F409469

General Info

Members Datasets Scaffolds Average Seq Length
328 238 656 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857933|2774905226
Length 317
Sequence VQTPARASARQRPQAATVFPYDSGDLRRFRELQQLAYACAERVGAWLEPGVTERQASARLGRELAAAGVQDFFHVPFAWFGDRTAFRHFHTPLQFFPSRRRLEEGMPYILDCAPVIDGYTADIGYAGRVAASPVWDRIDRDLREYRDLIVVEARRRTPFNEIYARVDALIARHGYDNRHRVYPXRVIGHQVTRTIARGPAGVSVLGFGIRTLQTLGREFLGERRYGRSPLWADXRASRHAPTPGLWAVEPHVAFRDVGLKFEELLVVTDDDAYWLDDDLPHVRRWQRAADTSSGTSSGIATDTAVADIATDVAVEAR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
68 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
69 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
75 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
76 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
79 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
82 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2773857933 Frankia sp. BMG5.30 Isolate Nodule
170 2506783011 Frankia datiscae Dg1 Isolate Nodule
171 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
172 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
173 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
174 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
175 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
176 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
177 2643221576 Nocardioides sp. Root614 Isolate Unclassified
178 2643221578 Streptomyces sp. Root63 Isolate Unclassified
179 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
180 2643221590 Nocardioides sp. Root682 Isolate Unclassified
181 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
182 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
183 2643221647 Streptomyces sp. Root369 Isolate Unclassified
184 2643221670 Streptomyces sp. Root431 Isolate Unclassified
185 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
186 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
187 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
188 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
189 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
190 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
191 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
192 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
193 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
194 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
195 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
196 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
197 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
198 2862574272 Streptomyces sp. AcE210 Isolate Nodule
199 2867428634 Streptomyces sp. RP5T Isolate Unclassified
200 2867475112 Streptomyces sp. TM32 Isolate Unclassified
201 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
202 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
203 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
204 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
205 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
206 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
207 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
208 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
209 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
210 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
211 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
212 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
213 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
214 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
218 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
219 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
220 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
221 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
222 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
223 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
224 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
225 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
226 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
227 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
228 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
229 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
230 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
231 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
232 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
233 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
234 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
235 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
236 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
237 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
238 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.35
Metatranscriptomes 0.3
Isolates 21.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 1.22
Rhizoplane 0.91
Rhizosphere 74.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013904 3300001979 Bacteria 2986
2 JGI24738J21930_10001951 3300002075 Bacteria 5560
3 rootH1_10051189 3300003316 Bacteria 2335
4 rootH2_10082578 3300003320 Bacteria 3623
5 rootL2_10041425 3300003322 Bacteria 2495
6 rootH1_10011733 3300003323 Bacteria 3538
7 rootH1_10056450 3300003323 Bacteria 1295
8 rootH1_10100970 3300003323 Bacteria 2884
9 JGI25160J50197_1004987 3300003354 Bacteria 5628
10 JGI25160J50197_1016998 3300003354 Bacteria 2322
11 Ga0006562J51391_1084183 3300003578 Bacteria 1907
12 Ga0070714_100412025 3300005435 Bacteria 1279
13 Ga0070681_10468447 3300005458 Bacteria 1172
14 Ga0070706_100150220 3300005467 Bacteria 2175
15 Ga0068855_100040152 3300005563 Bacteria 5555
16 Ga0068854_100001252 3300005578 Bacteria 15254
17 Ga0068856_100448070 3300005614 Bacteria 1311
18 Ga0081539_10039934 3300005985 Bacteria 2762
19 Ga0075365_10044879 3300006038 Bacteria 2898
20 Ga0075363_100010183 3300006048 Bacteria 4448
21 Ga0075363_100034509 3300006048 Bacteria 2641
22 Ga0075363_100305191 3300006048 Bacteria 924
23 Ga0075367_10062306 3300006178 Bacteria 2227
24 Ga0075430_100009861 3300006846 Bacteria 8078
25 Ga0075431_100004523 3300006847 Bacteria 13656
26 Ga0075429_100004970 3300006880 Bacteria 11456
27 Ga0099826_10017986 3300006948 Bacteria 5339
28 Ga0105240_10103795 3300009093 Bacteria 3453
29 Ga0111539_10410773 3300009094 Bacteria 1577
30 Ga0105241_10001050 3300009174 Bacteria 21063
31 Ga0105237_10119478 3300009545 Bacteria 2630
32 Ga0105238_10028713 3300009551 Bacteria 5666
33 Ga0105246_10000694 3300011119 Bacteria 18971
34 Ga0157372_10196758 3300013307 Bacteria 2335
35 Ga0182008_10002887 3300014497 Bacteria 10637
36 Ga0157376_10674253 3300014969 Bacteria 1037
37 Ga0182006_1029431 3300015261 Bacteria 2225
38 Ga0182007_10004832 3300015262 Bacteria 6032
39 Ga0183367_1008 3300015688 Bacteria 490626
40 Ga0213875_10002612 3300021388 Bacteria 10692
41 Ga0207426_1000755 3300025302 Bacteria 36197
42 Ga0207426_1001873 3300025302 Bacteria 15425
43 Ga0207426_1008012 3300025302 Bacteria 4337
44 Ga0207647_10004051 3300025904 Bacteria 10919
45 Ga0207647_10016260 3300025904 Bacteria 5079
46 Ga0207685_10025588 3300025905 Bacteria 2039
47 Ga0207684_10279709 3300025910 Bacteria 1439
48 Ga0207654_10001848 3300025911 Bacteria 10949
49 Ga0207671_10000216 3300025914 Bacteria 86159
50 Ga0207694_10004222 3300025924 Bacteria 11245
51 Ga0207667_10243495 3300025949 Bacteria 1840
52 Ga0207678_10029024 3300026067 Bacteria 4828
53 Ga0207702_10414961 3300026078 Bacteria 1301
54 Ga0307515_10002535 3300028794 Bacteria 39481
55 Ga0307511_10045446 3300030521 Bacteria 3628
56 Ga0307512_10002787 3300030522 Bacteria 21303
57 Ga0307512_10047798 3300030522 Bacteria 3472
58 Ga0307513_10022968 3300031456 Bacteria 7306
59 Ga0307513_10064045 3300031456 Bacteria 3876
60 Ga0307509_10022096 3300031507 Bacteria 7181
61 Ga0307509_10086201 3300031507 Bacteria 3229
62 Ga0307508_10004181 3300031616 Bacteria 14199
63 Ga0307514_10112802 3300031649 Bacteria 1920
64 Ga0307516_10037018 3300031730 Bacteria 4879
65 Ga0307518_10203612 3300031838 Bacteria 1311
66 Ga0307507_10027569 3300033179 Bacteria 6084
67 Ga0307510_10004078 3300033180 Bacteria 17133
68 Ga0307510_10130030 3300033180 Bacteria 2194
69 Ga0373955_0144493 3300035172 Bacteria 1397
70 Ga0395900_0062736 3300037418 Bacteria 3820
71 Ga0395898_0002856 3300037466 Bacteria 19744
72 Ga0395898_0445063 3300037466 Bacteria 1234
73 Ga0436364_0499509 3300037853 Bacteria 94496
74 Ga0395901_0022394 3300038443 Bacteria 6475
75 Ga0436365_0048890 3300039437 Bacteria 6908
76 Ga0436362_0124229 3300039453 Bacteria 987
77 Ga0439436_0013108 3300041404 Bacteria 2509
78 Ga0439438_012922 3300041405 Bacteria 2539
79 Ga0439439_0008095 3300041406 Bacteria 2472
80 Ga0439447_001216 3300041407 Bacteria 9393
81 Ga0439466_0006565 3300041411 Bacteria 4418
82 Ga0451789_1128400 3300041443 Bacteria 1242
83 Ga0451802_1091449 3300041460 Bacteria 3192
84 Ga0451853_0324200 3300041512 Bacteria 7412
85 Ga0439433_0023994 3300041999 Bacteria 1373
86 Ga0439448_0006927 3300042005 Bacteria 3270
87 Ga0439432_026817 3300042006 Bacteria 1885
88 Ga0439450_028209 3300042008 Bacteria 1248
89 Ga0439455_0003862 3300042012 Bacteria 2912
90 Ga0439457_000147 3300042014 Bacteria 18100
91 Ga0439457_062556 3300042014 Bacteria 844
92 Ga0450894_000157 3300042131 Bacteria 11985
93 Ga0450896_000113 3300042133 Bacteria 5882
94 Ga0450898_014279 3300042134 Bacteria 1333
95 Ga0450899_000607 3300042135 Bacteria 4074
96 Ga0450903_000572 3300042138 Bacteria 7559
97 Ga0450906_000587 3300042145 Bacteria 7729
98 Ga0439446_0061212 3300042156 Bacteria 1138
99 Ga0450908_006966 3300042184 Bacteria 2141
100 Ga0439434_0016947 3300042435 Bacteria 2178
101 Ga0466969_0017135 3300044656 Bacteria 3786
102 Ga0466972_0008615 3300044658 Bacteria 5116
103 Ga0466965_0025424 3300044683 Bacteria 2866
104 Ga0466965_0114405 3300044683 Bacteria 1389
105 Ga0466966_0001648 3300044684 Bacteria 14399
106 Ga0466966_0006360 3300044684 Bacteria 7812
107 Ga0466966_0028136 3300044684 Bacteria 3662
108 Ga0466966_0178243 3300044684 Bacteria 1290
109 Ga0466961_0039908 3300044693 Bacteria 3009
110 Ga0466961_0100876 3300044693 Bacteria 1818
111 Ga0466963_0008214 3300044694 Bacteria 6256
112 Ga0466963_0160049 3300044694 Bacteria 1567
113 Ga0466971_0014671 3300044719 Bacteria 3449
114 Ga0466971_0037393 3300044719 Bacteria 2175
115 Ga0466968_0011612 3300044735 Bacteria 3434
116 Ga0466970_0004881 3300044765 Bacteria 6623
117 Ga0466970_0014462 3300044765 Bacteria 4051
118 Ga0466960_0002082 3300044901 Bacteria 7444
119 Ga0466960_0147888 3300044901 Bacteria 1253
120 Ga0466959_0017753 3300045049 Bacteria 5218
121 Ga0466959_0097901 3300045049 Bacteria 2101
122 Ga0466959_0232632 3300045049 Bacteria 1275
123 Ga0466959_0295351 3300045049 Bacteria 1110
124 Ga0466958_0091861 3300045836 Bacteria 1879
125 Ga0466958_0229641 3300045836 Bacteria 1185
126 Ga0466967_0000353 3300045976 Bacteria 21250
127 Ga0466967_0030278 3300045976 Bacteria 4540
128 Ga0466967_0111567 3300045976 Bacteria 2513
129 Ga0466967_0151122 3300045976 Bacteria 2170
130 Ga0466967_0205489 3300045976 Bacteria 1866
131 Ga0495592_0010791 3300046454 Bacteria 6889
132 Ga0495592_0018085 3300046454 Bacteria 5354
133 Ga0495592_0019950 3300046454 Bacteria 5097
134 Ga0495603_0005744 3300046455 Bacteria 7422
135 Ga0495629_0001684 3300046459 Bacteria 17360
136 Ga0495629_0007807 3300046459 Bacteria 7876
137 Ga0495629_0022032 3300046459 Bacteria 4543
138 Ga0495629_0200310 3300046459 Bacteria 1380
139 Ga0495638_0091232 3300046460 Bacteria 1835
140 Ga0495638_0127395 3300046460 Bacteria 1499
141 Ga0495651_0001052 3300046462 Bacteria 21348
142 Ga0495651_0003837 3300046462 Bacteria 11489
143 Ga0495653_0025016 3300046463 Bacteria 4803
144 Ga0495653_0056490 3300046463 Bacteria 2992
145 Ga0495582_0053162 3300046473 Bacteria 2234
146 Ga0495605_0061175 3300046474 Bacteria 1803
147 Ga0495662_0003289 3300046476 Bacteria 8178
148 Ga0495662_0018561 3300046476 Bacteria 3366
149 Ga0495664_0000206 3300046477 Bacteria 28424
150 Ga0495664_0098836 3300046477 Bacteria 1757
151 Ga0495585_0035041 3300046492 Bacteria 2839
152 Ga0495585_0092820 3300046492 Bacteria 1624
153 Ga0495594_0000748 3300046499 Bacteria 16646
154 Ga0495594_0047344 3300046499 Bacteria 2361
155 Ga0495608_0000535 3300046511 Bacteria 26081
156 Ga0495618_0055076 3300046514 Bacteria 2518
157 Ga0495628_0002305 3300046516 Bacteria 17252
158 Ga0495628_0005866 3300046516 Bacteria 10755
159 Ga0495628_0112360 3300046516 Bacteria 2094
160 Ga0495630_0002519 3300046517 Bacteria 12702
161 Ga0495630_0025575 3300046517 Bacteria 4366
162 Ga0495643_0135579 3300046522 Bacteria 1232
163 Ga0495652_0001517 3300046529 Bacteria 25481
164 Ga0495652_0050777 3300046529 Bacteria 3544
165 Ga0495665_0001506 3300046531 Bacteria 12484
166 Ga0495640_0146900 3300046533 Bacteria 1516
167 Ga0495645_0009853 3300046543 Bacteria 6686
168 Ga0495645_0144939 3300046543 Bacteria 1654
169 Ga0495622_0006986 3300046557 Bacteria 5240
170 Ga0495622_0041075 3300046557 Bacteria 2151
171 Ga0495622_0078524 3300046557 Bacteria 1520
172 Ga0495622_0141640 3300046557 Bacteria 1091
173 Ga0495667_0006704 3300046559 Bacteria 7814
174 Ga0495634_0006416 3300046642 Bacteria 8937
175 Ga0495611_0099304 3300046648 Bacteria 1351
176 Ga0495611_0140306 3300046648 Bacteria 1128
177 Ga0495625_0027611 3300046660 Bacteria 4268
178 Ga0495588_0004993 3300046674 Bacteria 5891
179 Ga0495588_0026688 3300046674 Bacteria 2885
180 Ga0495588_0153101 3300046674 Bacteria 1218
181 Ga0495588_0185187 3300046674 Bacteria 1100
182 Ga0495657_0001293 3300046675 Bacteria 21757
183 Ga0495657_0003337 3300046675 Bacteria 13144
184 Ga0495657_0015409 3300046675 Bacteria 5594
185 Ga0495623_0010161 3300046679 Bacteria 6090
186 Ga0495623_0016207 3300046679 Bacteria 4813
187 Ga0495646_0001489 3300046680 Bacteria 13936
188 Ga0495658_0258725 3300046683 Bacteria 1095
189 Ga0495613_0000629 3300046689 Bacteria 28044
190 Ga0495613_0004608 3300046689 Bacteria 10347
191 Ga0495613_0005092 3300046689 Bacteria 9850
192 Ga0495613_0034694 3300046689 Bacteria 3746
193 Ga0495613_0174849 3300046689 Bacteria 1522
194 Ga0495649_0053947 3300046694 Bacteria 2175
195 Ga0495589_0008715 3300046794 Bacteria 5282
196 Ga0495589_0038341 3300046794 Bacteria 2399
197 Ga0495589_0079234 3300046794 Bacteria 1598
198 Ga0495600_0002349 3300046809 Bacteria 10803
199 Ga0495600_0012927 3300046809 Bacteria 5231
200 Ga0495600_0016610 3300046809 Bacteria 4675
201 Ga0495581_0013758 3300047315 Bacteria 4692
202 Ga0495581_0014221 3300047315 Bacteria 4614
203 Ga0495581_0070200 3300047315 Bacteria 2026
204 Ga0495581_0086619 3300047315 Bacteria 1816
205 Ga0495604_0000216 3300047317 Bacteria 52795
206 Ga0495604_0000676 3300047317 Bacteria 28890
207 Ga0495604_0006672 3300047317 Bacteria 9148
208 Ga0495604_0021277 3300047317 Bacteria 5178
209 Ga0495604_0306837 3300047317 Bacteria 1064
210 Ga0495636_0002761 3300047318 Bacteria 6771
211 Ga0495636_0003835 3300047318 Bacteria 5862
212 Ga0495636_0021096 3300047318 Bacteria 2628
213 Ga0495674_0043738 3300047319 Bacteria 3984
214 Ga0495676_0001354 3300047321 Bacteria 21050
215 Ga0495676_0021365 3300047321 Bacteria 5655
216 Ga0495683_0021645 3300047323 Bacteria 3313
217 Ga0495687_001793 3300047443 Bacteria 18950
218 Ga0495687_001814 3300047443 Bacteria 18789
219 Ga0495675_0011660 3300047444 Bacteria 5519
220 Ga0495675_0027165 3300047444 Bacteria 3647
221 Ga0495675_0030565 3300047444 Bacteria 3436
222 Ga0495675_0118252 3300047444 Bacteria 1651
223 Ga0495685_021252 3300047447 Bacteria 2233
224 Ga0495685_045486 3300047447 Bacteria 1495
225 Ga0495685_058195 3300047447 Bacteria 1304
226 Ga0495685_060551 3300047447 Bacteria 1276
227 Ga0495684_0001530 3300047471 Bacteria 18530
228 Ga0495686_0027995 3300047472 Bacteria 3674
229 Ga0495593_0004513 3300047673 Bacteria 8267
230 Ga0495593_0008867 3300047673 Bacteria 5835
231 Ga0495593_0087795 3300047673 Bacteria 1603
232 Ga0495602_0007604 3300048088 Bacteria 11331
233 Ga0495614_0000151 3300048089 Bacteria 25354
234 Ga0495614_0131312 3300048089 Bacteria 1108
235 Ga0496118_0176925 3300048921 Bacteria 1295
236 Ga0496124_0227737 3300048927 Bacteria 1396
237 Ga0501047_0162323 3300049581 Bacteria 2106
238 Ga0501071_0165783 3300049587 Bacteria 1653
239 Ga0501035_0125980 3300049822 Bacteria 2236
240 nmdc:mga0yw44_77678_c1 3300050492 Bacteria 2074
241 nmdc:mga0qj67_5447_c1 3300050509 Bacteria 9299
242 nmdc:mga06r32_5513_c1 3300050510 Bacteria 11400
243 nmdc:mga08y16_147294_c1 3300050511 Bacteria 2447
244 Ga0495601_0002055 3300053077 Bacteria 11280
245 Ga0495601_0002983 3300053077 Bacteria 9637
246 Ga0495612_0030029 3300053078 Bacteria 2190
247 Ga0495619_0021214 3300053085 Bacteria 4145
248 Ga0500644_0012740 3300053088 Bacteria 2333
249 Ga0500647_0047470 3300053091 Bacteria 2064
250 Ga0500650_0040256 3300053098 Bacteria 2156
251 Ga0500560_001768 3300053107 Bacteria 3889
252 Ga0500608_125020 3300053122 Bacteria 1161
253 Ga0500652_094634 3300053131 Bacteria 1248
254 Ga0500573_0061702 3300053140 Bacteria 2147
255 Ga0500573_0128583 3300053140 Bacteria 1405
256 Ga0466962_0006506 3300061719 Bacteria 5608
257 Ga0466962_0018313 3300061719 Bacteria 3369
258 Ga0466962_0023930 3300061719 Bacteria 2935
259 2774905226 2773857933 Bacteria 5818019
260 2506866462 2506783011 Bacteria 5323186
261 2554813991 2554235132 Bacteria 6772433
262 2585298515 2582581312 Bacteria 7308206
263 2585310826 2582581313 Bacteria 10042643
264 2585314512 2582581314 Bacteria 11452267
265 2608384712 2606217733 Bacteria 6360972
266 2616904867 2616644941 Bacteria 8510691
267 2643893409 2643221576 Bacteria 5214352
268 2643900119 2643221578 Bacteria 9213798
269 2643947866 2643221587 Bacteria 7586415
270 2643962459 2643221590 Bacteria 5214697
271 2644019590 2643221601 Bacteria 7493239
272 2644180523 2643221631 Bacteria 8168043
273 2644262914 2643221647 Bacteria 10741251
274 2644390696 2643221670 Bacteria 6497041
275 2644405657 2643221673 Bacteria 9196637
276 2644433731 2643221677 Bacteria 7584031
277 2784588994 2784132148 Bacteria 8627943
278 2785342856 2784746763 Bacteria 9783172
279 2785369946 2784746768 Bacteria 10036182
280 2786671018 2786546132 Bacteria 10419719
281 2808842436 2808606359 Bacteria 9866990
282 2808920952 2808606375 Bacteria 9466072
283 2811845781 2808606982 Bacteria 7791042
284 2819739219 2818991472 Bacteria 10089953
285 2862178985 2862178590 Bacteria 8583590
286 2862286043 2862281513 Bacteria 9621493
287 2862290858 2862290372 Bacteria 7471434
288 2862578872 2862574272 Bacteria 10567477
289 2867434831 2867428634 Bacteria 9590268
290 2867480928 2867475112 Bacteria 6909112
291 2873155358 2873151551 Bacteria 8625867
292 2875395210 2875391855 Bacteria 7600475
293 2877680683 2877676314 Bacteria 9512378
294 2912719399 2912715099 Bacteria 9460473
295 2912731394 2912723979 Bacteria 8557534
296 2912761269 2912757875 Bacteria 7940295
297 2918505184 2918501144 Bacteria 8668083
298 2919471899 2919468124 Bacteria 9133025
299 2932401388 2932398195 Bacteria 3847976
300 2935390836 2935390628 Bacteria 7043367
301 2946049514 2946045630 Bacteria 8527308
302 2954385810 2954380949 Bacteria 10050426
303 2954677345 2954673503 Bacteria 9685905
304 2954686807 2954682443 Bacteria 9862841
305 2954696456 2954691527 Bacteria 10720516
306 2954705822 2954701450 Bacteria 10834262
307 2954715812 2954711539 Bacteria 10867210
308 2954725749 2954721474 Bacteria 10456478
309 2954736051 2954731030 Bacteria 10243860
310 2954744706 2954740390 Bacteria 10229294
311 2954754911 2954749733 Bacteria 10366972
312 2954763670 2954759201 Bacteria 9358192
313 2990067676 2990059506 Bacteria 9321252
314 2995468135 2995463766 Bacteria 8577691
315 2997459086 2997451912 Bacteria 8492419
316 2997608503 2997600082 Bacteria 9896405
317 3003009339 3002998708 Bacteria 11715108
318 3006490219 3006486233 Bacteria 8157040
319 3006499374 3006493962 Bacteria 8825450
320 8011356354 8011350971 Bacteria 6158957
321 8023630481 8023623736 Bacteria 8593882
322 8025482585 8025478263 Bacteria 8209203
323 8025534399 8025530807 Bacteria 8495698
324 8033690523 8033684223 Bacteria 6906479
325 8048411494 8048406513 Bacteria 8936924
326 8056449909 8056447290 Bacteria 7680491
327 8056667415 8056667051 Bacteria 6953971
328 8056833296 8056829672 Bacteria 9045328
329 JGI24740J21852_10013904
330 JGI24738J21930_10001951
331 rootH1_10051189
332 rootH2_10082578
333 rootL2_10041425
334 rootH1_10011733
335 rootH1_10056450
336 rootH1_10100970
337 JGI25160J50197_1004987
338 JGI25160J50197_1016998
339 Ga0006562J51391_1084183
340 Ga0070714_100412025
341 Ga0070681_10468447
342 Ga0070706_100150220
343 Ga0068855_100040152
344 Ga0068854_100001252
345 Ga0068856_100448070
346 Ga0081539_10039934
347 Ga0075365_10044879
348 Ga0075363_100010183
349 Ga0075363_100034509
350 Ga0075363_100305191
351 Ga0075367_10062306
352 Ga0075430_100009861
353 Ga0075431_100004523
354 Ga0075429_100004970
355 Ga0099826_10017986
356 Ga0105240_10103795
357 Ga0111539_10410773
358 Ga0105241_10001050
359 Ga0105237_10119478
360 Ga0105238_10028713
361 Ga0105246_10000694
362 Ga0157372_10196758
363 Ga0182008_10002887
364 Ga0157376_10674253
365 Ga0182006_1029431
366 Ga0182007_10004832
367 Ga0183367_1008
368 Ga0213875_10002612
369 Ga0207426_1000755
370 Ga0207426_1001873
371 Ga0207426_1008012
372 Ga0207647_10004051
373 Ga0207647_10016260
374 Ga0207685_10025588
375 Ga0207684_10279709
376 Ga0207654_10001848
377 Ga0207671_10000216
378 Ga0207694_10004222
379 Ga0207667_10243495
380 Ga0207678_10029024
381 Ga0207702_10414961
382 Ga0307515_10002535
383 Ga0307511_10045446
384 Ga0307512_10002787
385 Ga0307512_10047798
386 Ga0307513_10022968
387 Ga0307513_10064045
388 Ga0307509_10022096
389 Ga0307509_10086201
390 Ga0307508_10004181
391 Ga0307514_10112802
392 Ga0307516_10037018
393 Ga0307518_10203612
394 Ga0307507_10027569
395 Ga0307510_10004078
396 Ga0307510_10130030
397 Ga0373955_0144493
398 Ga0395900_0062736
399 Ga0395898_0002856
400 Ga0395898_0445063
401 Ga0436364_0499509
402 Ga0395901_0022394
403 Ga0436365_0048890
404 Ga0436362_0124229
405 Ga0439436_0013108
406 Ga0439438_012922
407 Ga0439439_0008095
408 Ga0439447_001216
409 Ga0439466_0006565
410 Ga0451789_1128400
411 Ga0451802_1091449
412 Ga0451853_0324200
413 Ga0439433_0023994
414 Ga0439448_0006927
415 Ga0439432_026817
416 Ga0439450_028209
417 Ga0439455_0003862
418 Ga0439457_000147
419 Ga0439457_062556
420 Ga0450894_000157
421 Ga0450896_000113
422 Ga0450898_014279
423 Ga0450899_000607
424 Ga0450903_000572
425 Ga0450906_000587
426 Ga0439446_0061212
427 Ga0450908_006966
428 Ga0439434_0016947
429 Ga0466969_0017135
430 Ga0466972_0008615
431 Ga0466965_0025424
432 Ga0466965_0114405
433 Ga0466966_0001648
434 Ga0466966_0006360
435 Ga0466966_0028136
436 Ga0466966_0178243
437 Ga0466961_0039908
438 Ga0466961_0100876
439 Ga0466963_0008214
440 Ga0466963_0160049
441 Ga0466971_0014671
442 Ga0466971_0037393
443 Ga0466968_0011612
444 Ga0466970_0004881
445 Ga0466970_0014462
446 Ga0466960_0002082
447 Ga0466960_0147888
448 Ga0466959_0017753
449 Ga0466959_0097901
450 Ga0466959_0232632
451 Ga0466959_0295351
452 Ga0466958_0091861
453 Ga0466958_0229641
454 Ga0466967_0000353
455 Ga0466967_0030278
456 Ga0466967_0111567
457 Ga0466967_0151122
458 Ga0466967_0205489
459 Ga0495592_0010791
460 Ga0495592_0018085
461 Ga0495592_0019950
462 Ga0495603_0005744
463 Ga0495629_0001684
464 Ga0495629_0007807
465 Ga0495629_0022032
466 Ga0495629_0200310
467 Ga0495638_0091232
468 Ga0495638_0127395
469 Ga0495651_0001052
470 Ga0495651_0003837
471 Ga0495653_0025016
472 Ga0495653_0056490
473 Ga0495582_0053162
474 Ga0495605_0061175
475 Ga0495662_0003289
476 Ga0495662_0018561
477 Ga0495664_0000206
478 Ga0495664_0098836
479 Ga0495585_0035041
480 Ga0495585_0092820
481 Ga0495594_0000748
482 Ga0495594_0047344
483 Ga0495608_0000535
484 Ga0495618_0055076
485 Ga0495628_0002305
486 Ga0495628_0005866
487 Ga0495628_0112360
488 Ga0495630_0002519
489 Ga0495630_0025575
490 Ga0495643_0135579
491 Ga0495652_0001517
492 Ga0495652_0050777
493 Ga0495665_0001506
494 Ga0495640_0146900
495 Ga0495645_0009853
496 Ga0495645_0144939
497 Ga0495622_0006986
498 Ga0495622_0041075
499 Ga0495622_0078524
500 Ga0495622_0141640
501 Ga0495667_0006704
502 Ga0495634_0006416
503 Ga0495611_0099304
504 Ga0495611_0140306
505 Ga0495625_0027611
506 Ga0495588_0004993
507 Ga0495588_0026688
508 Ga0495588_0153101
509 Ga0495588_0185187
510 Ga0495657_0001293
511 Ga0495657_0003337
512 Ga0495657_0015409
513 Ga0495623_0010161
514 Ga0495623_0016207
515 Ga0495646_0001489
516 Ga0495658_0258725
517 Ga0495613_0000629
518 Ga0495613_0004608
519 Ga0495613_0005092
520 Ga0495613_0034694
521 Ga0495613_0174849
522 Ga0495649_0053947
523 Ga0495589_0008715
524 Ga0495589_0038341
525 Ga0495589_0079234
526 Ga0495600_0002349
527 Ga0495600_0012927
528 Ga0495600_0016610
529 Ga0495581_0013758
530 Ga0495581_0014221
531 Ga0495581_0070200
532 Ga0495581_0086619
533 Ga0495604_0000216
534 Ga0495604_0000676
535 Ga0495604_0006672
536 Ga0495604_0021277
537 Ga0495604_0306837
538 Ga0495636_0002761
539 Ga0495636_0003835
540 Ga0495636_0021096
541 Ga0495674_0043738
542 Ga0495676_0001354
543 Ga0495676_0021365
544 Ga0495683_0021645
545 Ga0495687_001793
546 Ga0495687_001814
547 Ga0495675_0011660
548 Ga0495675_0027165
549 Ga0495675_0030565
550 Ga0495675_0118252
551 Ga0495685_021252
552 Ga0495685_045486
553 Ga0495685_058195
554 Ga0495685_060551
555 Ga0495684_0001530
556 Ga0495686_0027995
557 Ga0495593_0004513
558 Ga0495593_0008867
559 Ga0495593_0087795
560 Ga0495602_0007604
561 Ga0495614_0000151
562 Ga0495614_0131312
563 Ga0496118_0176925
564 Ga0496124_0227737
565 Ga0501047_0162323
566 Ga0501071_0165783
567 Ga0501035_0125980
568 nmdc:mga0yw44_77678_c1
569 nmdc:mga0qj67_5447_c1
570 nmdc:mga06r32_5513_c1
571 nmdc:mga08y16_147294_c1
572 Ga0495601_0002055
573 Ga0495601_0002983
574 Ga0495612_0030029
575 Ga0495619_0021214
576 Ga0500644_0012740
577 Ga0500647_0047470
578 Ga0500650_0040256
579 Ga0500560_001768
580 Ga0500608_125020
581 Ga0500652_094634
582 Ga0500573_0061702
583 Ga0500573_0128583
584 Ga0466962_0006506
585 Ga0466962_0018313
586 Ga0466962_0023930
587 2774905226
588 2506866462
589 2554813991
590 2585298515
591 2585310826
592 2585314512
593 2608384712
594 2616904867
595 2643893409
596 2643900119
597 2643947866
598 2643962459
599 2644019590
600 2644180523
601 2644262914
602 2644390696
603 2644405657
604 2644433731
605 2784588994
606 2785342856
607 2785369946
608 2786671018
609 2808842436
610 2808920952
611 2811845781
612 2819739219
613 2862178985
614 2862286043
615 2862290858
616 2862578872
617 2867434831
618 2867480928
619 2873155358
620 2875395210
621 2877680683
622 2912719399
623 2912731394
624 2912761269
625 2918505184
626 2919471899
627 2932401388
628 2935390836
629 2946049514
630 2954385810
631 2954677345
632 2954686807
633 2954696456
634 2954705822
635 2954715812
636 2954725749
637 2954736051
638 2954744706
639 2954754911
640 2954763670
641 2990067676
642 2995468135
643 2997459086
644 2997608503
645 3003009339
646 3006490219
647 3006499374
648 8011356354
649 8023630481
650 8025482585
651 8025534399
652 8033690523
653 8048411494
654 8056449909
655 8056667415
656 8056833296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

27

269

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wn1-assembly1.cif.gz_A crystal structure of dipeptiase from pyrococcus horikoshii ot3 0.836 11 266
4rgz-assembly2.cif.gz_e crystal structure of recombinant prolidase from thermococcus sibiricus at p21221 spacegroup 0.8166 10 266
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.7935 11 266
5fcf-assembly1.cif.gz_A crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.7902 11 266
5cdl-assembly1.cif.gz_A proline dipeptidase from deinococcus radiodurans (selenomethionine derivative) 0.7888 15 266
ID Description Score Start End Superfamily
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8066 10 266 3.90.230.10
5cdlA02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.7924 15 266 3.90.230.10
af_Q9UUD8_220_447_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.7911 11 266 3.90.230.10
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.7844 10 266 3.90.230.10
af_A0A1D6KDB2_217_431_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.7807 11 159 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7Y5XF74-F1-model_v4 deleted 0.9997 11 105
AF-A0A1B6AHG9-F1-model_v4 Peptidase M24 domain-containing protein 0.9994 11 279
AF-A0A2G7EBJ5-F1-model_v4 deleted 0.9993 10 279
AF-A0A7W3WJB4-F1-model_v4 Aminopeptidase P family protein 0.9993 13 278 GO:0004177
AF-A0A7W7LQH6-F1-model_v4 Xaa-Pro aminopeptidase 0.9992 11 279 GO:0004177

Map