F409425

General Info

Members Datasets Scaffolds Average Seq Length
328 174 656 300

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0100758|Ga0501036_0100758_373_1347
Length 324
Sequence MLNAECGMRNAEGCELEAGSWELVFMRIFLTGGTGYIGSAVLDSLVRGGHRVDALVRNSEKAAQVQARGGHPVLGDLARPGTYADAAAAADGAVHTAFENSARGPQVDAAAIDVLTRTDGRSGRFLIYTSGVWILGSSPVPMDESAALNPAELVLWRPDHEKRVLDAATGGLRTVIVRPGIVYGGSRGIVGSLFKDAANGLVRIIGGGDNHWALVYDRDLGELYLRLVNTADAAGVFHANDEGDERVNDLVAAISAYASINPSVRRVPLLEAHQKMGAYADALALDQVVRSPRARALGWSPSLRSVSGNAARLFEEWRRGREAA

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.71
Nodule 0
Rhizoplane 3.96
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0100758 3300049572 Bacteria 2443
2 Ga0070676_10049694 3300005328 Bacteria 2456
3 Ga0070683_100246008 3300005329 Unclassified 1701
4 Ga0070690_100033266 3300005330 Unclassified 3226
5 Ga0070670_100336813 3300005331 Bacteria 1324
6 Ga0068869_100095689 3300005334 Bacteria 2241
7 Ga0068869_100237455 3300005334 Bacteria 1451
8 Ga0070691_10002990 3300005341 Bacteria 7568
9 Ga0070669_100003804 3300005353 Bacteria 10906
10 Ga0070669_100310193 3300005353 Bacteria 1271
11 Ga0070675_100001924 3300005354 Bacteria 15357
12 Ga0070675_100055329 3300005354 Bacteria 3266
13 Ga0070675_100075903 3300005354 Bacteria 2794
14 Ga0070671_100028647 3300005355 Bacteria 4587
15 Ga0070671_100033112 3300005355 Bacteria 4273
16 Ga0070674_100095519 3300005356 Bacteria 2155
17 Ga0070673_100024450 3300005364 Bacteria 4430
18 Ga0070673_100096125 3300005364 Bacteria 2431
19 Ga0070688_100128398 3300005365 Bacteria 1707
20 Ga0070667_100107216 3300005367 Bacteria 2419
21 Ga0070700_100015097 3300005441 Bacteria 4373
22 Ga0070694_100060499 3300005444 Bacteria 2583
23 Ga0070694_100217590 3300005444 Bacteria 1431
24 Ga0070708_100011253 3300005445 Bacteria 7277
25 Ga0070678_100046428 3300005456 Bacteria 3114
26 Ga0070678_100062730 3300005456 Bacteria 2746
27 Ga0070662_100270940 3300005457 Bacteria 1371
28 Ga0070681_10093723 3300005458 Bacteria 2952
29 Ga0070681_10395897 3300005458 Bacteria 1292
30 Ga0068867_100027402 3300005459 Bacteria 4094
31 Ga0068867_100236952 3300005459 Bacteria 1478
32 Ga0070698_100177079 3300005471 Unclassified 2072
33 Ga0070698_100230530 3300005471 Bacteria 1785
34 Ga0070698_100541836 3300005471 Bacteria 1103
35 Ga0070699_100016898 3300005518 Bacteria 6265
36 Ga0070699_100118130 3300005518 Unclassified 2331
37 Ga0070679_100037388 3300005530 Bacteria 4822
38 Ga0070697_100024013 3300005536 Bacteria 4852
39 Ga0070672_100021896 3300005543 Bacteria 4684
40 Ga0070686_100044177 3300005544 Bacteria 2799
41 Ga0070695_100000404 3300005545 Bacteria 22407
42 Ga0070695_100008545 3300005545 Bacteria 6081
43 Ga0070696_100065557 3300005546 Bacteria 2546
44 Ga0070665_100009389 3300005548 Bacteria 9897
45 Ga0070704_100014971 3300005549 Bacteria 4858
46 Ga0070664_100022254 3300005564 Bacteria 5227
47 Ga0070664_100503259 3300005564 Bacteria 1117
48 Ga0068857_100064804 3300005577 Bacteria 3249
49 Ga0070702_100010521 3300005615 Bacteria 4560
50 Ga0070702_100085633 3300005615 Unclassified 1899
51 Ga0068859_100053194 3300005617 Bacteria 4072
52 Ga0068859_100229314 3300005617 Bacteria 1945
53 Ga0068859_100608484 3300005617 Bacteria 1186
54 Ga0068859_100743619 3300005617 Bacteria 1070
55 Ga0068864_100263503 3300005618 Bacteria 1604
56 Ga0068864_100293813 3300005618 Bacteria 1519
57 Ga0068861_100005916 3300005719 Bacteria 8312
58 Ga0068861_100053719 3300005719 Bacteria 3066
59 Ga0068863_100004188 3300005841 Bacteria 14243
60 Ga0068863_100098961 3300005841 Bacteria 2770
61 Ga0068858_100002099 3300005842 Bacteria 20232
62 Ga0068858_100098238 3300005842 Bacteria 2730
63 Ga0068860_100132410 3300005843 Bacteria 2394
64 Ga0068860_100265880 3300005843 Unclassified 1673
65 Ga0068860_100446481 3300005843 Unclassified 1285
66 Ga0068862_100126086 3300005844 Bacteria 2260
67 Ga0068862_100189409 3300005844 Bacteria 1850
68 Ga0068862_100651590 3300005844 Bacteria 1016
69 Ga0081539_10008803 3300005985 Bacteria 8644
70 Ga0075368_10030930 3300006042 Unclassified 2075
71 Ga0075364_10039966 3300006051 Unclassified 3042
72 Ga0075367_10016848 3300006178 Bacteria 3998
73 Ga0075367_10152933 3300006178 Unclassified 1432
74 Ga0075366_10018209 3300006195 Bacteria 4054
75 Ga0075366_10024001 3300006195 Bacteria 3556
76 Ga0075366_10088641 3300006195 Bacteria 1853
77 Ga0097621_100014070 3300006237 Bacteria 5979
78 Ga0075370_10086906 3300006353 Unclassified 1801
79 Ga0068871_100061231 3300006358 Bacteria 3073
80 Ga0068871_100134944 3300006358 Bacteria 2095
81 Ga0068871_100220962 3300006358 Bacteria 1641
82 Ga0068871_100287490 3300006358 Unclassified 1440
83 Ga0075431_100032713 3300006847 Bacteria 5360
84 Ga0075433_10013493 3300006852 Bacteria 6644
85 Ga0075433_10045101 3300006852 Bacteria 3832
86 Ga0075433_10058079 3300006852 Bacteria 3383
87 Ga0075434_100001454 3300006871 Bacteria 19916
88 Ga0075434_100039128 3300006871 Bacteria 4698
89 Ga0075434_100243303 3300006871 Unclassified 1819
90 Ga0068865_100017109 3300006881 Bacteria 4656
91 Ga0075436_100020186 3300006914 Bacteria 4573
92 Ga0075436_100105039 3300006914 Bacteria 1969
93 Ga0097620_100053193 3300006931 Bacteria 4072
94 Ga0097620_100229296 3300006931 Bacteria 1945
95 Ga0097620_100608441 3300006931 Bacteria 1186
96 Ga0097620_100743474 3300006931 Bacteria 1070
97 Ga0075435_100000371 3300007076 Bacteria 27544
98 Ga0075435_100024542 3300007076 Bacteria 4681
99 Ga0075435_100033085 3300007076 Bacteria 4086
100 Ga0105251_10114365 3300009011 Unclassified 1228
101 Ga0105240_10518715 3300009093 Bacteria 1323
102 Ga0111539_10003630 3300009094 Bacteria 20329
103 Ga0111539_10006955 3300009094 Bacteria 14519
104 Ga0111539_10007874 3300009094 Bacteria 13602
105 Ga0111539_10703504 3300009094 Bacteria 1176
106 Ga0105247_10064809 3300009101 Unclassified 2271
107 Ga0114129_10000380 3300009147 Bacteria 51486
108 Ga0114129_10004040 3300009147 Bacteria 20719
109 Ga0114129_10038778 3300009147 Bacteria 6716
110 Ga0114129_10043979 3300009147 Bacteria 6283
111 Ga0114129_10081222 3300009147 Unclassified 4506
112 Ga0114129_10091319 3300009147 Unclassified 4219
113 Ga0114129_10220098 3300009147 Bacteria 2562
114 Ga0114129_10417107 3300009147 Bacteria 1766
115 Ga0105243_10018114 3300009148 Bacteria 5329
116 Ga0105243_10029866 3300009148 Bacteria 4195
117 Ga0105242_10039707 3300009176 Bacteria 3789
118 Ga0105242_10070042 3300009176 Bacteria 2907
119 Ga0105242_10315723 3300009176 Bacteria 1432
120 Ga0105242_10341775 3300009176 Bacteria 1379
121 Ga0105242_10405414 3300009176 Unclassified 1274
122 Ga0105248_10014609 3300009177 Bacteria 8640
123 Ga0105248_10015631 3300009177 Bacteria 8365
124 Ga0105248_10042577 3300009177 Bacteria 5093
125 Ga0105248_10089536 3300009177 Bacteria 3464
126 Ga0105248_10204723 3300009177 Unclassified 2224
127 Ga0105248_10356811 3300009177 Unclassified 1646
128 Ga0105248_10782086 3300009177 Bacteria 1077
129 Ga0105249_10112145 3300009553 Bacteria 2579
130 Ga0157378_10036694 3300013297 Bacteria 4338
131 Ga0157378_10572403 3300013297 Unclassified 1138
132 Ga0157375_10434383 3300013308 Unclassified 1479
133 Ga0163163_10103522 3300014325 Bacteria 2871
134 Ga0163163_10106359 3300014325 Bacteria 2832
135 Ga0163163_10328851 3300014325 Unclassified 1582
136 Ga0157380_10021189 3300014326 Bacteria 4872
137 Ga0157377_10033121 3300014745 Unclassified 2818
138 Ga0157379_10030737 3300014968 Bacteria 4783
139 Ga0157376_10025306 3300014969 Bacteria 4673
140 Ga0157376_10094838 3300014969 Bacteria 2593
141 Ga0157376_10339079 3300014969 Bacteria 1435
142 Ga0207642_10037743 3300025899 Bacteria 2084
143 Ga0207642_10075142 3300025899 Unclassified 1622
144 Ga0207642_10121650 3300025899 Bacteria 1347
145 Ga0207645_10001127 3300025907 Bacteria 22111
146 Ga0207645_10076415 3300025907 Bacteria 2145
147 Ga0207684_10187412 3300025910 Unclassified 1784
148 Ga0207707_10074554 3300025912 Bacteria 2960
149 Ga0207681_10139170 3300025923 Bacteria 1805
150 Ga0207681_10221693 3300025923 Bacteria 1463
151 Ga0207681_10222247 3300025923 Unclassified 1462
152 Ga0207650_10014683 3300025925 Bacteria 5442
153 Ga0207659_10000233 3300025926 Bacteria 34013
154 Ga0207706_10029324 3300025933 Bacteria 4912
155 Ga0207706_10204167 3300025933 Unclassified 1733
156 Ga0207706_10249005 3300025933 Bacteria 1552
157 Ga0207706_10338542 3300025933 Unclassified 1309
158 Ga0207686_10081252 3300025934 Bacteria 2115
159 Ga0207686_10166252 3300025934 Bacteria 1551
160 Ga0207709_10012892 3300025935 Bacteria 4610
161 Ga0207669_10040960 3300025937 Unclassified 2692
162 Ga0207704_10093138 3300025938 Bacteria 1985
163 Ga0207665_10224011 3300025939 Bacteria 1379
164 Ga0207691_10366832 3300025940 Bacteria 1230
165 Ga0207711_10109704 3300025941 Bacteria 2453
166 Ga0207711_10222905 3300025941 Bacteria 1725
167 Ga0207689_10287138 3300025942 Bacteria 1363
168 Ga0207679_10029987 3300025945 Bacteria 3793
169 Ga0207679_10407017 3300025945 Bacteria 1198
170 Ga0207667_10443393 3300025949 Unclassified 1320
171 Ga0207651_10109055 3300025960 Bacteria 2073
172 Ga0207651_10376934 3300025960 Bacteria 1201
173 Ga0207658_10162095 3300025986 Bacteria 1834
174 Ga0207658_10536339 3300025986 Bacteria 1046
175 Ga0207703_10018573 3300026035 Bacteria 5429
176 Ga0207703_10415600 3300026035 Bacteria 1251
177 Ga0207703_10601285 3300026035 Bacteria 1040
178 Ga0207678_10099018 3300026067 Bacteria 2490
179 Ga0207708_10004025 3300026075 Bacteria 10811
180 Ga0207708_10353052 3300026075 Bacteria 1207
181 Ga0207641_10047886 3300026088 Bacteria 3606
182 Ga0207641_10113443 3300026088 Bacteria 2407
183 Ga0207641_10140269 3300026088 Bacteria 2180
184 Ga0207641_10232625 3300026088 Unclassified 1714
185 Ga0207648_10161123 3300026089 Bacteria 1981
186 Ga0207674_10020679 3300026116 Bacteria 7102
187 Ga0207674_10436446 3300026116 Bacteria 1266
188 Ga0207675_100006201 3300026118 Bacteria 11353
189 Ga0207675_100023416 3300026118 Bacteria 5745
190 Ga0207675_100156273 3300026118 Bacteria 2173
191 Ga0207675_100197791 3300026118 Bacteria 1930
192 Ga0207683_10016025 3300026121 Bacteria 6379
193 Ga0207683_10029269 3300026121 Bacteria 4768
194 Ga0207683_10037148 3300026121 Bacteria 4241
195 Ga0207683_10146069 3300026121 Bacteria 2133
196 Ga0207428_10012715 3300027907 Bacteria 7381
197 Ga0207428_10025315 3300027907 Bacteria 4966
198 Ga0207428_10025450 3300027907 Bacteria 4954
199 Ga0207428_10332442 3300027907 Bacteria 1120
200 Ga0268266_10068759 3300028379 Bacteria 3067
201 Ga0268266_10291646 3300028379 Bacteria 1519
202 Ga0268265_10142647 3300028380 Bacteria 2007
203 Ga0268265_10357203 3300028380 Bacteria 1336
204 Ga0268265_10627651 3300028380 Bacteria 1030
205 Ga0268264_10679108 3300028381 Unclassified 1021
206 Ga0307405_10012071 3300031731 Bacteria 4557
207 Ga0307405_10158491 3300031731 Bacteria 1600
208 Ga0307413_10004561 3300031824 Bacteria 6047
209 Ga0307410_10004146 3300031852 Bacteria 7431
210 Ga0307410_10098863 3300031852 Bacteria 2088
211 Ga0307406_10057492 3300031901 Bacteria 2495
212 Ga0307407_10000298 3300031903 Bacteria 14660
213 Ga0307407_10018371 3300031903 Bacteria 3535
214 Ga0307409_100006590 3300031995 Bacteria 6845
215 Ga0307409_100039424 3300031995 Bacteria 3505
216 Ga0307409_100217290 3300031995 Unclassified 1723
217 Ga0307416_100002420 3300032002 Bacteria 10709
218 Ga0307416_100014629 3300032002 Bacteria 5387
219 Ga0307416_100044386 3300032002 Unclassified 3490
220 Ga0307416_100231843 3300032002 Bacteria 1781
221 Ga0307414_10005321 3300032004 Bacteria 7079
222 Ga0307411_10053104 3300032005 Unclassified 2653
223 Ga0373930_0009504 3300034816 Unclassified 1721
224 Ga0373948_0005715 3300034817 Unclassified 2026
225 Ga0373950_0013047 3300034818 Unclassified 1380
226 Ga0373938_0000994 3300034957 Bacteria 4556
227 Ga0373928_0000906 3300035084 Bacteria 5806
228 Ga0373951_0005034 3300035091 Bacteria 3093
229 Ga0373932_0004019 3300035112 Unclassified 3502
230 Ga0373941_0002252 3300035115 Bacteria 4218
231 Ga0373953_0058129 3300035117 Bacteria 1576
232 Ga0373960_0016486 3300035121 Unclassified 1901
233 Ga0373943_0205921 3300035170 Bacteria 1091
234 Ga0373942_0001299 3300035207 Bacteria 6529
235 Ga0373961_0002578 3300035241 Unclassified 4666
236 Ga0373961_0017420 3300035241 Unclassified 1863
237 Ga0373962_0024264 3300035242 Bacteria 1620
238 Ga0373962_0026396 3300035242 Unclassified 1565
239 Ga0373937_0183365 3300036401 Bacteria 1966
240 Ga0439433_0036148 3300041999 Bacteria 1140
241 Ga0439462_0063162 3300042015 Unclassified 1002
242 Ga0450908_001488 3300042184 Bacteria 4546
243 Ga0439435_0000441 3300042436 Bacteria 6531
244 Ga0451577_0068627 3300042876 Bacteria 3162
245 Ga0466963_0116539 3300044694 Bacteria 1836
246 Ga0453684_0246461 3300044712 Unclassified 2054
247 Ga0451576_0109949 3300045051 Bacteria 2868
248 Ga0451576_0173611 3300045051 Unclassified 2250
249 Ga0466967_0151464 3300045976 Bacteria 2168
250 Ga0495640_0157577 3300046533 Bacteria 1457
251 Ga0495633_0029640 3300046558 Bacteria 2662
252 Ga0496101_0012101 3300048904 Bacteria 5751
253 Ga0496101_0230160 3300048904 Bacteria 1440
254 Ga0496101_0298415 3300048904 Bacteria 1262
255 Ga0496102_0157753 3300048905 Unclassified 2133
256 Ga0496104_0121849 3300048907 Bacteria 2504
257 Ga0496104_0298072 3300048907 Bacteria 1524
258 Ga0496104_0399646 3300048907 Bacteria 1286
259 Ga0496106_0227494 3300048909 Bacteria 1488
260 Ga0496109_0030143 3300048912 Bacteria 4863
261 Ga0496112_0011161 3300048915 Bacteria 8192
262 Ga0496112_0516710 3300048915 Unclassified 1129
263 Ga0496114_0009246 3300048917 Bacteria 7815
264 Ga0496114_0186343 3300048917 Bacteria 1814
265 Ga0501041_0024031 3300049577 Bacteria 3657
266 Ga0501042_0160545 3300049578 Bacteria 1622
267 Ga0501046_0051859 3300049580 Bacteria 3236
268 Ga0501071_0011458 3300049587 Bacteria 5975
269 Ga0501072_0011914 3300049588 Bacteria 6641
270 Ga0501072_0168678 3300049588 Bacteria 1747
271 Ga0501075_0066345 3300049591 Bacteria 2723
272 Ga0501076_0007261 3300049592 Bacteria 8062
273 Ga0501045_0025449 3300049824 Bacteria 4254
274 nmdc:mga00v17_184329_c1 3300050491 Bacteria 1347
275 nmdc:mga00v17_88916_c1 3300050491 Unclassified 1938
276 nmdc:mga0k408_185257_c1 3300050493 Bacteria 1242
277 nmdc:mga0k408_2244_c1 3300050493 Bacteria 10326
278 nmdc:mga0k408_39142_c1 3300050493 Bacteria 2723
279 nmdc:mga06z11_104645_c1 3300050494 Bacteria 1558
280 nmdc:mga06z11_170480_c1 3300050494 Bacteria 1249
281 nmdc:mga06z11_48026_c1 3300050494 Unclassified 2171
282 nmdc:mga07m45_115359_c1 3300050496 Unclassified 1549
283 nmdc:mga07m45_162691_c1 3300050496 Bacteria 1296
284 nmdc:mga05p37_11199_c1 3300050507 Bacteria 10660
285 nmdc:mga05p37_1623_c1 3300050507 Bacteria 26057
286 nmdc:mga05p37_28795_c1 3300050507 Bacteria 6777
287 nmdc:mga05p37_30267_c1 3300050507 Bacteria 6604
288 nmdc:mga05p37_32758_c1 3300050507 Bacteria 6358
289 nmdc:mga05p37_40478_c1 3300050507 Bacteria 5724
290 nmdc:mga05p37_7348_c1 3300050507 Bacteria 12991
291 nmdc:mga05p37_88565_c1 3300050507 Bacteria 3815
292 nmdc:mga06r32_44261_c1 3300050510 Bacteria 4238
293 nmdc:mga08y16_35838_c1 3300050511 Bacteria 5211
294 nmdc:mga08y16_7487_c1 3300050511 Bacteria 11435
295 nmdc:mga0n895_155761_c1 3300050512 Bacteria 2315
296 nmdc:mga0n895_179572_c1 3300050512 Bacteria 2148
297 nmdc:mga0n895_181_c1 3300050512 Bacteria 38803
298 nmdc:mga0n895_278140_c1 3300050512 Bacteria 1697
299 nmdc:mga0n895_292046_c1 3300050512 Unclassified 1653
300 nmdc:mga0n895_468970_c1 3300050512 Bacteria 1270
301 nmdc:mga0n895_544072_c1 3300050512 Bacteria 1167
302 nmdc:mga0rr50_14467_c1 3300050513 Bacteria 5178
303 nmdc:mga0rr50_167123_c1 3300050513 Bacteria 1789
304 nmdc:mga0rr50_325382_c1 3300050513 Unclassified 1289
305 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
306 nmdc:mga0rr50_91460_c1 3300050513 Bacteria 2370
307 nmdc:mga08x19_13879_c1 3300050514 Bacteria 4879
308 nmdc:mga08x19_29429_c1 3300050514 Bacteria 3445
309 nmdc:mga08x19_71909_c1 3300050514 Bacteria 2256
310 nmdc:mga08x19_76035_c1 3300050514 Bacteria 2197
311 nmdc:mga0a205_10945_c1 3300050515 Bacteria 8346
312 nmdc:mga0a205_254828_c1 3300050515 Bacteria 1634
313 nmdc:mga0a205_52283_c1 3300050515 Bacteria 3943
314 nmdc:mga0a205_66843_c1 3300050515 Bacteria 3473
315 Ga0500641_0078133 3300053096 Bacteria 1401
316 Ga0500555_000142 3300053103 Bacteria 34036
317 Ga0500616_0001056 3300053153 Bacteria 29045
318 Ga0500645_000187 3300053730 Bacteria 48109
319 Ga0590071_000006 3300059421 Bacteria 60899
320 Ga0590071_004238 3300059421 Bacteria 3492
321 Ga0590074_008816 3300059423 Unclassified 1679
322 Ga0590075_000425 3300059424 Bacteria 11435
323 Ga0590075_005082 3300059424 Unclassified 3111
324 Ga0590077_001710 3300059426 Bacteria 4983
325 Ga0590077_002952 3300059426 Unclassified 3564
326 Ga0590077_003625 3300059426 Bacteria 3191
327 Ga0590077_027144 3300059426 Bacteria 1239
328 Ga0501082_0277922 3300060353 Unclassified 1458
329 Ga0501036_0100758
330 Ga0070676_10049694
331 Ga0070683_100246008
332 Ga0070690_100033266
333 Ga0070670_100336813
334 Ga0068869_100095689
335 Ga0068869_100237455
336 Ga0070691_10002990
337 Ga0070669_100003804
338 Ga0070669_100310193
339 Ga0070675_100001924
340 Ga0070675_100055329
341 Ga0070675_100075903
342 Ga0070671_100028647
343 Ga0070671_100033112
344 Ga0070674_100095519
345 Ga0070673_100024450
346 Ga0070673_100096125
347 Ga0070688_100128398
348 Ga0070667_100107216
349 Ga0070700_100015097
350 Ga0070694_100060499
351 Ga0070694_100217590
352 Ga0070708_100011253
353 Ga0070678_100046428
354 Ga0070678_100062730
355 Ga0070662_100270940
356 Ga0070681_10093723
357 Ga0070681_10395897
358 Ga0068867_100027402
359 Ga0068867_100236952
360 Ga0070698_100177079
361 Ga0070698_100230530
362 Ga0070698_100541836
363 Ga0070699_100016898
364 Ga0070699_100118130
365 Ga0070679_100037388
366 Ga0070697_100024013
367 Ga0070672_100021896
368 Ga0070686_100044177
369 Ga0070695_100000404
370 Ga0070695_100008545
371 Ga0070696_100065557
372 Ga0070665_100009389
373 Ga0070704_100014971
374 Ga0070664_100022254
375 Ga0070664_100503259
376 Ga0068857_100064804
377 Ga0070702_100010521
378 Ga0070702_100085633
379 Ga0068859_100053194
380 Ga0068859_100229314
381 Ga0068859_100608484
382 Ga0068859_100743619
383 Ga0068864_100263503
384 Ga0068864_100293813
385 Ga0068861_100005916
386 Ga0068861_100053719
387 Ga0068863_100004188
388 Ga0068863_100098961
389 Ga0068858_100002099
390 Ga0068858_100098238
391 Ga0068860_100132410
392 Ga0068860_100265880
393 Ga0068860_100446481
394 Ga0068862_100126086
395 Ga0068862_100189409
396 Ga0068862_100651590
397 Ga0081539_10008803
398 Ga0075368_10030930
399 Ga0075364_10039966
400 Ga0075367_10016848
401 Ga0075367_10152933
402 Ga0075366_10018209
403 Ga0075366_10024001
404 Ga0075366_10088641
405 Ga0097621_100014070
406 Ga0075370_10086906
407 Ga0068871_100061231
408 Ga0068871_100134944
409 Ga0068871_100220962
410 Ga0068871_100287490
411 Ga0075431_100032713
412 Ga0075433_10013493
413 Ga0075433_10045101
414 Ga0075433_10058079
415 Ga0075434_100001454
416 Ga0075434_100039128
417 Ga0075434_100243303
418 Ga0068865_100017109
419 Ga0075436_100020186
420 Ga0075436_100105039
421 Ga0097620_100053193
422 Ga0097620_100229296
423 Ga0097620_100608441
424 Ga0097620_100743474
425 Ga0075435_100000371
426 Ga0075435_100024542
427 Ga0075435_100033085
428 Ga0105251_10114365
429 Ga0105240_10518715
430 Ga0111539_10003630
431 Ga0111539_10006955
432 Ga0111539_10007874
433 Ga0111539_10703504
434 Ga0105247_10064809
435 Ga0114129_10000380
436 Ga0114129_10004040
437 Ga0114129_10038778
438 Ga0114129_10043979
439 Ga0114129_10081222
440 Ga0114129_10091319
441 Ga0114129_10220098
442 Ga0114129_10417107
443 Ga0105243_10018114
444 Ga0105243_10029866
445 Ga0105242_10039707
446 Ga0105242_10070042
447 Ga0105242_10315723
448 Ga0105242_10341775
449 Ga0105242_10405414
450 Ga0105248_10014609
451 Ga0105248_10015631
452 Ga0105248_10042577
453 Ga0105248_10089536
454 Ga0105248_10204723
455 Ga0105248_10356811
456 Ga0105248_10782086
457 Ga0105249_10112145
458 Ga0157378_10036694
459 Ga0157378_10572403
460 Ga0157375_10434383
461 Ga0163163_10103522
462 Ga0163163_10106359
463 Ga0163163_10328851
464 Ga0157380_10021189
465 Ga0157377_10033121
466 Ga0157379_10030737
467 Ga0157376_10025306
468 Ga0157376_10094838
469 Ga0157376_10339079
470 Ga0207642_10037743
471 Ga0207642_10075142
472 Ga0207642_10121650
473 Ga0207645_10001127
474 Ga0207645_10076415
475 Ga0207684_10187412
476 Ga0207707_10074554
477 Ga0207681_10139170
478 Ga0207681_10221693
479 Ga0207681_10222247
480 Ga0207650_10014683
481 Ga0207659_10000233
482 Ga0207706_10029324
483 Ga0207706_10204167
484 Ga0207706_10249005
485 Ga0207706_10338542
486 Ga0207686_10081252
487 Ga0207686_10166252
488 Ga0207709_10012892
489 Ga0207669_10040960
490 Ga0207704_10093138
491 Ga0207665_10224011
492 Ga0207691_10366832
493 Ga0207711_10109704
494 Ga0207711_10222905
495 Ga0207689_10287138
496 Ga0207679_10029987
497 Ga0207679_10407017
498 Ga0207667_10443393
499 Ga0207651_10109055
500 Ga0207651_10376934
501 Ga0207658_10162095
502 Ga0207658_10536339
503 Ga0207703_10018573
504 Ga0207703_10415600
505 Ga0207703_10601285
506 Ga0207678_10099018
507 Ga0207708_10004025
508 Ga0207708_10353052
509 Ga0207641_10047886
510 Ga0207641_10113443
511 Ga0207641_10140269
512 Ga0207641_10232625
513 Ga0207648_10161123
514 Ga0207674_10020679
515 Ga0207674_10436446
516 Ga0207675_100006201
517 Ga0207675_100023416
518 Ga0207675_100156273
519 Ga0207675_100197791
520 Ga0207683_10016025
521 Ga0207683_10029269
522 Ga0207683_10037148
523 Ga0207683_10146069
524 Ga0207428_10012715
525 Ga0207428_10025315
526 Ga0207428_10025450
527 Ga0207428_10332442
528 Ga0268266_10068759
529 Ga0268266_10291646
530 Ga0268265_10142647
531 Ga0268265_10357203
532 Ga0268265_10627651
533 Ga0268264_10679108
534 Ga0307405_10012071
535 Ga0307405_10158491
536 Ga0307413_10004561
537 Ga0307410_10004146
538 Ga0307410_10098863
539 Ga0307406_10057492
540 Ga0307407_10000298
541 Ga0307407_10018371
542 Ga0307409_100006590
543 Ga0307409_100039424
544 Ga0307409_100217290
545 Ga0307416_100002420
546 Ga0307416_100014629
547 Ga0307416_100044386
548 Ga0307416_100231843
549 Ga0307414_10005321
550 Ga0307411_10053104
551 Ga0373930_0009504
552 Ga0373948_0005715
553 Ga0373950_0013047
554 Ga0373938_0000994
555 Ga0373928_0000906
556 Ga0373951_0005034
557 Ga0373932_0004019
558 Ga0373941_0002252
559 Ga0373953_0058129
560 Ga0373960_0016486
561 Ga0373943_0205921
562 Ga0373942_0001299
563 Ga0373961_0002578
564 Ga0373961_0017420
565 Ga0373962_0024264
566 Ga0373962_0026396
567 Ga0373937_0183365
568 Ga0439433_0036148
569 Ga0439462_0063162
570 Ga0450908_001488
571 Ga0439435_0000441
572 Ga0451577_0068627
573 Ga0466963_0116539
574 Ga0453684_0246461
575 Ga0451576_0109949
576 Ga0451576_0173611
577 Ga0466967_0151464
578 Ga0495640_0157577
579 Ga0495633_0029640
580 Ga0496101_0012101
581 Ga0496101_0230160
582 Ga0496101_0298415
583 Ga0496102_0157753
584 Ga0496104_0121849
585 Ga0496104_0298072
586 Ga0496104_0399646
587 Ga0496106_0227494
588 Ga0496109_0030143
589 Ga0496112_0011161
590 Ga0496112_0516710
591 Ga0496114_0009246
592 Ga0496114_0186343
593 Ga0501041_0024031
594 Ga0501042_0160545
595 Ga0501046_0051859
596 Ga0501071_0011458
597 Ga0501072_0011914
598 Ga0501072_0168678
599 Ga0501075_0066345
600 Ga0501076_0007261
601 Ga0501045_0025449
602 nmdc:mga00v17_184329_c1
603 nmdc:mga00v17_88916_c1
604 nmdc:mga0k408_185257_c1
605 nmdc:mga0k408_2244_c1
606 nmdc:mga0k408_39142_c1
607 nmdc:mga06z11_104645_c1
608 nmdc:mga06z11_170480_c1
609 nmdc:mga06z11_48026_c1
610 nmdc:mga07m45_115359_c1
611 nmdc:mga07m45_162691_c1
612 nmdc:mga05p37_11199_c1
613 nmdc:mga05p37_1623_c1
614 nmdc:mga05p37_28795_c1
615 nmdc:mga05p37_30267_c1
616 nmdc:mga05p37_32758_c1
617 nmdc:mga05p37_40478_c1
618 nmdc:mga05p37_7348_c1
619 nmdc:mga05p37_88565_c1
620 nmdc:mga06r32_44261_c1
621 nmdc:mga08y16_35838_c1
622 nmdc:mga08y16_7487_c1
623 nmdc:mga0n895_155761_c1
624 nmdc:mga0n895_179572_c1
625 nmdc:mga0n895_181_c1
626 nmdc:mga0n895_278140_c1
627 nmdc:mga0n895_292046_c1
628 nmdc:mga0n895_468970_c1
629 nmdc:mga0n895_544072_c1
630 nmdc:mga0rr50_14467_c1
631 nmdc:mga0rr50_167123_c1
632 nmdc:mga0rr50_325382_c1
633 nmdc:mga0rr50_6_c1
634 nmdc:mga0rr50_91460_c1
635 nmdc:mga08x19_13879_c1
636 nmdc:mga08x19_29429_c1
637 nmdc:mga08x19_71909_c1
638 nmdc:mga08x19_76035_c1
639 nmdc:mga0a205_10945_c1
640 nmdc:mga0a205_254828_c1
641 nmdc:mga0a205_52283_c1
642 nmdc:mga0a205_66843_c1
643 Ga0500641_0078133
644 Ga0500555_000142
645 Ga0500616_0001056
646 Ga0500645_000187
647 Ga0590071_000006
648 Ga0590071_004238
649 Ga0590074_008816
650 Ga0590075_000425
651 Ga0590075_005082
652 Ga0590077_001710
653 Ga0590077_002952
654 Ga0590077_003625
655 Ga0590077_027144
656 Ga0501082_0277922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

116

0.89

PF05368

NmrA

NmrA-like family

28

111

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

32

199

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.8059 2 281
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.8024 2 281
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.8016 1 276
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.8012 19 283
6s5o-assembly2.cif.gz_F-2 non-square conformations of ktra e125q mutant rings with bound adp 0.7949 1 89
ID Description Score Start End Superfamily
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8499 1 241 3.40.50.720
af_Q4D157_188_344_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8489 108 225 3.40.50.720
af_Q4CYE7_260_443_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8365 99 257 3.40.50.720
af_Q54KV1_1_298_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.835 1 277 3.40.50.720
af_Q4DI30_3_123_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8344 128 211 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8AE39-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9993 114 280 GO:0004029
GO:0005737
AF-A0A2V8AE39-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9759 114 280 GO:0004029
GO:0005737
AF-A0A1F2TRA7-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9637 1 282 GO:0004029
GO:0005737
AF-A0A7W1P9A1-F1-model_v4 NAD-dependent epimerase 0.9618 62 285 GO:0004029
GO:0005737
AF-A0A3N5Y7J4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9616 1 279 GO:0004029
GO:0005737

Map