F409421

General Info

Members Datasets Scaffolds Average Seq Length
328 193 656 282

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0021217|Ga0501032_0021217_2042_2896
Length 263
Sequence MLARLRTYASFVRVSHSVFALPFALAGALLSSRLVPLTWLRAGWIVACMVTARSAAMGFNRLVDASYDARNPRTAMRELPRGAMSRGEAIGFVAVASAAFVFCASRLGPVCFALSPVALAIVFWYSLAKRVTSYTQLFLGLAMAVAPVGGWIAAGGPPRPEPWVLGLAIGTWVAGFDVLYACQDLEFDRRERLRSIPVRFGVVRSLWISRGLHVIAALVAALLVYEQSLVRADDLSQVKRAFDLNGWVGLLYLAATAMDVWLT

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0021217 3300049569 Bacteria 4517
2 Ga0065715_10172453 3300005293 Bacteria 1536
3 Ga0070676_10025743 3300005328 Bacteria 3328
4 Ga0070683_100185620 3300005329 Bacteria 1974
5 Ga0070690_100092412 3300005330 Bacteria 1995
6 Ga0070690_100111948 3300005330 Bacteria 1823
7 Ga0070670_100365826 3300005331 Unclassified 1269
8 Ga0068869_100064275 3300005334 Bacteria 2699
9 Ga0070666_10045661 3300005335 Bacteria 2937
10 Ga0070660_100048850 3300005339 Bacteria 3250
11 Ga0070689_100021551 3300005340 Bacteria 4800
12 Ga0070691_10000205 3300005341 Bacteria 19816
13 Ga0070668_100130898 3300005347 Unclassified 2014
14 Ga0070669_100006383 3300005353 Bacteria 8492
15 Ga0070669_100037570 3300005353 Bacteria 3513
16 Ga0070674_100008928 3300005356 Bacteria 5987
17 Ga0070688_100110840 3300005365 Bacteria 1825
18 Ga0070701_10193993 3300005438 Bacteria 1197
19 Ga0070700_100017254 3300005441 Bacteria 4124
20 Ga0070694_100010273 3300005444 Bacteria 5768
21 Ga0070694_100314186 3300005444 Bacteria 1204
22 Ga0070678_100085870 3300005456 Bacteria 2399
23 Ga0070681_10103104 3300005458 Unclassified 2797
24 Ga0068867_100021865 3300005459 Bacteria 4567
25 Ga0068867_100081154 3300005459 Bacteria 2444
26 Ga0068867_100436404 3300005459 Bacteria 1113
27 Ga0070685_10069126 3300005466 Bacteria 2088
28 Ga0070706_100317957 3300005467 Unclassified 1452
29 Ga0070707_100079102 3300005468 Bacteria 3173
30 Ga0070707_100093211 3300005468 Bacteria 2916
31 Ga0070698_100140245 3300005471 Bacteria 2369
32 Ga0070699_100070015 3300005518 Bacteria 3049
33 Ga0070699_100130944 3300005518 Bacteria 2211
34 Ga0070699_100220061 3300005518 Bacteria 1692
35 Ga0070679_100024711 3300005530 Bacteria 5888
36 Ga0070684_100020841 3300005535 Bacteria 5440
37 Ga0070672_100106147 3300005543 Bacteria 2284
38 Ga0070686_100186162 3300005544 Bacteria 1479
39 Ga0070695_100061712 3300005545 Bacteria 2432
40 Ga0070695_100082861 3300005545 Unclassified 2124
41 Ga0070696_100020430 3300005546 Bacteria 4489
42 Ga0070696_100024142 3300005546 Bacteria 4132
43 Ga0070665_100001511 3300005548 Bacteria 27024
44 Ga0070665_100003106 3300005548 Bacteria 17884
45 Ga0070665_100070519 3300005548 Bacteria 3502
46 Ga0070665_100097496 3300005548 Bacteria 2945
47 Ga0068855_100023926 3300005563 Bacteria 7315
48 Ga0068854_100047459 3300005578 Bacteria 3061
49 Ga0068854_100336301 3300005578 Bacteria 1232
50 Ga0068856_100014941 3300005614 Bacteria 7498
51 Ga0070702_100006773 3300005615 Bacteria 5447
52 Ga0068859_100128380 3300005617 Bacteria 2606
53 Ga0068859_100198295 3300005617 Bacteria 2092
54 Ga0068859_100214118 3300005617 Bacteria 2014
55 Ga0068859_100396378 3300005617 Bacteria 1476
56 Ga0068864_100019648 3300005618 Bacteria 5650
57 Ga0068864_100077381 3300005618 Bacteria 2909
58 Ga0068866_10014486 3300005718 Bacteria 3484
59 Ga0068866_10051218 3300005718 Bacteria 2100
60 Ga0068861_100004810 3300005719 Bacteria 9079
61 Ga0068861_100292302 3300005719 Bacteria 1407
62 Ga0068870_10065326 3300005840 Bacteria 1968
63 Ga0068863_100009990 3300005841 Bacteria 9240
64 Ga0068858_100002245 3300005842 Bacteria 19525
65 Ga0068858_100003783 3300005842 Bacteria 14961
66 Ga0068858_100242356 3300005842 Bacteria 1711
67 Ga0068858_100369204 3300005842 Bacteria 1376
68 Ga0068860_100014536 3300005843 Bacteria 7702
69 Ga0068860_100629214 3300005843 Bacteria 1080
70 Ga0081539_10014209 3300005985 Bacteria 5911
71 Ga0097621_100026607 3300006237 Bacteria 4540
72 Ga0068871_100006536 3300006358 Bacteria 8258
73 Ga0075428_100088763 3300006844 Bacteria 3372
74 Ga0075433_10176594 3300006852 Bacteria 1901
75 Ga0075433_10438148 3300006852 Unclassified 1152
76 Ga0075433_10526981 3300006852 Bacteria 1039
77 Ga0075434_100011037 3300006871 Bacteria 8499
78 Ga0068865_100005679 3300006881 Bacteria 7578
79 Ga0075436_100007129 3300006914 Bacteria 7650
80 Ga0075436_100008464 3300006914 Bacteria 7033
81 Ga0075436_100046494 3300006914 Bacteria 2993
82 Ga0075436_100183394 3300006914 Bacteria 1480
83 Ga0097620_100198302 3300006931 Bacteria 2092
84 Ga0097620_100214109 3300006931 Bacteria 2014
85 Ga0097620_100396374 3300006931 Bacteria 1476
86 Ga0075435_100000213 3300007076 Bacteria 35518
87 Ga0075435_100000297 3300007076 Bacteria 30737
88 Ga0075435_100000827 3300007076 Bacteria 19283
89 Ga0075435_100012707 3300007076 Bacteria 6237
90 Ga0075435_100046860 3300007076 Bacteria 3469
91 Ga0075435_100221739 3300007076 Bacteria 1606
92 Ga0075435_100340769 3300007076 Unclassified 1284
93 Ga0111539_10044979 3300009094 Bacteria 5286
94 Ga0111539_10259079 3300009094 Bacteria 2025
95 Ga0105245_10334531 3300009098 Bacteria 1496
96 Ga0114129_10002788 3300009147 Bacteria 24360
97 Ga0114129_10004180 3300009147 Bacteria 20396
98 Ga0114129_10027315 3300009147 Bacteria 8081
99 Ga0114129_10038108 3300009147 Bacteria 6783
100 Ga0114129_10044612 3300009147 Bacteria 6236
101 Ga0114129_10123072 3300009147 Bacteria 3568
102 Ga0114129_10294556 3300009147 Bacteria 2164
103 Ga0114129_10520602 3300009147 Bacteria 1551
104 Ga0105243_10017800 3300009148 Bacteria 5376
105 Ga0105243_10075791 3300009148 Bacteria 2731
106 Ga0105243_10097580 3300009148 Bacteria 2432
107 Ga0105243_10698552 3300009148 Bacteria 988
108 Ga0105241_10068790 3300009174 Bacteria 2744
109 Ga0105242_10011789 3300009176 Bacteria 6728
110 Ga0105242_10035951 3300009176 Bacteria 3972
111 Ga0105242_10151936 3300009176 Bacteria 2020
112 Ga0105248_10003314 3300009177 Bacteria 17875
113 Ga0105248_10010492 3300009177 Bacteria 10204
114 Ga0105248_10042926 3300009177 Bacteria 5070
115 Ga0105248_10060438 3300009177 Bacteria 4254
116 Ga0105249_10145201 3300009553 Bacteria 2279
117 Ga0105246_10030539 3300011119 Bacteria 3560
118 Ga0157374_10015227 3300013296 Bacteria 6744
119 Ga0157378_10147409 3300013297 Bacteria 2190
120 Ga0163162_10039132 3300013306 Bacteria 4737
121 Ga0163162_10178050 3300013306 Bacteria 2252
122 Ga0163162_10982006 3300013306 Bacteria 954
123 Ga0157375_10577007 3300013308 Bacteria 1285
124 Ga0157375_10730774 3300013308 Bacteria 1142
125 Ga0157375_10734524 3300013308 Bacteria 1139
126 Ga0157380_10234336 3300014326 Bacteria 1651
127 Ga0157379_10005030 3300014968 Bacteria 11340
128 Ga0157379_10320580 3300014968 Bacteria 1415
129 Ga0157379_10473205 3300014968 Bacteria 1159
130 Ga0157376_10213904 3300014969 Bacteria 1781
131 Ga0157376_10321207 3300014969 Bacteria 1472
132 Ga0182005_1017643 3300015265 Bacteria 1975
133 Ga0207697_10026814 3300025315 Bacteria 2357
134 Ga0207697_10094016 3300025315 Unclassified 1272
135 Ga0207697_10097492 3300025315 Bacteria 1251
136 Ga0207682_10142705 3300025893 Bacteria 1075
137 Ga0207642_10046132 3300025899 Bacteria 1939
138 Ga0207688_10095593 3300025901 Bacteria 1710
139 Ga0207680_10009146 3300025903 Bacteria 4899
140 Ga0207680_10154273 3300025903 Bacteria 1534
141 Ga0207645_10039788 3300025907 Bacteria 3012
142 Ga0207643_10078081 3300025908 Bacteria 1915
143 Ga0207684_10163052 3300025910 Unclassified 1920
144 Ga0207707_10039997 3300025912 Bacteria 4097
145 Ga0207657_10011587 3300025919 Bacteria 8746
146 Ga0207657_10155315 3300025919 Bacteria 1861
147 Ga0207652_10199679 3300025921 Bacteria 1800
148 Ga0207652_10210268 3300025921 Unclassified 1752
149 Ga0207652_10347718 3300025921 Bacteria 1338
150 Ga0207646_10074704 3300025922 Bacteria 3028
151 Ga0207646_10153211 3300025922 Bacteria 2079
152 Ga0207681_10013051 3300025923 Bacteria 5136
153 Ga0207681_10376043 3300025923 Bacteria 1143
154 Ga0207681_10401681 3300025923 Bacteria 1107
155 Ga0207694_10249072 3300025924 Bacteria 1453
156 Ga0207687_10013508 3300025927 Bacteria 5332
157 Ga0207687_10335939 3300025927 Bacteria 1227
158 Ga0207644_10095968 3300025931 Bacteria 2218
159 Ga0207690_10185255 3300025932 Unclassified 1570
160 Ga0207706_10387453 3300025933 Bacteria 1212
161 Ga0207686_10022777 3300025934 Bacteria 3610
162 Ga0207686_10168954 3300025934 Bacteria 1540
163 Ga0207686_10375539 3300025934 Bacteria 1077
164 Ga0207670_10024252 3300025936 Bacteria 3789
165 Ga0207670_10104763 3300025936 Bacteria 2027
166 Ga0207669_10130918 3300025937 Bacteria 1724
167 Ga0207704_10009863 3300025938 Bacteria 4628
168 Ga0207691_10065847 3300025940 Bacteria 3278
169 Ga0207711_10029567 3300025941 Bacteria 4624
170 Ga0207711_10054049 3300025941 Bacteria 3444
171 Ga0207711_10099909 3300025941 Bacteria 2566
172 Ga0207711_10381604 3300025941 Bacteria 1308
173 Ga0207661_10308923 3300025944 Bacteria 1419
174 Ga0207651_10549684 3300025960 Bacteria 1004
175 Ga0207668_10096842 3300025972 Bacteria 2182
176 Ga0207640_10501764 3300025981 Bacteria 1011
177 Ga0207658_10132205 3300025986 Bacteria 2007
178 Ga0207677_10312326 3300026023 Bacteria 1303
179 Ga0207703_10011640 3300026035 Bacteria 6841
180 Ga0207703_10018091 3300026035 Bacteria 5504
181 Ga0207703_10018232 3300026035 Bacteria 5482
182 Ga0207703_10053128 3300026035 Bacteria 3293
183 Ga0207703_10062082 3300026035 Bacteria 3061
184 Ga0207703_10231614 3300026035 Bacteria 1656
185 Ga0207703_10547265 3300026035 Bacteria 1091
186 Ga0207708_10002632 3300026075 Bacteria 13204
187 Ga0207708_10040677 3300026075 Bacteria 3544
188 Ga0207702_10032798 3300026078 Bacteria 4334
189 Ga0207641_10014455 3300026088 Bacteria 6466
190 Ga0207648_10003352 3300026089 Bacteria 16838
191 Ga0207648_10030023 3300026089 Bacteria 4820
192 Ga0207648_10033668 3300026089 Bacteria 4519
193 Ga0207648_10151974 3300026089 Bacteria 2043
194 Ga0207676_10016740 3300026095 Bacteria 5307
195 Ga0207676_10066823 3300026095 Bacteria 2869
196 Ga0207676_10228414 3300026095 Bacteria 1662
197 Ga0207675_100002221 3300026118 Bacteria 19290
198 Ga0207675_100623468 3300026118 Bacteria 1083
199 Ga0207683_10251506 3300026121 Bacteria 1613
200 Ga0268266_10011481 3300028379 Bacteria 7694
201 Ga0268266_10015827 3300028379 Bacteria 6458
202 Ga0268266_10342455 3300028379 Bacteria 1404
203 Ga0268265_10004027 3300028380 Bacteria 10350
204 Ga0268264_10097489 3300028381 Bacteria 2548
205 Ga0268264_10226532 3300028381 Bacteria 1724
206 Ga0268264_10279902 3300028381 Bacteria 1562
207 Ga0268264_10357150 3300028381 Bacteria 1393
208 Ga0265318_10079406 3300028577 Bacteria 1212
209 Ga0265332_10100321 3300031238 Bacteria 1222
210 Ga0307416_100009707 3300032002 Bacteria 6319
211 Ga0373930_0006718 3300034816 Bacteria 1956
212 Ga0373948_0001093 3300034817 Bacteria 3666
213 Ga0373958_0000875 3300034819 Bacteria 3876
214 Ga0373938_0014746 3300034957 Bacteria 1504
215 Ga0373928_0005185 3300035084 Bacteria 2486
216 Ga0373929_0000765 3300035085 Bacteria 6259
217 Ga0373940_0001778 3300035088 Bacteria 4011
218 Ga0373949_0005372 3300035090 Bacteria 2859
219 Ga0373951_0000250 3300035091 Bacteria 17855
220 Ga0373952_0000930 3300035092 Bacteria 5320
221 Ga0373932_0001640 3300035112 Bacteria 6136
222 Ga0373939_0000330 3300035114 Bacteria 12172
223 Ga0373941_0004661 3300035115 Bacteria 3180
224 Ga0373957_0072182 3300035120 Bacteria 1352
225 Ga0373960_0000553 3300035121 Bacteria 7559
226 Ga0373943_0063154 3300035170 Bacteria 1856
227 Ga0373942_0000461 3300035207 Bacteria 11493
228 Ga0373961_0002363 3300035241 Bacteria 4923
229 Ga0373962_0002576 3300035242 Bacteria 4306
230 Ga0373931_0029932 3300035691 Bacteria 2799
231 Ga0373931_0150338 3300035691 Bacteria 1357
232 Ga0373933_0103879 3300035724 Bacteria 1766
233 Ga0373947_0256903 3300035725 Bacteria 1157
234 Ga0373937_0188393 3300036401 Bacteria 1938
235 Ga0451577_0039555 3300042876 Bacteria 4238
236 Ga0451577_0233463 3300042876 Bacteria 1664
237 Ga0453684_0007700 3300044712 Bacteria 19687
238 Ga0451576_0209401 3300045051 Bacteria 2036
239 Ga0495603_0070832 3300046455 Bacteria 2049
240 Ga0495582_0201346 3300046473 Bacteria 1137
241 Ga0495586_0096563 3300046535 Bacteria 1637
242 Ga0495647_0064693 3300046681 Bacteria 1451
243 Ga0495600_0056881 3300046809 Bacteria 2556
244 Ga0495604_0261143 3300047317 Bacteria 1177
245 Ga0495674_0099006 3300047319 Bacteria 2483
246 Ga0496104_0002606 3300048907 Bacteria 15527
247 Ga0496104_0191049 3300048907 Bacteria 1959
248 Ga0496104_0427928 3300048907 Bacteria 1236
249 Ga0496105_0078946 3300048908 Bacteria 2718
250 Ga0496106_0140118 3300048909 Bacteria 1902
251 Ga0496109_0381143 3300048912 Bacteria 1332
252 Ga0496112_0029041 3300048915 Bacteria 5346
253 Ga0496112_0284949 3300048915 Bacteria 1598
254 Ga0496113_0024136 3300048916 Bacteria 4318
255 Ga0496114_0179102 3300048917 Bacteria 1850
256 Ga0501031_0061227 3300049568 Bacteria 2453
257 Ga0501032_0010564 3300049569 Bacteria 6657
258 Ga0501033_0235954 3300049570 Bacteria 1298
259 Ga0501034_0002089 3300049571 Bacteria 24951
260 Ga0501034_0015356 3300049571 Bacteria 7870
261 Ga0501036_0028381 3300049572 Bacteria 4729
262 Ga0501037_0047544 3300049573 Bacteria 3144
263 Ga0501038_0016707 3300049574 Bacteria 6648
264 Ga0501038_0020934 3300049574 Bacteria 5877
265 Ga0501039_0040392 3300049575 Bacteria 3601
266 Ga0501041_0284263 3300049577 Bacteria 1041
267 Ga0501042_0097694 3300049578 Bacteria 2111
268 Ga0501043_0068352 3300049579 Bacteria 2789
269 Ga0501046_0023961 3300049580 Bacteria 5012
270 Ga0501046_0048535 3300049580 Bacteria 3361
271 Ga0501047_0043918 3300049581 Bacteria 4317
272 Ga0501047_0071252 3300049581 Bacteria 3345
273 Ga0501047_0091044 3300049581 Bacteria 2927
274 Ga0501048_0043283 3300049582 Bacteria 3224
275 Ga0501067_0011945 3300049583 Bacteria 4810
276 Ga0501068_0016295 3300049584 Bacteria 4283
277 Ga0501069_0013156 3300049585 Bacteria 4409
278 Ga0501071_0005952 3300049587 Bacteria 7893
279 Ga0501072_0018177 3300049588 Bacteria 5408
280 Ga0501072_0049760 3300049588 Bacteria 3299
281 Ga0501073_0054999 3300049589 Bacteria 2785
282 Ga0501075_0052021 3300049591 Bacteria 3080
283 Ga0501077_0042920 3300049593 Bacteria 2874
284 Ga0501079_0214147 3300049741 Unclassified 1505
285 Ga0501080_0001055 3300049742 Bacteria 22666
286 Ga0501080_0017108 3300049742 Bacteria 6697
287 Ga0501083_0038054 3300049744 Bacteria 3271
288 Ga0501044_0015396 3300049823 Bacteria 8237
289 Ga0501044_0089669 3300049823 Bacteria 3103
290 Ga0501045_0013268 3300049824 Bacteria 5816
291 nmdc:mga05p37_2308_c1 3300050507 Bacteria 22237
292 nmdc:mga05p37_28047_c1 3300050507 Bacteria 6861
293 nmdc:mga05p37_422415_c1 3300050507 Bacteria 1551
294 nmdc:mga05p37_43448_c1 3300050507 Bacteria 5529
295 nmdc:mga05p37_712710_c1 3300050507 Bacteria 1113
296 nmdc:mga05p37_717354_c1 3300050507 Unclassified 1108
297 nmdc:mga09592_99095_c1 3300050508 Bacteria 2495
298 nmdc:mga08y16_245097_c1 3300050511 Bacteria 1852
299 nmdc:mga08y16_650861_c1 3300050511 Bacteria 1058
300 nmdc:mga08y16_73474_c1 3300050511 Bacteria 3564
301 nmdc:mga0n895_14801_c1 3300050512 Bacteria 7098
302 nmdc:mga0n895_171555_c1 3300050512 Bacteria 2201
303 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
304 nmdc:mga0n895_35741_c1 3300050512 Bacteria 4792
305 nmdc:mga0n895_370328_c1 3300050512 Bacteria 1450
306 nmdc:mga0n895_5460_c1 3300050512 Bacteria 10633
307 nmdc:mga0n895_636869_c1 3300050512 Bacteria 1066
308 nmdc:mga0rr50_10419_c1 3300050513 Bacteria 5897
309 nmdc:mga0rr50_1088_c1 3300050513 Bacteria 14763
310 nmdc:mga0rr50_15225_c1 3300050513 Bacteria 5072
311 nmdc:mga0rr50_177171_c1 3300050513 Bacteria 1741
312 nmdc:mga0rr50_283539_c1 3300050513 Bacteria 1383
313 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
314 nmdc:mga0rr50_356121_c1 3300050513 Bacteria 1231
315 nmdc:mga0rr50_72796_c1 3300050513 Bacteria 2626
316 nmdc:mga08x19_124252_c1 3300050514 Bacteria 1732
317 nmdc:mga08x19_16760_c1 3300050514 Bacteria 4474
318 nmdc:mga08x19_36544_c1 3300050514 Bacteria 1407
319 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
320 nmdc:mga0a205_191513_c1 3300050515 Bacteria 1937
321 nmdc:mga0a205_205321_c1 3300050515 Bacteria 1860
322 nmdc:mga0a205_271664_c1 3300050515 Bacteria 1572
323 nmdc:mga0a205_440126_c1 3300050515 Bacteria 1164
324 nmdc:mga0a205_516599_c1 3300050515 Bacteria 1051
325 Ga0495601_0092604 3300053077 Bacteria 1947
326 Ga0495619_0025709 3300053085 Bacteria 3783
327 Ga0501084_0090893 3300054114 Bacteria 2563
328 Ga0501082_0076792 3300060353 Bacteria 2879
329 Ga0501032_0021217
330 Ga0065715_10172453
331 Ga0070676_10025743
332 Ga0070683_100185620
333 Ga0070690_100092412
334 Ga0070690_100111948
335 Ga0070670_100365826
336 Ga0068869_100064275
337 Ga0070666_10045661
338 Ga0070660_100048850
339 Ga0070689_100021551
340 Ga0070691_10000205
341 Ga0070668_100130898
342 Ga0070669_100006383
343 Ga0070669_100037570
344 Ga0070674_100008928
345 Ga0070688_100110840
346 Ga0070701_10193993
347 Ga0070700_100017254
348 Ga0070694_100010273
349 Ga0070694_100314186
350 Ga0070678_100085870
351 Ga0070681_10103104
352 Ga0068867_100021865
353 Ga0068867_100081154
354 Ga0068867_100436404
355 Ga0070685_10069126
356 Ga0070706_100317957
357 Ga0070707_100079102
358 Ga0070707_100093211
359 Ga0070698_100140245
360 Ga0070699_100070015
361 Ga0070699_100130944
362 Ga0070699_100220061
363 Ga0070679_100024711
364 Ga0070684_100020841
365 Ga0070672_100106147
366 Ga0070686_100186162
367 Ga0070695_100061712
368 Ga0070695_100082861
369 Ga0070696_100020430
370 Ga0070696_100024142
371 Ga0070665_100001511
372 Ga0070665_100003106
373 Ga0070665_100070519
374 Ga0070665_100097496
375 Ga0068855_100023926
376 Ga0068854_100047459
377 Ga0068854_100336301
378 Ga0068856_100014941
379 Ga0070702_100006773
380 Ga0068859_100128380
381 Ga0068859_100198295
382 Ga0068859_100214118
383 Ga0068859_100396378
384 Ga0068864_100019648
385 Ga0068864_100077381
386 Ga0068866_10014486
387 Ga0068866_10051218
388 Ga0068861_100004810
389 Ga0068861_100292302
390 Ga0068870_10065326
391 Ga0068863_100009990
392 Ga0068858_100002245
393 Ga0068858_100003783
394 Ga0068858_100242356
395 Ga0068858_100369204
396 Ga0068860_100014536
397 Ga0068860_100629214
398 Ga0081539_10014209
399 Ga0097621_100026607
400 Ga0068871_100006536
401 Ga0075428_100088763
402 Ga0075433_10176594
403 Ga0075433_10438148
404 Ga0075433_10526981
405 Ga0075434_100011037
406 Ga0068865_100005679
407 Ga0075436_100007129
408 Ga0075436_100008464
409 Ga0075436_100046494
410 Ga0075436_100183394
411 Ga0097620_100198302
412 Ga0097620_100214109
413 Ga0097620_100396374
414 Ga0075435_100000213
415 Ga0075435_100000297
416 Ga0075435_100000827
417 Ga0075435_100012707
418 Ga0075435_100046860
419 Ga0075435_100221739
420 Ga0075435_100340769
421 Ga0111539_10044979
422 Ga0111539_10259079
423 Ga0105245_10334531
424 Ga0114129_10002788
425 Ga0114129_10004180
426 Ga0114129_10027315
427 Ga0114129_10038108
428 Ga0114129_10044612
429 Ga0114129_10123072
430 Ga0114129_10294556
431 Ga0114129_10520602
432 Ga0105243_10017800
433 Ga0105243_10075791
434 Ga0105243_10097580
435 Ga0105243_10698552
436 Ga0105241_10068790
437 Ga0105242_10011789
438 Ga0105242_10035951
439 Ga0105242_10151936
440 Ga0105248_10003314
441 Ga0105248_10010492
442 Ga0105248_10042926
443 Ga0105248_10060438
444 Ga0105249_10145201
445 Ga0105246_10030539
446 Ga0157374_10015227
447 Ga0157378_10147409
448 Ga0163162_10039132
449 Ga0163162_10178050
450 Ga0163162_10982006
451 Ga0157375_10577007
452 Ga0157375_10730774
453 Ga0157375_10734524
454 Ga0157380_10234336
455 Ga0157379_10005030
456 Ga0157379_10320580
457 Ga0157379_10473205
458 Ga0157376_10213904
459 Ga0157376_10321207
460 Ga0182005_1017643
461 Ga0207697_10026814
462 Ga0207697_10094016
463 Ga0207697_10097492
464 Ga0207682_10142705
465 Ga0207642_10046132
466 Ga0207688_10095593
467 Ga0207680_10009146
468 Ga0207680_10154273
469 Ga0207645_10039788
470 Ga0207643_10078081
471 Ga0207684_10163052
472 Ga0207707_10039997
473 Ga0207657_10011587
474 Ga0207657_10155315
475 Ga0207652_10199679
476 Ga0207652_10210268
477 Ga0207652_10347718
478 Ga0207646_10074704
479 Ga0207646_10153211
480 Ga0207681_10013051
481 Ga0207681_10376043
482 Ga0207681_10401681
483 Ga0207694_10249072
484 Ga0207687_10013508
485 Ga0207687_10335939
486 Ga0207644_10095968
487 Ga0207690_10185255
488 Ga0207706_10387453
489 Ga0207686_10022777
490 Ga0207686_10168954
491 Ga0207686_10375539
492 Ga0207670_10024252
493 Ga0207670_10104763
494 Ga0207669_10130918
495 Ga0207704_10009863
496 Ga0207691_10065847
497 Ga0207711_10029567
498 Ga0207711_10054049
499 Ga0207711_10099909
500 Ga0207711_10381604
501 Ga0207661_10308923
502 Ga0207651_10549684
503 Ga0207668_10096842
504 Ga0207640_10501764
505 Ga0207658_10132205
506 Ga0207677_10312326
507 Ga0207703_10011640
508 Ga0207703_10018091
509 Ga0207703_10018232
510 Ga0207703_10053128
511 Ga0207703_10062082
512 Ga0207703_10231614
513 Ga0207703_10547265
514 Ga0207708_10002632
515 Ga0207708_10040677
516 Ga0207702_10032798
517 Ga0207641_10014455
518 Ga0207648_10003352
519 Ga0207648_10030023
520 Ga0207648_10033668
521 Ga0207648_10151974
522 Ga0207676_10016740
523 Ga0207676_10066823
524 Ga0207676_10228414
525 Ga0207675_100002221
526 Ga0207675_100623468
527 Ga0207683_10251506
528 Ga0268266_10011481
529 Ga0268266_10015827
530 Ga0268266_10342455
531 Ga0268265_10004027
532 Ga0268264_10097489
533 Ga0268264_10226532
534 Ga0268264_10279902
535 Ga0268264_10357150
536 Ga0265318_10079406
537 Ga0265332_10100321
538 Ga0307416_100009707
539 Ga0373930_0006718
540 Ga0373948_0001093
541 Ga0373958_0000875
542 Ga0373938_0014746
543 Ga0373928_0005185
544 Ga0373929_0000765
545 Ga0373940_0001778
546 Ga0373949_0005372
547 Ga0373951_0000250
548 Ga0373952_0000930
549 Ga0373932_0001640
550 Ga0373939_0000330
551 Ga0373941_0004661
552 Ga0373957_0072182
553 Ga0373960_0000553
554 Ga0373943_0063154
555 Ga0373942_0000461
556 Ga0373961_0002363
557 Ga0373962_0002576
558 Ga0373931_0029932
559 Ga0373931_0150338
560 Ga0373933_0103879
561 Ga0373947_0256903
562 Ga0373937_0188393
563 Ga0451577_0039555
564 Ga0451577_0233463
565 Ga0453684_0007700
566 Ga0451576_0209401
567 Ga0495603_0070832
568 Ga0495582_0201346
569 Ga0495586_0096563
570 Ga0495647_0064693
571 Ga0495600_0056881
572 Ga0495604_0261143
573 Ga0495674_0099006
574 Ga0496104_0002606
575 Ga0496104_0191049
576 Ga0496104_0427928
577 Ga0496105_0078946
578 Ga0496106_0140118
579 Ga0496109_0381143
580 Ga0496112_0029041
581 Ga0496112_0284949
582 Ga0496113_0024136
583 Ga0496114_0179102
584 Ga0501031_0061227
585 Ga0501032_0010564
586 Ga0501033_0235954
587 Ga0501034_0002089
588 Ga0501034_0015356
589 Ga0501036_0028381
590 Ga0501037_0047544
591 Ga0501038_0016707
592 Ga0501038_0020934
593 Ga0501039_0040392
594 Ga0501041_0284263
595 Ga0501042_0097694
596 Ga0501043_0068352
597 Ga0501046_0023961
598 Ga0501046_0048535
599 Ga0501047_0043918
600 Ga0501047_0071252
601 Ga0501047_0091044
602 Ga0501048_0043283
603 Ga0501067_0011945
604 Ga0501068_0016295
605 Ga0501069_0013156
606 Ga0501071_0005952
607 Ga0501072_0018177
608 Ga0501072_0049760
609 Ga0501073_0054999
610 Ga0501075_0052021
611 Ga0501077_0042920
612 Ga0501079_0214147
613 Ga0501080_0001055
614 Ga0501080_0017108
615 Ga0501083_0038054
616 Ga0501044_0015396
617 Ga0501044_0089669
618 Ga0501045_0013268
619 nmdc:mga05p37_2308_c1
620 nmdc:mga05p37_28047_c1
621 nmdc:mga05p37_422415_c1
622 nmdc:mga05p37_43448_c1
623 nmdc:mga05p37_712710_c1
624 nmdc:mga05p37_717354_c1
625 nmdc:mga09592_99095_c1
626 nmdc:mga08y16_245097_c1
627 nmdc:mga08y16_650861_c1
628 nmdc:mga08y16_73474_c1
629 nmdc:mga0n895_14801_c1
630 nmdc:mga0n895_171555_c1
631 nmdc:mga0n895_173_c1
632 nmdc:mga0n895_35741_c1
633 nmdc:mga0n895_370328_c1
634 nmdc:mga0n895_5460_c1
635 nmdc:mga0n895_636869_c1
636 nmdc:mga0rr50_10419_c1
637 nmdc:mga0rr50_1088_c1
638 nmdc:mga0rr50_15225_c1
639 nmdc:mga0rr50_177171_c1
640 nmdc:mga0rr50_283539_c1
641 nmdc:mga0rr50_2_c1
642 nmdc:mga0rr50_356121_c1
643 nmdc:mga0rr50_72796_c1
644 nmdc:mga08x19_124252_c1
645 nmdc:mga08x19_16760_c1
646 nmdc:mga08x19_36544_c1
647 nmdc:mga08x19_452_c1
648 nmdc:mga0a205_191513_c1
649 nmdc:mga0a205_205321_c1
650 nmdc:mga0a205_271664_c1
651 nmdc:mga0a205_440126_c1
652 nmdc:mga0a205_516599_c1
653 Ga0495601_0092604
654 Ga0495619_0025709
655 Ga0501084_0090893
656 Ga0501082_0076792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

20

257

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9121 12 281
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8931 12 281
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7933 4 280
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7808 7 279
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.776 4 280
ID Description Score Start End Superfamily
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9266 13 157 1.10.357.140
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9253 163 282 1.20.120.1780
af_Q54U71_333_454_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9234 167 283 1.20.120.1780
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9169 12 153 1.10.357.140
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9147 23 173 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A7V8WEA2-F1-model_v4 UbiA family prenyltransferase 0.9893 92 284 GO:0005886
GO:0006744
GO:0016765
AF-A0A7C4U5G3-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9821 41 284 GO:0005886
GO:0006744
GO:0016765
AF-A0A3C0TJ02-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9811 44 281 GO:0005886
GO:0006744
GO:0016765
AF-A0A381Z278-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9806 61 284 GO:0005886
GO:0006744
GO:0016765
AF-A0A4Q5SHR0-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9797 22 284 GO:0005886
GO:0006744
GO:0016765

Map