F409448

General Info

Members Datasets Scaffolds Average Seq Length
328 212 656 160

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_894696_c1|nmdc:mga0rr50_894696_c1_137_688
Length 183
Sequence MSPKQSPEVKAARQQLIDGLNEDLSREYQAIIAYVVYSQVLKGAQYMNIAAELEKHAGEELRHALLVSKQIDYLGGNPVVTPKPVRTSQDPKAMLRFDLENETETVRNYRERVRQCEALEEYAMAEVIRGILVQEQEHQIDLAAALGIEVPDSSRVAGETRRPATQIDREEKARTPGAKAARR

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
119 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.27
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 17.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_894696_c1 3300050513 Bacteria 757
2 Ga0058863_11932021 3300004799 Unclassified 743
3 Ga0065712_10095621 3300005290 Bacteria 2212
4 Ga0065715_10100894 3300005293 Bacteria 3257
5 Ga0065715_10103952 3300005293 Bacteria 2996
6 Ga0065707_10001699 3300005295 Bacteria 8572
7 Ga0065707_10457780 3300005295 Bacteria 794
8 Ga0070676_10005421 3300005328 Bacteria 6799
9 Ga0070690_100008010 3300005330 Bacteria 6067
10 Ga0070690_100122691 3300005330 Bacteria 1746
11 Ga0068869_100436532 3300005334 Unclassified 1083
12 Ga0068869_100468701 3300005334 Bacteria 1047
13 Ga0070680_100218596 3300005336 Bacteria 1608
14 Ga0070680_101194473 3300005336 Unclassified 658
15 Ga0068868_100181904 3300005338 Unclassified 1744
16 Ga0070689_100079911 3300005340 Bacteria 2566
17 Ga0070691_10011051 3300005341 Unclassified 4124
18 Ga0070692_10033998 3300005345 Bacteria 2572
19 Ga0070692_10363140 3300005345 Bacteria 903
20 Ga0070668_100011265 3300005347 Bacteria 6658
21 Ga0070669_100000040 3300005353 Bacteria 130277
22 Ga0070669_100542468 3300005353 Bacteria 969
23 Ga0070675_100267415 3300005354 Bacteria 1500
24 Ga0070671_101210360 3300005355 Bacteria 665
25 Ga0070673_100186917 3300005364 Bacteria 1777
26 Ga0070688_100927367 3300005365 Bacteria 688
27 Ga0070703_10070194 3300005406 Bacteria 1168
28 Ga0070709_10952780 3300005434 Bacteria 681
29 Ga0070713_100012741 3300005436 Bacteria 6179
30 Ga0070710_10332824 3300005437 Bacteria 1000
31 Ga0070701_10137534 3300005438 Bacteria 1394
32 Ga0070701_10841103 3300005438 Bacteria 629
33 Ga0070711_100000409 3300005439 Bacteria 22269
34 Ga0070711_100449949 3300005439 Bacteria 1054
35 Ga0070705_100000810 3300005440 Bacteria 17631
36 Ga0070700_100086283 3300005441 Bacteria 2038
37 Ga0070694_100006602 3300005444 Bacteria 7049
38 Ga0070694_100016675 3300005444 Bacteria 4626
39 Ga0070663_100265261 3300005455 Unclassified 1363
40 Ga0070678_100207501 3300005456 Bacteria 1621
41 Ga0070678_100574484 3300005456 Bacteria 1003
42 Ga0070662_100000112 3300005457 Bacteria 45382
43 Ga0070662_100565220 3300005457 Bacteria 954
44 Ga0070662_100800410 3300005457 Bacteria 801
45 Ga0070681_10078827 3300005458 Bacteria 3251
46 Ga0068867_100000043 3300005459 Bacteria 76605
47 Ga0068867_101468374 3300005459 Unclassified 634
48 Ga0070685_10998403 3300005466 Bacteria 628
49 Ga0070707_101343615 3300005468 Unclassified 681
50 Ga0070698_100211766 3300005471 Bacteria 1872
51 Ga0070698_100772219 3300005471 Bacteria 904
52 Ga0068853_100591445 3300005539 Unclassified 1053
53 Ga0070672_100046497 3300005543 Bacteria 3363
54 Ga0070686_100034058 3300005544 Unclassified 3135
55 Ga0070695_100005606 3300005545 Bacteria 7393
56 Ga0070695_100006800 3300005545 Bacteria 6770
57 Ga0070695_100732939 3300005545 Bacteria 787
58 Ga0070696_100020552 3300005546 Bacteria 4473
59 Ga0070665_100027881 3300005548 Bacteria 5687
60 Ga0070665_100513841 3300005548 Unclassified 1209
61 Ga0070665_100630385 3300005548 Bacteria 1085
62 Ga0070704_100035340 3300005549 Unclassified 3396
63 Ga0068855_100709031 3300005563 Bacteria 1076
64 Ga0068857_100021658 3300005577 Bacteria 5656
65 Ga0068854_100026004 3300005578 Bacteria 4018
66 Ga0068856_101673564 3300005614 Unclassified 649
67 Ga0070702_100003477 3300005615 Bacteria 7049
68 Ga0068859_100051602 3300005617 Bacteria 4135
69 Ga0068859_100463099 3300005617 Bacteria 1364
70 Ga0068864_100005860 3300005618 Bacteria 10070
71 Ga0068864_100103485 3300005618 Bacteria 2528
72 Ga0068864_100540105 3300005618 Bacteria 1126
73 Ga0068866_10000039 3300005718 Bacteria 49445
74 Ga0068861_100005556 3300005719 Bacteria 8542
75 Ga0068861_100477767 3300005719 Bacteria 1122
76 Ga0068861_100529711 3300005719 Bacteria 1070
77 Ga0068870_10040596 3300005840 Bacteria 2414
78 Ga0068870_10260528 3300005840 Bacteria 1079
79 Ga0068863_100124276 3300005841 Bacteria 2462
80 Ga0068863_100491103 3300005841 Unclassified 1208
81 Ga0068860_100010158 3300005843 Bacteria 9326
82 Ga0068860_100170169 3300005843 Bacteria 2104
83 Ga0070717_10322746 3300006028 Bacteria 1376
84 Ga0070712_100152446 3300006175 Bacteria 1776
85 Ga0097621_100097111 3300006237 Bacteria 2473
86 Ga0068871_100359701 3300006358 Unclassified 1289
87 Ga0075428_100011417 3300006844 Bacteria 9883
88 Ga0075431_100006432 3300006847 Bacteria 11662
89 Ga0075431_100264683 3300006847 Bacteria 1744
90 Ga0075433_10127869 3300006852 Unclassified 2256
91 Ga0075433_10244347 3300006852 Bacteria 1593
92 Ga0075433_10606313 3300006852 Unclassified 961
93 Ga0075434_100023634 3300006871 Bacteria 5993
94 Ga0075434_100033521 3300006871 Bacteria 5069
95 Ga0075429_100206454 3300006880 Bacteria 1721
96 Ga0068865_100001106 3300006881 Bacteria 15582
97 Ga0075436_100984593 3300006914 Bacteria 632
98 Ga0075436_100984594 3300006914 Unclassified 632
99 Ga0097620_100051601 3300006931 Bacteria 4135
100 Ga0097620_100463104 3300006931 Bacteria 1364
101 Ga0105240_10049275 3300009093 Bacteria 5318
102 Ga0105240_10482900 3300009093 Bacteria 1381
103 Ga0105240_10690867 3300009093 Bacteria 1115
104 Ga0105240_11020857 3300009093 Bacteria 884
105 Ga0111539_10047887 3300009094 Bacteria 5107
106 Ga0111539_10340497 3300009094 Bacteria 1746
107 Ga0111539_10484092 3300009094 Bacteria 1441
108 Ga0105245_10022487 3300009098 Bacteria 5535
109 Ga0105245_10042287 3300009098 Bacteria 4066
110 Ga0105247_10293782 3300009101 Bacteria 1125
111 Ga0114129_10103886 3300009147 Bacteria 3928
112 Ga0114129_10133855 3300009147 Bacteria 3403
113 Ga0105243_10000836 3300009148 Bacteria 29255
114 Ga0105241_10000975 3300009174 Bacteria 21685
115 Ga0105242_10000483 3300009176 Bacteria 31725
116 Ga0105248_10001265 3300009177 Bacteria 28244
117 Ga0105248_10628479 3300009177 Unclassified 1212
118 Ga0105248_10894061 3300009177 Unclassified 1003
119 Ga0105237_11105704 3300009545 Unclassified 799
120 Ga0105249_11472348 3300009553 Unclassified 753
121 Ga0105249_11944601 3300009553 Bacteria 661
122 Ga0105239_10093159 3300010375 Bacteria 3326
123 Ga0157374_10030843 3300013296 Bacteria 4869
124 Ga0157378_10004920 3300013297 Bacteria 11708
125 Ga0157378_11784777 3300013297 Unclassified 663
126 Ga0163162_10003287 3300013306 Bacteria 15467
127 Ga0157372_10186623 3300013307 Bacteria 2401
128 Ga0157375_10084766 3300013308 Bacteria 3218
129 Ga0157375_10153151 3300013308 Unclassified 2443
130 Ga0163163_10172920 3300014325 Bacteria 2207
131 Ga0163163_10286764 3300014325 Bacteria 1698
132 Ga0163163_10651625 3300014325 Unclassified 1117
133 Ga0157380_10076324 3300014326 Bacteria 2727
134 Ga0157380_10167265 3300014326 Bacteria 1917
135 Ga0157380_10209503 3300014326 Bacteria 1736
136 Ga0157377_10070863 3300014745 Bacteria 2014
137 Ga0157379_10022080 3300014968 Bacteria 5640
138 Ga0157379_10586715 3300014968 Unclassified 1039
139 Ga0157376_10835780 3300014969 Bacteria 935
140 Ga0157376_12723316 3300014969 Bacteria 534
141 Ga0163161_10837199 3300017792 Bacteria 775
142 Ga0224712_10549137 3300022467 Unclassified 561
143 Ga0207653_10030154 3300025885 Bacteria 1749
144 Ga0207653_10238626 3300025885 Bacteria 694
145 Ga0207699_10013446 3300025906 Bacteria 4190
146 Ga0207699_10724406 3300025906 Bacteria 729
147 Ga0207707_10203550 3300025912 Bacteria 1726
148 Ga0207695_10001578 3300025913 Bacteria 37134
149 Ga0207695_10077877 3300025913 Bacteria 3366
150 Ga0207695_10407949 3300025913 Unclassified 1243
151 Ga0207663_10012854 3300025916 Bacteria 4537
152 Ga0207662_10054103 3300025918 Unclassified 2392
153 Ga0207681_10000016 3300025923 Bacteria 345352
154 Ga0207681_10443816 3300025923 Bacteria 1055
155 Ga0207706_10720840 3300025933 Bacteria 851
156 Ga0207709_11201543 3300025935 Bacteria 625
157 Ga0207670_11907864 3300025936 Bacteria 505
158 Ga0207691_10293737 3300025940 Bacteria 1397
159 Ga0207689_10442056 3300025942 Bacteria 1086
160 Ga0207651_10021297 3300025960 Unclassified 3938
161 Ga0207712_10005583 3300025961 Bacteria 7931
162 Ga0207658_10018761 3300025986 Bacteria 4782
163 Ga0207677_10075627 3300026023 Unclassified 2394
164 Ga0207703_10343682 3300026035 Bacteria 1372
165 Ga0207708_10075775 3300026075 Unclassified 2580
166 Ga0207708_10148368 3300026075 Bacteria 1844
167 Ga0207641_10140992 3300026088 Bacteria 2175
168 Ga0207648_10631031 3300026089 Bacteria 989
169 Ga0207648_11681962 3300026089 Unclassified 596
170 Ga0207676_10048201 3300026095 Bacteria 3306
171 Ga0207676_10683283 3300026095 Bacteria 993
172 Ga0207676_11677600 3300026095 Bacteria 634
173 Ga0207674_10001565 3300026116 Bacteria 29462
174 Ga0207675_100003502 3300026118 Bacteria 15315
175 Ga0207675_100302725 3300026118 Bacteria 1557
176 Ga0207683_10251063 3300026121 Bacteria 1614
177 Ga0207683_10426417 3300026121 Unclassified 1222
178 Ga0207698_10610206 3300026142 Bacteria 1077
179 Ga0207428_10130746 3300027907 Unclassified 1921
180 Ga0207428_10250635 3300027907 Bacteria 1320
181 Ga0207428_10900914 3300027907 Unclassified 625
182 Ga0265354_1002539 3300028016 Bacteria 2237
183 Ga0265357_1008631 3300028023 Bacteria 1003
184 Ga0268266_10028090 3300028379 Unclassified 4783
185 Ga0268266_10183274 3300028379 Bacteria 1908
186 Ga0268266_10426905 3300028379 Bacteria 1257
187 Ga0268265_10126030 3300028380 Bacteria 2119
188 Ga0268265_10800611 3300028380 Bacteria 919
189 Ga0268264_10407254 3300028381 Bacteria 1308
190 Ga0268264_10952974 3300028381 Bacteria 863
191 Ga0265338_10007559 3300028800 Bacteria 13437
192 Ga0265338_10012287 3300028800 Bacteria 9776
193 Ga0265338_10093865 3300028800 Bacteria 2470
194 Ga0265338_10168703 3300028800 Bacteria 1681
195 Ga0265338_10446251 3300028800 Unclassified 916
196 Ga0265338_10731708 3300028800 Bacteria 681
197 Ga0265330_10106310 3300031235 Bacteria 1200
198 Ga0265330_10315496 3300031235 Bacteria 659
199 Ga0265325_10001312 3300031241 Bacteria 17620
200 Ga0265325_10023585 3300031241 Bacteria 3355
201 Ga0265325_10032217 3300031241 Unclassified 2799
202 Ga0265329_10039821 3300031242 Bacteria 1509
203 Ga0265339_10000405 3300031249 Bacteria 34030
204 Ga0265339_10052450 3300031249 Bacteria 2221
205 Ga0265339_10140035 3300031249 Unclassified 1231
206 Ga0265331_10000175 3300031250 Bacteria 78849
207 Ga0265316_10015962 3300031344 Bacteria 6536
208 Ga0265313_10014924 3300031595 Bacteria 4558
209 Ga0265313_10028889 3300031595 Bacteria 2875
210 Ga0265314_10000310 3300031711 Bacteria 69421
211 Ga0265314_10012711 3300031711 Bacteria 6843
212 Ga0265314_10062079 3300031711 Bacteria 2541
213 Ga0265342_10036850 3300031712 Bacteria 2985
214 Ga0265342_10041603 3300031712 Bacteria 2781
215 Ga0265342_10351831 3300031712 Bacteria 767
216 Ga0373926_0021131 3300035083 Bacteria 2252
217 Ga0373923_0005252 3300035111 Bacteria 4387
218 Ga0373936_0118543 3300035113 Bacteria 1129
219 Ga0373941_0399812 3300035115 Unclassified 568
220 Ga0373954_0187640 3300035118 Bacteria 1014
221 Ga0373954_0280282 3300035118 Bacteria 822
222 Ga0373956_0158221 3300035119 Bacteria 1067
223 Ga0373946_0115461 3300035171 Bacteria 1220
224 Ga0373955_0104665 3300035172 Bacteria 1629
225 Ga0373961_0003019 3300035241 Bacteria 4246
226 Ga0373927_0003719 3300035695 Bacteria 10843
227 Ga0373937_0015553 3300036401 Bacteria 6732
228 Ga0373937_1489695 3300036401 Unclassified 624
229 Ga0265778_010726 3300036457 Unclassified 1047
230 Ga0265778_041575 3300036457 Unclassified 613
231 Ga0436365_1585132 3300039437 Bacteria 787
232 Ga0451577_0093858 3300042876 Bacteria 2680
233 Ga0453684_0349020 3300044712 Bacteria 1669
234 Ga0495592_0017194 3300046454 Bacteria 5492
235 Ga0495651_0010129 3300046462 Bacteria 7240
236 Ga0495653_0007710 3300046463 Bacteria 8806
237 Ga0495639_0168365 3300046475 Unclassified 1063
238 Ga0495664_0867983 3300046477 Unclassified 528
239 Ga0495584_0120624 3300046491 Bacteria 1328
240 Ga0495608_0011102 3300046511 Bacteria 6272
241 Ga0495608_0030540 3300046511 Bacteria 3648
242 Ga0495618_0524242 3300046514 Bacteria 712
243 Ga0495628_0052055 3300046516 Bacteria 3235
244 Ga0495628_1082289 3300046516 Bacteria 548
245 Ga0495630_0010818 3300046517 Bacteria 6588
246 Ga0495630_0123183 3300046517 Bacteria 1967
247 Ga0495630_0273441 3300046517 Bacteria 1291
248 Ga0495630_1007859 3300046517 Unclassified 633
249 Ga0495666_0043010 3300046526 Bacteria 2183
250 Ga0495652_0009953 3300046529 Bacteria 8618
251 Ga0495665_0004930 3300046531 Bacteria 7196
252 Ga0495586_0005567 3300046535 Bacteria 6740
253 Ga0495621_0150340 3300046539 Bacteria 916
254 Ga0495645_0058384 3300046543 Bacteria 2799
255 Ga0495667_0094344 3300046559 Bacteria 1937
256 Ga0495634_0206733 3300046642 Bacteria 1217
257 Ga0495634_0246431 3300046642 Bacteria 1094
258 Ga0495635_0007433 3300046663 Bacteria 7646
259 Ga0495659_0013800 3300046664 Bacteria 2636
260 Ga0495659_0284154 3300046664 Unclassified 696
261 Ga0495657_0150255 3300046675 Bacteria 1446
262 Ga0495657_0606919 3300046675 Unclassified 633
263 Ga0495599_0541949 3300046678 Bacteria 682
264 Ga0495623_0005122 3300046679 Bacteria 8602
265 Ga0495623_0264659 3300046679 Bacteria 962
266 Ga0495646_0000534 3300046680 Bacteria 20391
267 Ga0495613_0105206 3300046689 Bacteria 2037
268 Ga0495613_0184459 3300046689 Unclassified 1477
269 Ga0495613_0197270 3300046689 Bacteria 1421
270 Ga0495624_0001421 3300046690 Bacteria 18642
271 Ga0495670_0230912 3300046691 Bacteria 984
272 Ga0495600_0383653 3300046809 Bacteria 876
273 Ga0495604_0006230 3300047317 Bacteria 9464
274 Ga0495674_0023587 3300047319 Bacteria 5668
275 Ga0495674_0189958 3300047319 Bacteria 1707
276 Ga0495674_0280910 3300047319 Bacteria 1364
277 Ga0495676_0160801 3300047321 Bacteria 1589
278 Ga0495680_0514998 3300047322 Unclassified 810
279 Ga0495675_0000750 3300047444 Bacteria 20283
280 Ga0495675_0035267 3300047444 Bacteria 3196
281 Ga0495675_0087720 3300047444 Unclassified 1955
282 Ga0495675_0331954 3300047444 Bacteria 898
283 Ga0495684_0004653 3300047471 Bacteria 10708
284 Ga0495684_0029130 3300047471 Bacteria 4238
285 Ga0495593_0039164 3300047673 Bacteria 2557
286 Ga0495602_0027194 3300048088 Bacteria 5503
287 Ga0495614_0030889 3300048089 Bacteria 2306
288 Ga0496101_0100920 3300048904 Bacteria 2160
289 Ga0496102_0385902 3300048905 Bacteria 1318
290 Ga0496106_0014656 3300048909 Bacteria 5794
291 Ga0496106_0306031 3300048909 Bacteria 1275
292 Ga0496107_0140941 3300048910 Bacteria 1782
293 Ga0496108_0233458 3300048911 Bacteria 1600
294 Ga0496109_0252388 3300048912 Bacteria 1661
295 Ga0496109_0388410 3300048912 Bacteria 1319
296 Ga0496110_0237435 3300048913 Bacteria 1659
297 Ga0496112_0318363 3300048915 Bacteria 1500
298 Ga0496112_0453533 3300048915 Bacteria 1220
299 Ga0496113_0233851 3300048916 Bacteria 1466
300 Ga0496114_0000020 3300048917 Bacteria 238645
301 Ga0496114_0083139 3300048917 Unclassified 2708
302 Ga0501032_0000157 3300049569 Bacteria 55322
303 Ga0501033_0000001 3300049570 Bacteria 795921
304 Ga0501075_0001000 3300049591 Bacteria 18056
305 Ga0501077_0001462 3300049593 Bacteria 14221
306 Ga0501243_088707 3300049675 Bacteria 611
307 Ga0501080_0123116 3300049742 Bacteria 2402
308 Ga0501080_0159107 3300049742 Unclassified 2086
309 Ga0501083_0001682 3300049744 Bacteria 15104
310 Ga0501204_048198 3300049850 Bacteria 645
311 nmdc:mga05p37_105510_c1 3300050507 Bacteria 3466
312 nmdc:mga09592_198532_c1 3300050508 Bacteria 1737
313 nmdc:mga09592_63879_c1 3300050508 Bacteria 3116
314 nmdc:mga09592_92440_c1 3300050508 Bacteria 2586
315 nmdc:mga06r32_20992_c1 3300050510 Bacteria 6023
316 nmdc:mga06r32_901253_c1 3300050510 Bacteria 841
317 nmdc:mga08y16_1689896_c1 3300050511 Unclassified 589
318 nmdc:mga08y16_266136_c1 3300050511 Bacteria 1770
319 nmdc:mga08y16_409653_c1 3300050511 Unclassified 1387
320 nmdc:mga0n895_108540_c1 3300050512 Unclassified 2790
321 nmdc:mga0n895_57688_c1 3300050512 Bacteria 3828
322 nmdc:mga08x19_308_c1 3300050514 Bacteria 35524
323 nmdc:mga08x19_367859_c1 3300050514 Bacteria 1006
324 nmdc:mga0a205_15586_c1 3300050515 Bacteria 7103
325 nmdc:mga0a205_171777_c1 3300050515 Bacteria 2064
326 Ga0495612_0004392 3300053078 Bacteria 5847
327 Ga0495619_0377739 3300053085 Bacteria 979
328 Ga0501082_0045091 3300060353 Bacteria 3802
329 nmdc:mga0rr50_894696_c1
330 Ga0058863_11932021
331 Ga0065712_10095621
332 Ga0065715_10100894
333 Ga0065715_10103952
334 Ga0065707_10001699
335 Ga0065707_10457780
336 Ga0070676_10005421
337 Ga0070690_100008010
338 Ga0070690_100122691
339 Ga0068869_100436532
340 Ga0068869_100468701
341 Ga0070680_100218596
342 Ga0070680_101194473
343 Ga0068868_100181904
344 Ga0070689_100079911
345 Ga0070691_10011051
346 Ga0070692_10033998
347 Ga0070692_10363140
348 Ga0070668_100011265
349 Ga0070669_100000040
350 Ga0070669_100542468
351 Ga0070675_100267415
352 Ga0070671_101210360
353 Ga0070673_100186917
354 Ga0070688_100927367
355 Ga0070703_10070194
356 Ga0070709_10952780
357 Ga0070713_100012741
358 Ga0070710_10332824
359 Ga0070701_10137534
360 Ga0070701_10841103
361 Ga0070711_100000409
362 Ga0070711_100449949
363 Ga0070705_100000810
364 Ga0070700_100086283
365 Ga0070694_100006602
366 Ga0070694_100016675
367 Ga0070663_100265261
368 Ga0070678_100207501
369 Ga0070678_100574484
370 Ga0070662_100000112
371 Ga0070662_100565220
372 Ga0070662_100800410
373 Ga0070681_10078827
374 Ga0068867_100000043
375 Ga0068867_101468374
376 Ga0070685_10998403
377 Ga0070707_101343615
378 Ga0070698_100211766
379 Ga0070698_100772219
380 Ga0068853_100591445
381 Ga0070672_100046497
382 Ga0070686_100034058
383 Ga0070695_100005606
384 Ga0070695_100006800
385 Ga0070695_100732939
386 Ga0070696_100020552
387 Ga0070665_100027881
388 Ga0070665_100513841
389 Ga0070665_100630385
390 Ga0070704_100035340
391 Ga0068855_100709031
392 Ga0068857_100021658
393 Ga0068854_100026004
394 Ga0068856_101673564
395 Ga0070702_100003477
396 Ga0068859_100051602
397 Ga0068859_100463099
398 Ga0068864_100005860
399 Ga0068864_100103485
400 Ga0068864_100540105
401 Ga0068866_10000039
402 Ga0068861_100005556
403 Ga0068861_100477767
404 Ga0068861_100529711
405 Ga0068870_10040596
406 Ga0068870_10260528
407 Ga0068863_100124276
408 Ga0068863_100491103
409 Ga0068860_100010158
410 Ga0068860_100170169
411 Ga0070717_10322746
412 Ga0070712_100152446
413 Ga0097621_100097111
414 Ga0068871_100359701
415 Ga0075428_100011417
416 Ga0075431_100006432
417 Ga0075431_100264683
418 Ga0075433_10127869
419 Ga0075433_10244347
420 Ga0075433_10606313
421 Ga0075434_100023634
422 Ga0075434_100033521
423 Ga0075429_100206454
424 Ga0068865_100001106
425 Ga0075436_100984593
426 Ga0075436_100984594
427 Ga0097620_100051601
428 Ga0097620_100463104
429 Ga0105240_10049275
430 Ga0105240_10482900
431 Ga0105240_10690867
432 Ga0105240_11020857
433 Ga0111539_10047887
434 Ga0111539_10340497
435 Ga0111539_10484092
436 Ga0105245_10022487
437 Ga0105245_10042287
438 Ga0105247_10293782
439 Ga0114129_10103886
440 Ga0114129_10133855
441 Ga0105243_10000836
442 Ga0105241_10000975
443 Ga0105242_10000483
444 Ga0105248_10001265
445 Ga0105248_10628479
446 Ga0105248_10894061
447 Ga0105237_11105704
448 Ga0105249_11472348
449 Ga0105249_11944601
450 Ga0105239_10093159
451 Ga0157374_10030843
452 Ga0157378_10004920
453 Ga0157378_11784777
454 Ga0163162_10003287
455 Ga0157372_10186623
456 Ga0157375_10084766
457 Ga0157375_10153151
458 Ga0163163_10172920
459 Ga0163163_10286764
460 Ga0163163_10651625
461 Ga0157380_10076324
462 Ga0157380_10167265
463 Ga0157380_10209503
464 Ga0157377_10070863
465 Ga0157379_10022080
466 Ga0157379_10586715
467 Ga0157376_10835780
468 Ga0157376_12723316
469 Ga0163161_10837199
470 Ga0224712_10549137
471 Ga0207653_10030154
472 Ga0207653_10238626
473 Ga0207699_10013446
474 Ga0207699_10724406
475 Ga0207707_10203550
476 Ga0207695_10001578
477 Ga0207695_10077877
478 Ga0207695_10407949
479 Ga0207663_10012854
480 Ga0207662_10054103
481 Ga0207681_10000016
482 Ga0207681_10443816
483 Ga0207706_10720840
484 Ga0207709_11201543
485 Ga0207670_11907864
486 Ga0207691_10293737
487 Ga0207689_10442056
488 Ga0207651_10021297
489 Ga0207712_10005583
490 Ga0207658_10018761
491 Ga0207677_10075627
492 Ga0207703_10343682
493 Ga0207708_10075775
494 Ga0207708_10148368
495 Ga0207641_10140992
496 Ga0207648_10631031
497 Ga0207648_11681962
498 Ga0207676_10048201
499 Ga0207676_10683283
500 Ga0207676_11677600
501 Ga0207674_10001565
502 Ga0207675_100003502
503 Ga0207675_100302725
504 Ga0207683_10251063
505 Ga0207683_10426417
506 Ga0207698_10610206
507 Ga0207428_10130746
508 Ga0207428_10250635
509 Ga0207428_10900914
510 Ga0265354_1002539
511 Ga0265357_1008631
512 Ga0268266_10028090
513 Ga0268266_10183274
514 Ga0268266_10426905
515 Ga0268265_10126030
516 Ga0268265_10800611
517 Ga0268264_10407254
518 Ga0268264_10952974
519 Ga0265338_10007559
520 Ga0265338_10012287
521 Ga0265338_10093865
522 Ga0265338_10168703
523 Ga0265338_10446251
524 Ga0265338_10731708
525 Ga0265330_10106310
526 Ga0265330_10315496
527 Ga0265325_10001312
528 Ga0265325_10023585
529 Ga0265325_10032217
530 Ga0265329_10039821
531 Ga0265339_10000405
532 Ga0265339_10052450
533 Ga0265339_10140035
534 Ga0265331_10000175
535 Ga0265316_10015962
536 Ga0265313_10014924
537 Ga0265313_10028889
538 Ga0265314_10000310
539 Ga0265314_10012711
540 Ga0265314_10062079
541 Ga0265342_10036850
542 Ga0265342_10041603
543 Ga0265342_10351831
544 Ga0373926_0021131
545 Ga0373923_0005252
546 Ga0373936_0118543
547 Ga0373941_0399812
548 Ga0373954_0187640
549 Ga0373954_0280282
550 Ga0373956_0158221
551 Ga0373946_0115461
552 Ga0373955_0104665
553 Ga0373961_0003019
554 Ga0373927_0003719
555 Ga0373937_0015553
556 Ga0373937_1489695
557 Ga0265778_010726
558 Ga0265778_041575
559 Ga0436365_1585132
560 Ga0451577_0093858
561 Ga0453684_0349020
562 Ga0495592_0017194
563 Ga0495651_0010129
564 Ga0495653_0007710
565 Ga0495639_0168365
566 Ga0495664_0867983
567 Ga0495584_0120624
568 Ga0495608_0011102
569 Ga0495608_0030540
570 Ga0495618_0524242
571 Ga0495628_0052055
572 Ga0495628_1082289
573 Ga0495630_0010818
574 Ga0495630_0123183
575 Ga0495630_0273441
576 Ga0495630_1007859
577 Ga0495666_0043010
578 Ga0495652_0009953
579 Ga0495665_0004930
580 Ga0495586_0005567
581 Ga0495621_0150340
582 Ga0495645_0058384
583 Ga0495667_0094344
584 Ga0495634_0206733
585 Ga0495634_0246431
586 Ga0495635_0007433
587 Ga0495659_0013800
588 Ga0495659_0284154
589 Ga0495657_0150255
590 Ga0495657_0606919
591 Ga0495599_0541949
592 Ga0495623_0005122
593 Ga0495623_0264659
594 Ga0495646_0000534
595 Ga0495613_0105206
596 Ga0495613_0184459
597 Ga0495613_0197270
598 Ga0495624_0001421
599 Ga0495670_0230912
600 Ga0495600_0383653
601 Ga0495604_0006230
602 Ga0495674_0023587
603 Ga0495674_0189958
604 Ga0495674_0280910
605 Ga0495676_0160801
606 Ga0495680_0514998
607 Ga0495675_0000750
608 Ga0495675_0035267
609 Ga0495675_0087720
610 Ga0495675_0331954
611 Ga0495684_0004653
612 Ga0495684_0029130
613 Ga0495593_0039164
614 Ga0495602_0027194
615 Ga0495614_0030889
616 Ga0496101_0100920
617 Ga0496102_0385902
618 Ga0496106_0014656
619 Ga0496106_0306031
620 Ga0496107_0140941
621 Ga0496108_0233458
622 Ga0496109_0252388
623 Ga0496109_0388410
624 Ga0496110_0237435
625 Ga0496112_0318363
626 Ga0496112_0453533
627 Ga0496113_0233851
628 Ga0496114_0000020
629 Ga0496114_0083139
630 Ga0501032_0000157
631 Ga0501033_0000001
632 Ga0501075_0001000
633 Ga0501077_0001462
634 Ga0501243_088707
635 Ga0501080_0123116
636 Ga0501080_0159107
637 Ga0501083_0001682
638 Ga0501204_048198
639 nmdc:mga05p37_105510_c1
640 nmdc:mga09592_198532_c1
641 nmdc:mga09592_63879_c1
642 nmdc:mga09592_92440_c1
643 nmdc:mga06r32_20992_c1
644 nmdc:mga06r32_901253_c1
645 nmdc:mga08y16_1689896_c1
646 nmdc:mga08y16_266136_c1
647 nmdc:mga08y16_409653_c1
648 nmdc:mga0n895_108540_c1
649 nmdc:mga0n895_57688_c1
650 nmdc:mga08x19_308_c1
651 nmdc:mga08x19_367859_c1
652 nmdc:mga0a205_15586_c1
653 nmdc:mga0a205_171777_c1
654 Ga0495612_0004392
655 Ga0495619_0377739
656 Ga0501082_0045091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

17

149

0.96

PF02915

Rubrerythrin

Rubrerythrin

18

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.956 10 145
3ghq-assembly1.cif.gz_A crystal structure of e. coli w35f bfr mutant 0.9486 14 146
4xku-assembly1.cif.gz_F e coli bfr variant y114f 0.948 14 146
1bcf-assembly1.cif.gz_A the structure of a unique, two-fold symmetric, haem-binding site 0.948 14 146
4xkt-assembly1.cif.gz_C e coli bfr variant y149f 0.9477 14 146
ID Description Score Start End Superfamily
2qqyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9552 12 145 1.20.1260.10
1bcfA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.948 14 146 1.20.1260.10
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9477 14 146 1.20.1260.10
3e2cA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9472 14 146 1.20.1260.10
3e2cB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9457 14 146 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7Y4WUE8-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9888 12 152 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A1V5IPQ1-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.9867 9 147 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0015093
GO:0020037
AF-A0A832TDR8-F1-model_v4 Ferritin-like domain-containing protein 0.9864 10 146 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-X1HHP3-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9862 19 146 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A346AE38-F1-model_v4 Ferritin 0.9857 9 152 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Map