F409400

General Info

Members Datasets Scaffolds Average Seq Length
328 197 656 88

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0616308|Ga0495680_0616308_329_640
Length 103
Sequence MVVPLNQLRTDGAFMSDAGEGLVDADARIQERMEELERERLQSRKKDSRDPEKVRALESLRLAKTELDRQRQATQHEGRRAQLTQAIDEVDRRMAEATAALSL

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 0.91
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 20.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0616308 3300047322 Bacteria 725
2 Ga0058863_11239450 3300004799 Bacteria 566
3 Ga0058861_12055662 3300004800 Bacteria 701
4 Ga0058862_12642877 3300004803 Bacteria 595
5 Ga0070658_10082690 3300005327 Bacteria 2639
6 Ga0070670_100035954 3300005331 Bacteria 4264
7 Ga0070670_100063401 3300005331 Bacteria 3172
8 Ga0070670_101955669 3300005331 Bacteria 540
9 Ga0070677_10034563 3300005333 Bacteria 1954
10 Ga0070677_10333396 3300005333 Unclassified 781
11 Ga0068869_101233880 3300005334 Bacteria 658
12 Ga0070666_10473671 3300005335 Bacteria 906
13 Ga0070660_100001206 3300005339 Bacteria 17544
14 Ga0070687_101025811 3300005343 Bacteria 599
15 Ga0070661_100651917 3300005344 Bacteria 855
16 Ga0070668_101323399 3300005347 Bacteria 655
17 Ga0070671_100321587 3300005355 Bacteria 1318
18 Ga0070671_101242599 3300005355 Unclassified 656
19 Ga0070673_101417398 3300005364 Bacteria 654
20 Ga0070688_101182172 3300005365 Bacteria 614
21 Ga0070659_100035423 3300005366 Bacteria 3886
22 Ga0070659_100151315 3300005366 Bacteria 1893
23 Ga0070711_100587215 3300005439 Bacteria 928
24 Ga0070705_100269366 3300005440 Bacteria 1205
25 Ga0070694_100002766 3300005444 Bacteria 10405
26 Ga0070663_100872004 3300005455 Bacteria 776
27 Ga0070663_101514646 3300005455 Bacteria 596
28 Ga0070678_100188358 3300005456 Bacteria 1694
29 Ga0070662_101693256 3300005457 Bacteria 546
30 Ga0070681_10024700 3300005458 Bacteria 6045
31 Ga0070681_10074214 3300005458 Bacteria 3362
32 Ga0070681_11342664 3300005458 Bacteria 638
33 Ga0068867_101299668 3300005459 Unclassified 671
34 Ga0070698_100780767 3300005471 Bacteria 899
35 Ga0070699_100290082 3300005518 Bacteria 1467
36 Ga0070699_101066806 3300005518 Bacteria 741
37 Ga0070679_100127333 3300005530 Bacteria 2528
38 Ga0070679_100183580 3300005530 Bacteria 2064
39 Ga0070679_100265632 3300005530 Bacteria 1671
40 Ga0070679_100722605 3300005530 Bacteria 939
41 Ga0070697_100965989 3300005536 Bacteria 757
42 Ga0070672_100147600 3300005543 Bacteria 1944
43 Ga0070672_100504352 3300005543 Bacteria 1047
44 Ga0070686_100101460 3300005544 Bacteria 1945
45 Ga0070695_100001565 3300005545 Bacteria 12769
46 Ga0070696_100105021 3300005546 Bacteria 2029
47 Ga0070704_100005607 3300005549 Bacteria 7328
48 Ga0070704_100385468 3300005549 Bacteria 1192
49 Ga0070704_100899758 3300005549 Bacteria 796
50 Ga0070704_101823582 3300005549 Bacteria 563
51 Ga0070704_102099081 3300005549 Unclassified 525
52 Ga0068855_100033510 3300005563 Bacteria 6129
53 Ga0068855_101674865 3300005563 Bacteria 649
54 Ga0068855_101741708 3300005563 Bacteria 634
55 Ga0070664_100425272 3300005564 Bacteria 1217
56 Ga0070664_100703891 3300005564 Bacteria 941
57 Ga0068857_100070662 3300005577 Bacteria 3110
58 Ga0068857_102247838 3300005577 Unclassified 535
59 Ga0068854_102145453 3300005578 Bacteria 516
60 Ga0068859_100003043 3300005617 Bacteria 17010
61 Ga0068859_101242092 3300005617 Unclassified 821
62 Ga0068864_100479087 3300005618 Bacteria 1194
63 Ga0068864_101549536 3300005618 Bacteria 666
64 Ga0068861_100673443 3300005719 Unclassified 958
65 Ga0068851_10414078 3300005834 Bacteria 795
66 Ga0068858_100100729 3300005842 Bacteria 2694
67 Ga0068860_100210039 3300005843 Bacteria 1888
68 Ga0068860_100632243 3300005843 Unclassified 1077
69 Ga0068862_100725282 3300005844 Bacteria 965
70 Ga0081455_10215420 3300005937 Bacteria 1428
71 Ga0081455_10958907 3300005937 Unclassified 530
72 Ga0075432_10306919 3300006058 Unclassified 660
73 Ga0070715_10418037 3300006163 Bacteria 749
74 Ga0070715_10891616 3300006163 Bacteria 547
75 Ga0070715_11041946 3300006163 Unclassified 512
76 Ga0070716_100964405 3300006173 Unclassified 672
77 Ga0070712_101738070 3300006175 Unclassified 546
78 Ga0075366_10263736 3300006195 Bacteria 1051
79 Ga0097621_100089286 3300006237 Bacteria 2577
80 Ga0068871_100126230 3300006358 Bacteria 2166
81 Ga0075430_101300148 3300006846 Unclassified 598
82 Ga0075431_100452219 3300006847 Bacteria 1280
83 Ga0075433_10072705 3300006852 Bacteria 3024
84 Ga0075433_10216080 3300006852 Bacteria 1703
85 Ga0075434_100033832 3300006871 Bacteria 5045
86 Ga0075434_100606917 3300006871 Bacteria 1113
87 Ga0075434_101617017 3300006871 Unclassified 656
88 Ga0075434_102637095 3300006871 Unclassified 503
89 Ga0075436_100013718 3300006914 Bacteria 5550
90 Ga0075436_100039117 3300006914 Bacteria 3272
91 Ga0075436_100164484 3300006914 Bacteria 1565
92 Ga0097620_100003043 3300006931 Bacteria 17010
93 Ga0097620_101241863 3300006931 Unclassified 821
94 Ga0075435_100009832 3300007076 Bacteria 6960
95 Ga0075435_100021149 3300007076 Bacteria 4998
96 Ga0105240_10743371 3300009093 Unclassified 1067
97 Ga0111539_10195710 3300009094 Unclassified 2358
98 Ga0111539_10275885 3300009094 Bacteria 1956
99 Ga0111539_10414125 3300009094 Bacteria 1570
100 Ga0111539_11511093 3300009094 Bacteria 779
101 Ga0114129_10023273 3300009147 Bacteria 8787
102 Ga0114129_10062916 3300009147 Bacteria 5183
103 Ga0114129_10871272 3300009147 Bacteria 1143
104 Ga0114129_12175657 3300009147 Bacteria 668
105 Ga0105248_10360906 3300009177 Bacteria 1636
106 Ga0105248_12826564 3300009177 Bacteria 554
107 Ga0105238_10226733 3300009551 Bacteria 1845
108 Ga0105238_11900327 3300009551 Bacteria 628
109 Ga0105238_12828223 3300009551 Bacteria 522
110 Ga0105249_13065257 3300009553 Bacteria 537
111 Ga0105249_13355262 3300009553 Bacteria 515
112 Ga0105239_12783858 3300010375 Bacteria 571
113 Ga0157378_11139143 3300013297 Bacteria 818
114 Ga0157378_11960130 3300013297 Bacteria 635
115 Ga0163162_11494938 3300013306 Bacteria 769
116 Ga0157372_10634917 3300013307 Unclassified 1244
117 Ga0157375_13383569 3300013308 Unclassified 531
118 Ga0157380_10485068 3300014326 Unclassified 1196
119 Ga0157380_10690222 3300014326 Bacteria 1024
120 Ga0157376_10021576 3300014969 Bacteria 5005
121 Ga0157376_10190863 3300014969 Bacteria 1879
122 Ga0163161_10918339 3300017792 Bacteria 743
123 Ga0207697_10264691 3300025315 Bacteria 761
124 Ga0207685_10748349 3300025905 Bacteria 535
125 Ga0207699_10290174 3300025906 Unclassified 1140
126 Ga0207705_10018964 3300025909 Bacteria 4919
127 Ga0207705_10736408 3300025909 Bacteria 766
128 Ga0207684_11271162 3300025910 Bacteria 607
129 Ga0207707_10059189 3300025912 Bacteria 3333
130 Ga0207707_10129436 3300025912 Unclassified 2208
131 Ga0207695_10475497 3300025913 Bacteria 1132
132 Ga0207663_10225822 3300025916 Unclassified 1365
133 Ga0207663_10409704 3300025916 Bacteria 1038
134 Ga0207657_10000694 3300025919 Bacteria 35789
135 Ga0207657_11084035 3300025919 Bacteria 612
136 Ga0207652_10105057 3300025921 Bacteria 2499
137 Ga0207652_10421035 3300025921 Bacteria 1204
138 Ga0207652_10431137 3300025921 Bacteria 1189
139 Ga0207652_11147317 3300025921 Bacteria 678
140 Ga0207646_10133412 3300025922 Bacteria 2236
141 Ga0207646_11170152 3300025922 Bacteria 675
142 Ga0207681_11724529 3300025923 Bacteria 523
143 Ga0207694_10825105 3300025924 Bacteria 783
144 Ga0207650_10071062 3300025925 Bacteria 2618
145 Ga0207650_10471758 3300025925 Bacteria 1046
146 Ga0207650_11424205 3300025925 Bacteria 589
147 Ga0207659_10384038 3300025926 Bacteria 1172
148 Ga0207659_11140906 3300025926 Bacteria 670
149 Ga0207644_10159816 3300025931 Bacteria 1751
150 Ga0207644_11722262 3300025931 Bacteria 525
151 Ga0207690_10081673 3300025932 Bacteria 2259
152 Ga0207690_10162786 3300025932 Bacteria 1665
153 Ga0207670_11199413 3300025936 Bacteria 642
154 Ga0207665_10094556 3300025939 Bacteria 2076
155 Ga0207691_10158402 3300025940 Bacteria 1987
156 Ga0207691_10742351 3300025940 Unclassified 827
157 Ga0207711_10151258 3300025941 Bacteria 2094
158 Ga0207689_11025052 3300025942 Bacteria 696
159 Ga0207661_12043399 3300025944 Unclassified 519
160 Ga0207679_10233752 3300025945 Bacteria 1554
161 Ga0207679_11105059 3300025945 Bacteria 727
162 Ga0207679_11407196 3300025945 Unclassified 640
163 Ga0207667_10032394 3300025949 Bacteria 5633
164 Ga0207667_10789853 3300025949 Bacteria 947
165 Ga0207667_11957797 3300025949 Bacteria 547
166 Ga0207712_11526648 3300025961 Bacteria 598
167 Ga0207668_10866828 3300025972 Bacteria 802
168 Ga0207658_10158265 3300025986 Bacteria 1854
169 Ga0207639_12065106 3300026041 Bacteria 531
170 Ga0207676_10745640 3300026095 Bacteria 952
171 Ga0207676_11310771 3300026095 Bacteria 719
172 Ga0207674_10641384 3300026116 Unclassified 1026
173 Ga0207675_102314678 3300026118 Bacteria 551
174 Ga0207683_10102837 3300026121 Bacteria 2551
175 Ga0209813_10177155 3300027866 Bacteria 778
176 Ga0207428_10380268 3300027907 Bacteria 1036
177 Ga0207428_10726356 3300027907 Unclassified 709
178 Ga0207428_10818958 3300027907 Unclassified 661
179 Ga0268266_11098228 3300028379 Bacteria 770
180 Ga0268265_10794704 3300028380 Bacteria 922
181 Ga0268264_10089318 3300028381 Bacteria 2653
182 Ga0268264_10128860 3300028381 Bacteria 2240
183 Ga0265332_10124373 3300031238 Unclassified 1083
184 Ga0265314_10361026 3300031711 Bacteria 796
185 Ga0307405_11754948 3300031731 Unclassified 551
186 Ga0307414_11381334 3300032004 Bacteria 654
187 Ga0307411_11386947 3300032005 Bacteria 643
188 Ga0373934_0350872 3300035086 Unclassified 614
189 Ga0373944_0178553 3300035089 Bacteria 760
190 Ga0373949_0036140 3300035090 Bacteria 1197
191 Ga0373951_0109137 3300035091 Bacteria 743
192 Ga0373945_0099421 3300035116 Bacteria 1137
193 Ga0373953_0307387 3300035117 Bacteria 692
194 Ga0373954_0271241 3300035118 Bacteria 836
195 Ga0373956_0360809 3300035119 Unclassified 693
196 Ga0373957_0364133 3300035120 Bacteria 619
197 Ga0373957_0552782 3300035120 Unclassified 504
198 Ga0373955_0522727 3300035172 Unclassified 725
199 Ga0373935_0040409 3300035692 Bacteria 2928
200 Ga0373933_0583213 3300035724 Bacteria 734
201 Ga0373947_0114505 3300035725 Bacteria 1708
202 Ga0373947_1125489 3300035725 Unclassified 535
203 Ga0373937_0053793 3300036401 Bacteria 3693
204 Ga0373925_0707537 3300037068 Bacteria 830
205 Ga0439439_0094268 3300041406 Unclassified 820
206 Ga0451791_1525073 3300041451 Bacteria 637
207 Ga0451798_0331240 3300041458 Bacteria 546
208 Ga0451807_2276273 3300041486 Unclassified 571
209 Ga0451843_1169213 3300041509 Bacteria 789
210 Ga0451853_2029903 3300041512 Unclassified 617
211 Ga0439435_0002425 3300042436 Bacteria 3701
212 Ga0451577_0155933 3300042876 Bacteria 2055
213 Ga0466964_0853543 3300044706 Unclassified 518
214 Ga0453684_0007814 3300044712 Bacteria 19501
215 Ga0466959_0434423 3300045049 Bacteria 891
216 Ga0495592_0371471 3300046454 Bacteria 912
217 Ga0495653_0708965 3300046463 Unclassified 611
218 Ga0495639_0119958 3300046475 Bacteria 1254
219 Ga0495628_0285384 3300046516 Unclassified 1225
220 Ga0495628_0677643 3300046516 Bacteria 730
221 Ga0495652_0715938 3300046529 Bacteria 672
222 Ga0495645_0252491 3300046543 Bacteria 1172
223 Ga0495599_0855529 3300046678 Unclassified 517
224 Ga0495613_1073425 3300046689 Bacteria 515
225 Ga0495600_0043170 3300046809 Bacteria 2940
226 Ga0495672_0008740 3300047320 Bacteria 7425
227 Ga0495593_0387318 3300047673 Bacteria 699
228 Ga0501031_0243795 3300049568 Bacteria 1168
229 Ga0501031_0503109 3300049568 Bacteria 781
230 Ga0501032_0141976 3300049569 Unclassified 1581
231 Ga0501033_0172830 3300049570 Unclassified 1551
232 Ga0501034_0004199 3300049571 Bacteria 16083
233 Ga0501034_0019699 3300049571 Bacteria 6897
234 Ga0501034_0035640 3300049571 Bacteria 5043
235 Ga0501034_0039761 3300049571 Bacteria 4763
236 Ga0501034_0043931 3300049571 Bacteria 4520
237 Ga0501034_0929385 3300049571 Unclassified 756
238 Ga0501036_0003148 3300049572 Bacteria 13162
239 Ga0501036_0033407 3300049572 Bacteria 4351
240 Ga0501036_0034770 3300049572 Bacteria 4263
241 Ga0501037_0220064 3300049573 Bacteria 1336
242 Ga0501038_0118092 3300049574 Bacteria 2190
243 Ga0501038_0267991 3300049574 Bacteria 1347
244 Ga0501038_0726142 3300049574 Unclassified 742
245 Ga0501039_0632041 3300049575 Unclassified 838
246 Ga0501039_0739312 3300049575 Unclassified 768
247 Ga0501040_0802894 3300049576 Unclassified 681
248 Ga0501042_0738475 3300049578 Bacteria 716
249 Ga0501043_0012455 3300049579 Bacteria 6654
250 Ga0501043_0206426 3300049579 Bacteria 1523
251 Ga0501043_0208616 3300049579 Bacteria 1514
252 Ga0501043_0279179 3300049579 Bacteria 1281
253 Ga0501046_0021220 3300049580 Bacteria 5362
254 Ga0501046_0039022 3300049580 Bacteria 3806
255 Ga0501046_0446359 3300049580 Bacteria 930
256 Ga0501047_0001960 3300049581 Bacteria 19764
257 Ga0501047_0004559 3300049581 Bacteria 13028
258 Ga0501047_0123168 3300049581 Unclassified 2473
259 Ga0501047_0464287 3300049581 Unclassified 1094
260 Ga0501047_0971577 3300049581 Unclassified 662
261 Ga0501048_0038825 3300049582 Bacteria 3417
262 Ga0501048_0404009 3300049582 Unclassified 976
263 Ga0501067_0013701 3300049583 Bacteria 4491
264 Ga0501067_0066986 3300049583 Bacteria 1987
265 Ga0501067_0159243 3300049583 Unclassified 1257
266 Ga0501067_0200292 3300049583 Bacteria 1112
267 Ga0501068_0237932 3300049584 Bacteria 1158
268 Ga0501069_0058515 3300049585 Bacteria 2149
269 Ga0501070_0092560 3300049586 Unclassified 2502
270 Ga0501072_0117256 3300049588 Unclassified 2120
271 Ga0501072_0565729 3300049588 Bacteria 897
272 Ga0501073_0064006 3300049589 Bacteria 2564
273 Ga0501073_0076219 3300049589 Bacteria 2333
274 Ga0501073_0207972 3300049589 Bacteria 1352
275 Ga0501073_0223429 3300049589 Bacteria 1301
276 Ga0501073_0289047 3300049589 Bacteria 1131
277 Ga0501074_0040755 3300049590 Bacteria 3362
278 Ga0501076_0164345 3300049592 Bacteria 1809
279 Ga0501079_0495069 3300049741 Bacteria 961
280 Ga0501080_0000239 3300049742 Bacteria 41220
281 Ga0501080_0005968 3300049742 Bacteria 10911
282 Ga0501080_0019912 3300049742 Bacteria 6213
283 Ga0501080_0059162 3300049742 Unclassified 3566
284 Ga0501080_0409603 3300049742 Bacteria 1219
285 Ga0501080_1783617 3300049742 Bacteria 517
286 Ga0501083_0041690 3300049744 Bacteria 3112
287 Ga0501083_0095940 3300049744 Bacteria 1956
288 Ga0501035_0333398 3300049822 Bacteria 1272
289 Ga0501035_0524124 3300049822 Bacteria 973
290 Ga0501044_0010250 3300049823 Bacteria 10179
291 Ga0501044_0104081 3300049823 Bacteria 2852
292 Ga0501044_0565755 3300049823 Unclassified 1032
293 Ga0501045_0820435 3300049824 Unclassified 685
294 nmdc:mga05p37_1395702_c1 3300050507 Bacteria 706
295 nmdc:mga05p37_1956879_c1 3300050507 Unclassified 557
296 nmdc:mga05p37_378013_c1 3300050507 Bacteria 1661
297 nmdc:mga05p37_446184_c1 3300050507 Bacteria 1499
298 nmdc:mga05p37_9617_c1 3300050507 Bacteria 11451
299 nmdc:mga06r32_575664_c1 3300050510 Bacteria 1098
300 nmdc:mga08y16_384144_c1 3300050511 Unclassified 1439
301 nmdc:mga08y16_700451_c1 3300050511 Bacteria 1013
302 nmdc:mga08y16_761123_c1 3300050511 Bacteria 964
303 nmdc:mga0n895_13709_c1 3300050512 Bacteria 7328
304 nmdc:mga0n895_552598_c1 3300050512 Bacteria 1157
305 nmdc:mga0n895_68433_c1 3300050512 Bacteria 3518
306 nmdc:mga0n895_797178_c1 3300050512 Bacteria 935
307 nmdc:mga0rr50_41523_c1 3300050513 Bacteria 3353
308 nmdc:mga0rr50_9473_c1 3300050513 Bacteria 6125
309 nmdc:mga08x19_240876_c1 3300050514 Bacteria 1247
310 nmdc:mga08x19_257952_c1 3300050514 Bacteria 1205
311 nmdc:mga08x19_675943_c1 3300050514 Bacteria 733
312 nmdc:mga08x19_72270_c1 3300050514 Bacteria 2250
313 nmdc:mga0a205_1063293_c1 3300050515 Bacteria 656
314 nmdc:mga0a205_244330_c1 3300050515 Bacteria 1676
315 nmdc:mga0a205_63859_c1 3300050515 Bacteria 3557
316 Ga0500555_000142 3300053103 Bacteria 34036
317 Ga0500568_0000928 3300053139 Bacteria 20204
318 Ga0500616_0001056 3300053153 Bacteria 29045
319 Ga0500645_000187 3300053730 Bacteria 48109
320 Ga0500609_060091 3300053731 Bacteria 531
321 Ga0501084_0084085 3300054114 Bacteria 2671
322 Ga0501084_0103918 3300054114 Bacteria 2386
323 Ga0501084_0949385 3300054114 Bacteria 723
324 Ga0501082_0086759 3300060353 Bacteria 2699
325 Ga0501082_0932154 3300060353 Bacteria 759
326 Ga0501082_1607124 3300060353 Unclassified 567
327 Ga0530510_0565536 3300061734 Unclassified 864
328 Ga0530510_1431972 3300061734 Bacteria 530
329 Ga0495680_0616308
330 Ga0058863_11239450
331 Ga0058861_12055662
332 Ga0058862_12642877
333 Ga0070658_10082690
334 Ga0070670_100035954
335 Ga0070670_100063401
336 Ga0070670_101955669
337 Ga0070677_10034563
338 Ga0070677_10333396
339 Ga0068869_101233880
340 Ga0070666_10473671
341 Ga0070660_100001206
342 Ga0070687_101025811
343 Ga0070661_100651917
344 Ga0070668_101323399
345 Ga0070671_100321587
346 Ga0070671_101242599
347 Ga0070673_101417398
348 Ga0070688_101182172
349 Ga0070659_100035423
350 Ga0070659_100151315
351 Ga0070711_100587215
352 Ga0070705_100269366
353 Ga0070694_100002766
354 Ga0070663_100872004
355 Ga0070663_101514646
356 Ga0070678_100188358
357 Ga0070662_101693256
358 Ga0070681_10024700
359 Ga0070681_10074214
360 Ga0070681_11342664
361 Ga0068867_101299668
362 Ga0070698_100780767
363 Ga0070699_100290082
364 Ga0070699_101066806
365 Ga0070679_100127333
366 Ga0070679_100183580
367 Ga0070679_100265632
368 Ga0070679_100722605
369 Ga0070697_100965989
370 Ga0070672_100147600
371 Ga0070672_100504352
372 Ga0070686_100101460
373 Ga0070695_100001565
374 Ga0070696_100105021
375 Ga0070704_100005607
376 Ga0070704_100385468
377 Ga0070704_100899758
378 Ga0070704_101823582
379 Ga0070704_102099081
380 Ga0068855_100033510
381 Ga0068855_101674865
382 Ga0068855_101741708
383 Ga0070664_100425272
384 Ga0070664_100703891
385 Ga0068857_100070662
386 Ga0068857_102247838
387 Ga0068854_102145453
388 Ga0068859_100003043
389 Ga0068859_101242092
390 Ga0068864_100479087
391 Ga0068864_101549536
392 Ga0068861_100673443
393 Ga0068851_10414078
394 Ga0068858_100100729
395 Ga0068860_100210039
396 Ga0068860_100632243
397 Ga0068862_100725282
398 Ga0081455_10215420
399 Ga0081455_10958907
400 Ga0075432_10306919
401 Ga0070715_10418037
402 Ga0070715_10891616
403 Ga0070715_11041946
404 Ga0070716_100964405
405 Ga0070712_101738070
406 Ga0075366_10263736
407 Ga0097621_100089286
408 Ga0068871_100126230
409 Ga0075430_101300148
410 Ga0075431_100452219
411 Ga0075433_10072705
412 Ga0075433_10216080
413 Ga0075434_100033832
414 Ga0075434_100606917
415 Ga0075434_101617017
416 Ga0075434_102637095
417 Ga0075436_100013718
418 Ga0075436_100039117
419 Ga0075436_100164484
420 Ga0097620_100003043
421 Ga0097620_101241863
422 Ga0075435_100009832
423 Ga0075435_100021149
424 Ga0105240_10743371
425 Ga0111539_10195710
426 Ga0111539_10275885
427 Ga0111539_10414125
428 Ga0111539_11511093
429 Ga0114129_10023273
430 Ga0114129_10062916
431 Ga0114129_10871272
432 Ga0114129_12175657
433 Ga0105248_10360906
434 Ga0105248_12826564
435 Ga0105238_10226733
436 Ga0105238_11900327
437 Ga0105238_12828223
438 Ga0105249_13065257
439 Ga0105249_13355262
440 Ga0105239_12783858
441 Ga0157378_11139143
442 Ga0157378_11960130
443 Ga0163162_11494938
444 Ga0157372_10634917
445 Ga0157375_13383569
446 Ga0157380_10485068
447 Ga0157380_10690222
448 Ga0157376_10021576
449 Ga0157376_10190863
450 Ga0163161_10918339
451 Ga0207697_10264691
452 Ga0207685_10748349
453 Ga0207699_10290174
454 Ga0207705_10018964
455 Ga0207705_10736408
456 Ga0207684_11271162
457 Ga0207707_10059189
458 Ga0207707_10129436
459 Ga0207695_10475497
460 Ga0207663_10225822
461 Ga0207663_10409704
462 Ga0207657_10000694
463 Ga0207657_11084035
464 Ga0207652_10105057
465 Ga0207652_10421035
466 Ga0207652_10431137
467 Ga0207652_11147317
468 Ga0207646_10133412
469 Ga0207646_11170152
470 Ga0207681_11724529
471 Ga0207694_10825105
472 Ga0207650_10071062
473 Ga0207650_10471758
474 Ga0207650_11424205
475 Ga0207659_10384038
476 Ga0207659_11140906
477 Ga0207644_10159816
478 Ga0207644_11722262
479 Ga0207690_10081673
480 Ga0207690_10162786
481 Ga0207670_11199413
482 Ga0207665_10094556
483 Ga0207691_10158402
484 Ga0207691_10742351
485 Ga0207711_10151258
486 Ga0207689_11025052
487 Ga0207661_12043399
488 Ga0207679_10233752
489 Ga0207679_11105059
490 Ga0207679_11407196
491 Ga0207667_10032394
492 Ga0207667_10789853
493 Ga0207667_11957797
494 Ga0207712_11526648
495 Ga0207668_10866828
496 Ga0207658_10158265
497 Ga0207639_12065106
498 Ga0207676_10745640
499 Ga0207676_11310771
500 Ga0207674_10641384
501 Ga0207675_102314678
502 Ga0207683_10102837
503 Ga0209813_10177155
504 Ga0207428_10380268
505 Ga0207428_10726356
506 Ga0207428_10818958
507 Ga0268266_11098228
508 Ga0268265_10794704
509 Ga0268264_10089318
510 Ga0268264_10128860
511 Ga0265332_10124373
512 Ga0265314_10361026
513 Ga0307405_11754948
514 Ga0307414_11381334
515 Ga0307411_11386947
516 Ga0373934_0350872
517 Ga0373944_0178553
518 Ga0373949_0036140
519 Ga0373951_0109137
520 Ga0373945_0099421
521 Ga0373953_0307387
522 Ga0373954_0271241
523 Ga0373956_0360809
524 Ga0373957_0364133
525 Ga0373957_0552782
526 Ga0373955_0522727
527 Ga0373935_0040409
528 Ga0373933_0583213
529 Ga0373947_0114505
530 Ga0373947_1125489
531 Ga0373937_0053793
532 Ga0373925_0707537
533 Ga0439439_0094268
534 Ga0451791_1525073
535 Ga0451798_0331240
536 Ga0451807_2276273
537 Ga0451843_1169213
538 Ga0451853_2029903
539 Ga0439435_0002425
540 Ga0451577_0155933
541 Ga0466964_0853543
542 Ga0453684_0007814
543 Ga0466959_0434423
544 Ga0495592_0371471
545 Ga0495653_0708965
546 Ga0495639_0119958
547 Ga0495628_0285384
548 Ga0495628_0677643
549 Ga0495652_0715938
550 Ga0495645_0252491
551 Ga0495599_0855529
552 Ga0495613_1073425
553 Ga0495600_0043170
554 Ga0495672_0008740
555 Ga0495593_0387318
556 Ga0501031_0243795
557 Ga0501031_0503109
558 Ga0501032_0141976
559 Ga0501033_0172830
560 Ga0501034_0004199
561 Ga0501034_0019699
562 Ga0501034_0035640
563 Ga0501034_0039761
564 Ga0501034_0043931
565 Ga0501034_0929385
566 Ga0501036_0003148
567 Ga0501036_0033407
568 Ga0501036_0034770
569 Ga0501037_0220064
570 Ga0501038_0118092
571 Ga0501038_0267991
572 Ga0501038_0726142
573 Ga0501039_0632041
574 Ga0501039_0739312
575 Ga0501040_0802894
576 Ga0501042_0738475
577 Ga0501043_0012455
578 Ga0501043_0206426
579 Ga0501043_0208616
580 Ga0501043_0279179
581 Ga0501046_0021220
582 Ga0501046_0039022
583 Ga0501046_0446359
584 Ga0501047_0001960
585 Ga0501047_0004559
586 Ga0501047_0123168
587 Ga0501047_0464287
588 Ga0501047_0971577
589 Ga0501048_0038825
590 Ga0501048_0404009
591 Ga0501067_0013701
592 Ga0501067_0066986
593 Ga0501067_0159243
594 Ga0501067_0200292
595 Ga0501068_0237932
596 Ga0501069_0058515
597 Ga0501070_0092560
598 Ga0501072_0117256
599 Ga0501072_0565729
600 Ga0501073_0064006
601 Ga0501073_0076219
602 Ga0501073_0207972
603 Ga0501073_0223429
604 Ga0501073_0289047
605 Ga0501074_0040755
606 Ga0501076_0164345
607 Ga0501079_0495069
608 Ga0501080_0000239
609 Ga0501080_0005968
610 Ga0501080_0019912
611 Ga0501080_0059162
612 Ga0501080_0409603
613 Ga0501080_1783617
614 Ga0501083_0041690
615 Ga0501083_0095940
616 Ga0501035_0333398
617 Ga0501035_0524124
618 Ga0501044_0010250
619 Ga0501044_0104081
620 Ga0501044_0565755
621 Ga0501045_0820435
622 nmdc:mga05p37_1395702_c1
623 nmdc:mga05p37_1956879_c1
624 nmdc:mga05p37_378013_c1
625 nmdc:mga05p37_446184_c1
626 nmdc:mga05p37_9617_c1
627 nmdc:mga06r32_575664_c1
628 nmdc:mga08y16_384144_c1
629 nmdc:mga08y16_700451_c1
630 nmdc:mga08y16_761123_c1
631 nmdc:mga0n895_13709_c1
632 nmdc:mga0n895_552598_c1
633 nmdc:mga0n895_68433_c1
634 nmdc:mga0n895_797178_c1
635 nmdc:mga0rr50_41523_c1
636 nmdc:mga0rr50_9473_c1
637 nmdc:mga08x19_240876_c1
638 nmdc:mga08x19_257952_c1
639 nmdc:mga08x19_675943_c1
640 nmdc:mga08x19_72270_c1
641 nmdc:mga0a205_1063293_c1
642 nmdc:mga0a205_244330_c1
643 nmdc:mga0a205_63859_c1
644 Ga0500555_000142
645 Ga0500568_0000928
646 Ga0500616_0001056
647 Ga0500645_000187
648 Ga0500609_060091
649 Ga0501084_0084085
650 Ga0501084_0103918
651 Ga0501084_0949385
652 Ga0501082_0086759
653 Ga0501082_0932154
654 Ga0501082_1607124
655 Ga0530510_0565536
656 Ga0530510_1431972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un9-assembly1.cif.gz_A crystal structure of an immune receptor 0.9943 40 82
5c39-assembly1.cif.gz_B crystal structure of a designed mn binding peptide 0.9778 39 84
1mft-assembly1.cif.gz_A crystal structure of four-helix bundle model 0.9759 39 86
7f6j-assembly1.cif.gz_C crystal structure of the pdzd8 coiled-coil domain - rab7 complex 0.974 38 84
2a26-assembly2.cif.gz_C crystal structure of the n-terminal, dimerization domain of siah interacting protein 0.9728 43 82
ID Description Score Start End Superfamily
4fvmA06 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 1 39 82 1.10.287.690
af_Q9CXW3_1_48_4.10.860.10 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 0.9996 43 85 4.10.860.10
af_Q4D315_1583_2097_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.9963 39 84 3.40.850.10
af_Q54I73_262_1323_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9927 38 83 1.25.10.10
af_A0A286Y9S9_612_725_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.9903 39 83 6.10.140.680
ID Description Score Start End GO Terms
AF-A0A7X6TIX3-F1-model_v4 Mechanosensitive ion channel 1.001 39 84 GO:0016020
AF-A0A7W1CL55-F1-model_v4 C4-type zinc ribbon domain-containing protein 0.9993 39 86
AF-A0A0H5PWJ1-F1-model_v4 Uncharacterized protein 0.8702 31 85
AF-A0A1G2HXX3-F1-model_v4 DUF5667 domain-containing protein 0.8457 26 86
AF-A0A7X7EZ68-F1-model_v4 Uncharacterized protein 0.8127 27 87 GO:0016020

Map