690 3300046675 Bacteria 4730
185 Ga0495657_0076151 3300046675 Bacteria 2179
186 Ga0495646_0004894 3300046680 Bacteria 8462
187 Ga0495646_0137507 3300046680 Bacteria 1369
188 Ga0495658_0009546 3300046683 Bacteria 4838
189 Ga0495613_0005702 3300046689 Bacteria 9335
190 Ga0495613_0030553 3300046689 Bacteria 4001
191 Ga0495613_0040161 3300046689 Bacteria 3468
192 Ga0495613_0369348 3300046689 Bacteria 982
193 Ga0495624_0057547 3300046690 Bacteria 2444
194 Ga0495624_0199203 3300046690 Bacteria 1217
195 Ga0495670_0487696 3300046691 Bacteria 669
196 Ga0495671_0007169 3300046692 Bacteria 6380
197 Ga0495671_0079870 3300046692 Bacteria 1603
198 Ga0495649_0022805 3300046694 Bacteria 3501
199 Ga0495649_0187763 3300046694 Bacteria 1076
200 Ga0495589_0022665 3300046794 Bacteria 3203
201 Ga0495589_0057897 3300046794 Bacteria 1905
202 Ga0495589_0171475 3300046794 Bacteria 1031
203 Ga0495589_0186500 3300046794 Bacteria 982
204 Ga0495600_0021653 3300046809 Bacteria 4120
205 Ga0495600_0106461 3300046809 Bacteria 1827
206 Ga0495660_0119263 3300046810 Bacteria 1336
207 Ga0495581_0005662 3300047315 Bacteria 7246
208 Ga0495604_0000264 3300047317 Bacteria 46714
209 Ga0495604_0083805 3300047317 Bacteria 2381
210 Ga0495636_0008647 3300047318 Bacteria 4014
211 Ga0495636_0013800 3300047318 Bacteria 3207
212 Ga0495636_0035225 3300047318 Bacteria 2061
213 Ga0495636_0041228 3300047318 Bacteria 1916
214 Ga0495636_0189719 3300047318 Bacteria 935
215 Ga0495674_0074263 3300047319 Bacteria 2929
216 Ga0495676_0010262 3300047321 Bacteria 8499
217 Ga0495676_0015372 3300047321 Bacteria 6815
218 Ga0495676_0104371 3300047321 Bacteria 2091
219 Ga0495680_0005909 3300047322 Bacteria 11444
220 Ga0495683_0071162 3300047323 Bacteria 1707
221 Ga0495687_014211 3300047443 Bacteria 4111
222 Ga0495687_027518 3300047443 Bacteria 2659
223 Ga0495687_037789 3300047443 Bacteria 2148
224 Ga0495687_053872 3300047443 Bacteria 1691
225 Ga0495675_0008712 3300047444 Bacteria 6295
226 Ga0495675_0027312 3300047444 Bacteria 3637
227 Ga0495675_0080669 3300047444 Bacteria 2049
228 Ga0495685_001968 3300047447 Bacteria 6377
229 Ga0495685_020702 3300047447 Bacteria 2261
230 Ga0495685_026733 3300047447 Bacteria 1984
231 Ga0495685_064513 3300047447 Bacteria 1231
232 Ga0495685_081594 3300047447 Bacteria 1076
233 Ga0495681_0007407 3300047470 Bacteria 7018
234 Ga0495681_0039498 3300047470 Bacteria 2304
235 Ga0495681_0117045 3300047470 Bacteria 1148
236 Ga0495684_0249683 3300047471 Bacteria 1291
237 Ga0495686_0109641 3300047472 Bacteria 1657
238 Ga0495686_0154957 3300047472 Bacteria 1342
239 Ga0495593_0004368 3300047673 Bacteria 8410
240 Ga0495593_0010508 3300047673 Bacteria 5342
241 Ga0495602_0013989 3300048088 Bacteria 8169
242 Ga0495614_0002591 3300048089 Bacteria 8039
243 Ga0495614_0008792 3300048089 Bacteria 4484
244 Ga0495614_0049710 3300048089 Bacteria 1797
245 Ga0495614_0125567 3300048089 Bacteria 1133
246 Ga0495626_0017679 3300048091 Bacteria 3595
247 Ga0496100_1284788 3300048903 Bacteria 577
248 Ga0496102_1231673 3300048905 Bacteria 668
249 Ga0496108_0427405 3300048911 Bacteria 1157
250 Ga0496109_0012207 3300048912 Bacteria 7412
251 Ga0496109_0716558 3300048912 Bacteria 938
252 Ga0501033_0078174 3300049570 Bacteria 2428
253 Ga0501034_0065616 3300049571 Bacteria 3643
254 Ga0501034_0192695 3300049571 Bacteria 2000
255 Ga0501034_0290359 3300049571 Bacteria 1573
256 Ga0501036_0014323 3300049572 Bacteria 6600
257 Ga0501037_0168860 3300049573 Bacteria 1556
258 Ga0501038_0015732 3300049574 Bacteria 6875
259 Ga0501038_0141817 3300049574 Bacteria 1965
260 Ga0501043_0021125 3300049579 Bacteria 5103
261 Ga0501047_0007067 3300049581 Bacteria 10541
262 Ga0501047_0026667 3300049581 Bacteria 5561
263 Ga0501070_0281422 3300049586 Bacteria 1357
264 Ga0501073_0438933 3300049589 Bacteria 902
265 Ga0501083_0617794 3300049744 Bacteria 705
266 Ga0501035_0041142 3300049822 Bacteria 4174
267 Ga0501035_0050651 3300049822 Bacteria 3721
268 Ga0501035_0424708 3300049822 Bacteria 1103
269 Ga0501044_0125080 3300049823 Bacteria 2569
270 nmdc:mga03n38_127363_c1 3300050490 Bacteria 1258
271 nmdc:mga0yw44_72315_c1 3300050492 Bacteria 2143
272 nmdc:mga06z11_19181_c1 3300050494 Bacteria 3139
273 nmdc:mga07m45_375107_c1 3300050496 Bacteria 826
274 Ga0500644_0073634 3300053088 Bacteria 1237
275 Ga0500583_0024231 3300053092 Bacteria 2572
276 Ga0500640_002145 3300053095 Bacteria 6399
277 Ga0466962_0000820 3300061719 Bacteria 13990
278 2547411830 2547132111 Bacteria 8013147
279 2585306171 2582581313 Bacteria 10042643
280 2585320702 2582581314 Bacteria 11452267
281 2616696581 2616644814 Bacteria 11555299
282 2643764621 2643221548 Bacteria 8053412
283 2643941832 2643221587 Bacteria 7586415
284 2644261390 2643221647 Bacteria 10741251
285 2644389451 2643221670 Bacteria 6497041
286 2644428915 2643221677 Bacteria 7584031
287 2644439524 2643221678 Bacteria 9540101
288 2644462006 2643221682 Bacteria 6743283
289 2644633110 2643221714 Bacteria 9015452
290 2784589904 2784132148 Bacteria 8627943
291 2785341685 2784746763 Bacteria 9783172
292 2785370980 2784746768 Bacteria 10036182
293 2786672155 2786546132 Bacteria 10419719
294 2808843527 2808606359 Bacteria 9866990
295 2808913098 2808606375 Bacteria 9466072
296 2809233573 2808606448 Bacteria 8656184
297 2811844927 2808606982 Bacteria 7791042
298 2812479253 2811994917 Bacteria 7761064
299 2819695089 2818991463 Bacteria 7948711
300 2852640171 2852635781 Bacteria 8251373
301 2862287196 2862281513 Bacteria 9621493
302 2862384198 2862382967 Bacteria 10317375
303 2862512046 2862507626 Bacteria 9425308
304 2862578004 2862574272 Bacteria 10567477
305 2863411365 2863404153 Bacteria 9672205
306 2877679600 2877676314 Bacteria 9512378
307 2912718252 2912715099 Bacteria 9460473
308 2912730632 2912723979 Bacteria 8557534
309 2918505983 2918501144 Bacteria 8668083
310 2919470410 2919468124 Bacteria 9133025
311 2946069350 2946064051 Bacteria 8957905
312 2946077285 2946072368 Bacteria 8999607
313 2947227563 2947224130 Bacteria 9938529
314 2954004936 2954002825 Bacteria 9173742
315 2954384510 2954380949 Bacteria 10050426
316 2954678431 2954673503 Bacteria 9685905
317 2954685724 2954682443 Bacteria 9862841
318 2954695367 2954691527 Bacteria 10720516
319 2954710558 2954701450 Bacteria 10834262
320 2954714802 2954711539 Bacteria 10867210
321 2954724747 2954721474 Bacteria 10456478
322 2954737071 2954731030 Bacteria 10243860
323 2954743671 2954740390 Bacteria 10229294
324 2954755922 2954749733 Bacteria 10366972
325 2990059783 2990059506 Bacteria 9321252
326 3006498990 3006493962 Bacteria 8825450
327 8008566748 8008558824 Bacteria 10610750
328 8023631725 8023623736 Bacteria 8593882
329 8048412237 8048406513 Bacteria 8936924
330 rootH1_10044226
331 JGI24735J21928_10078633
332 rootH1_10027081
333 rootH1_10037465
334 rootL2_10115812
335 rootH1_10301428
336 Ga0070668_101400755
337 Ga0068867_101166389
338 Ga0068853_100034189
339 Ga0070672_100564727
340 Ga0075365_10135172
341 Ga0075367_10000592
342 Ga0099826_10077957
343 Ga0105250_10040545
344 Ga0105245_10455797
345 Ga0105242_10554073
346 Ga0105248_10138522
347 Ga0105238_10360903
348 Ga0105249_11161205
349 Ga0105246_10014438
350 Ga0182008_10003613
351 Ga0182007_10000822
352 Ga0183367_1002
353 Ga0209758_1018086
354 Ga0207426_1047938
355 Ga0207647_10007709
356 Ga0207686_10198569
357 Ga0207691_10249547
358 Ga0207711_10767891
359 Ga0207668_11168401
360 Ga0207639_10012770
361 Ga0209371_1005545
362 Ga0307515_10000497
363 Ga0307515_10092530
364 Ga0268256_1012877
365 Ga0307511_10000238
366 Ga0307511_10012823
367 Ga0307512_10005779
368 Ga0307512_10010667
369 Ga0307513_10010529
370 Ga0307513_10084668
371 Ga0307509_10011503
372 Ga0307509_10048064
373 Ga0307508_10004630
374 Ga0307508_10009865
375 Ga0307514_10014652
376 Ga0307514_10078297
377 Ga0307514_10089940
378 Ga0307516_10003058
379 Ga0307516_10091801
380 Ga0307516_10413075
381 Ga0307518_10066362
382 Ga0307518_10217123
383 Ga0307410_10765684
384 Ga0307507_10036682
385 Ga0307507_10319436
386 Ga0307510_10026931
387 Ga0307510_10041691
388 Ga0307510_10161476
389 Ga0307510_10324782
390 Ga0395901_0472586
391 Ga0436365_0479943
392 Ga0439436_0005704
393 Ga0439439_0012518
394 Ga0451853_0121869
395 Ga0451853_2365576
396 Ga0439433_0001037
397 Ga0439448_0021828
398 Ga0439449_0002149
399 Ga0439449_0008310
400 Ga0439449_0034595
401 Ga0439455_0001256
402 Ga0439457_004910
403 Ga0439457_005657
404 Ga0450920_064240
405 Ga0450894_000249
406 Ga0450899_000564
407 Ga0450903_000168
408 Ga0450906_001013
409 Ga0439458_0003846
410 Ga0466969_0101820
411 Ga0466972_0003635
412 Ga0466972_0026503
413 Ga0466972_0058488
414 Ga0466965_0005212
415 Ga0466965_0153952
416 Ga0466966_0000253
417 Ga0466966_0004617
418 Ga0466966_0050302
419 Ga0466961_0001187
420 Ga0466961_0015138
421 Ga0466961_0226069
422 Ga0466963_0000226
423 Ga0466964_0010850
424 Ga0466971_0001611
425 Ga0466968_0010482
426 Ga0466970_0003063
427 Ga0466970_0007932
428 Ga0466970_0475645
429 Ga0466957_0028783
430 Ga0466960_0007060
431 Ga0466959_0003039
432 Ga0466959_0042782
433 Ga0466959_0630372
434 Ga0466958_0003109
435 Ga0466967_0030674
436 Ga0466967_0079980
437 Ga0495592_0010626
438 Ga0495592_0062512
439 Ga0495603_0003400
440 Ga0495603_0030575
441 Ga0495603_0068212
442 Ga0495590_0069932
443 Ga0495590_0187761
444 Ga0495629_0009394
445 Ga0495629_0010131
446 Ga0495629_0028951
447 Ga0495629_0029311
448 Ga0495629_0077405
449 Ga0495629_0223601
450 Ga0495638_0032566
451 Ga0495638_0087291
452 Ga0495638_0115575
453 Ga0495651_0001724
454 Ga0495582_0015397
455 Ga0495582_0496703
456 Ga0495605_0002633
457 Ga0495605_0046170
458 Ga0495639_0225944
459 Ga0495662_0002264
460 Ga0495662_0014482
461 Ga0495662_0051061
462 Ga0495664_0012765
463 Ga0495585_0038222
464 Ga0495594_0014090
465 Ga0495594_0038909
466 Ga0495594_0090510
467 Ga0495594_0448858
468 Ga0495607_0130195
469 Ga0495583_0034312
470 Ga0495606_0006416
471 Ga0495608_0033468
472 Ga0495608_0212733
473 Ga0495608_0226873
474 Ga0495616_0019684
475 Ga0495618_0020238
476 Ga0495618_0029481
477 Ga0495620_0037222
478 Ga0495620_0048576
479 Ga0495628_0054756
480 Ga0495630_0023929
481 Ga0495631_0010965
482 Ga0495631_0161139
483 Ga0495643_0102765
484 Ga0495666_0075284
485 Ga0495666_0137613
486 Ga0495666_0248377
487 Ga0495652_0022380
488 Ga0495652_0065052
489 Ga0495654_0019700
490 Ga0495665_0387950
491 Ga0495640_0022272
492 Ga0495587_0005704
493 Ga0495609_0039604
494 Ga0495597_0020283
495 Ga0495645_0010041
496 Ga0495645_0113026
497 Ga0495622_0037562
498 Ga0495622_0070786
499 Ga0495633_0009508
500 Ga0495667_0532274
501 Ga0495668_0031467
502 Ga0495668_0040101
503 Ga0495634_0011255
504 Ga0495611_0108516
505 Ga0495625_0131174
506 Ga0495625_0239812
507 Ga0495635_0005226
508 Ga0495635_0196880
509 Ga0495588_0006667
510 Ga0495588_0029065
511 Ga0495588_0040811
512 Ga0495657_0003659
513 Ga0495657_0020690
514 Ga0495657_0076151
515 Ga0495646_0004894
516 Ga0495646_0137507
517 Ga0495658_0009546
518 Ga0495613_0005702
519 Ga0495613_0030553
520 Ga0495613_0040161
521 Ga0495613_0369348
522 Ga0495624_0057547
523 Ga0495624_0199203
524 Ga0495670_0487696
525 Ga0495671_0007169
526 Ga0495671_0079870
527 Ga0495649_0022805
528 Ga0495649_0187763
529 Ga0495589_0022665
530 Ga0495589_0057897
531 Ga0495589_0171475
532 Ga0495589_0186500
533 Ga0495600_0021653
534 Ga0495600_0106461
535 Ga0495660_0119263
536 Ga0495581_0005662
537 Ga0495604_0000264
538 Ga0495604_0083805
539 Ga0495636_0008647
540 Ga0495636_0013800
541 Ga0495636_0035225
542 Ga0495636_0041228
543 Ga0495636_0189719
544 Ga0495674_0074263
545 Ga0495676_0010262
546 Ga0495676_0015372
547 Ga0495676_0104371
548 Ga0495680_0005909
549 Ga0495683_0071162
550 Ga0495687_014211
551 Ga0495687_027518
552 Ga0495687_037789
553 Ga0495687_053872
554 Ga0495675_0008712
555 Ga0495675_0027312
556 Ga0495675_0080669
557 Ga0495685_001968
558 Ga0495685_020702
559 Ga0495685_026733
560 Ga0495685_064513
561 Ga0495685_081594
562 Ga0495681_0007407
563 Ga0495681_0039498
564 Ga0495681_0117045
565 Ga0495684_0249683
566 Ga0495686_0109641
567 Ga0495686_0154957
568 Ga0495593_0004368
569 Ga0495593_0010508
570 Ga0495602_0013989
571 Ga0495614_0002591
572 Ga0495614_0008792
573 Ga0495614_0049710
574 Ga0495614_0125567
575 Ga0495626_0017679
576 Ga0496100_1284788
577 Ga0496102_1231673
578 Ga0496108_0427405
579 Ga0496109_0012207
580 Ga0496109_0716558
581 Ga0501033_0078174
582 Ga0501034_0065616
583 Ga0501034_0192695
584 Ga0501034_0290359
585 Ga0501036_0014323
586 Ga0501037_0168860
587 Ga0501038_0015732
588 Ga0501038_0141817
589 Ga0501043_0021125
590 Ga0501047_0007067
591 Ga0501047_0026667
592 Ga0501070_0281422
593 Ga0501073_0438933
594 Ga0501083_0617794
595 Ga0501035_0041142
596 Ga0501035_0050651
597 Ga0501035_0424708
598 Ga0501044_0125080
599 nmdc:mga03n38_127363_c1
600 nmdc:mga0yw44_72315_c1
601 nmdc:mga06z11_19181_c1
602 nmdc:mga07m45_375107_c1
603 Ga0500644_0073634
604 Ga0500583_0024231
605 Ga0500640_002145
606 Ga0466962_0000820
607 2547411830
608 2585306171
609 2585320702
610 2616696581
611 2643764621
612 2643941832
613 2644261390
614 2644389451
615 2644428915
616 2644439524
617 2644462006
618 2644633110
619 2784589904
620 2785341685
621 2785370980
622 2786672155
623 2808843527
624 2808913098
625 2809233573
626 2811844927
627 2812479253
628 2819695089
629 2852640171
630 2862287196
631 2862384198
632 2862512046
633 2862578004
634 2863411365
635 2877679600
636 2912718252
637 2912730632
638 2918505983
639 2919470410
640 2946069350
641 2946077285
642 2947227563
643 2954004936
644 2954384510
645 2954678431
646 2954685724
647 2954695367
648 2954710558
649 2954714802
650 2954724747
651 2954737071
652 2954743671
653 2954755922
654 2990059783
655 3006498990
656 8008566748
657 8023631725
658 8048412237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q9r-assembly1.cif.gz_A-2 crystal structure of a duf416 family protein (sbal_3149) from shewanella baltica os155 at 1.91 a resolution 0.5419 5 169
2q9r-assembly1.cif.gz_A-2 crystal structure of a duf416 family protein (sbal_3149) from shewanella baltica os155 at 1.91 a resolution 0.4934 5 169
4xtk-assembly3.cif.gz_F structure of tm1797, a cas1 protein from thermotoga maritima 0.3333 3 154
5jk0-assembly1.cif.gz_C crystal structure of xerh site-specific recombinase bound to difh substrate: pre-cleavage complex 0.3091 12 158
1i5n-assembly1.cif.gz_A crystal structure of the p1 domain of chea from salmonella typhimurium 0.3072 19 148
ID Description Score Start End Superfamily
2q9rA01 Mainly Alpha;Up-down Bundle;YP_001051499.1 fold like;YP_001051499.1 domain like 0.5063 5 169 1.20.1590.10
2q9rA01 Mainly Alpha;Up-down Bundle;YP_001051499.1 fold like;YP_001051499.1 domain like 0.4636 5 169 1.20.1590.10
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.417 18 177 1.20.120.660
1orjC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.4011 3 177 1.20.120.340
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.3945 18 177 1.20.120.660
ID Description Score Start End GO Terms
AF-A0A4Y3VM14-F1-model_v4 Uncharacterized protein 0.976 1 185
AF-A0A4Y3VM14-F1-model_v4 Uncharacterized protein 0.9708 1 185
AF-A0A8B0DVK9-F1-model_v4 deleted 0.9358 1 183
AF-A0A1G9EJA0-F1-model_v4 Uncharacterized protein 0.9356 1 183
AF-A0A372MCK6-F1-model_v4 Uncharacterized protein 0.9293 1 183

Map