F409378

General Info

Members Datasets Scaffolds Average Seq Length
328 239 301 325

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0003545|Ga0495641_0003545_2967_4067
Length 366
Sequence VEECLSLYAGLYRAYSLGPYLSQLFALSYRAWSFQLTTLFKMKAIVIERFGGPECLVVQDVPLPEPKQGEVVIRIKAFGVNHAEMHMRRGEWAEWVPISGIECVGMVHRCPGGEFEEGTPVASLMGGLGRTISGSYAEFTRAKASNVVPLGPATLDLRWDQLAALPESYATAWTCLFRNLEIAAGQRLLIRGGTSAFGRAAINLAVQAGVKVTSTTRSEDRVVQLKSLGVEAVLIEGPELSERVQEKFDAVLELIGNSTVIDSLKLVHRGGRVCLAGWLGGLAPISDFNPLLQMASGVHLSFFGSFVFGTPEFPLSDIPFQDIVAMVARKQFNADHWKVFPFQEIQEAHRLMENNEAHGKIVVTVD

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
5 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
6 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
7 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
8 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
9 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
10 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
11 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
12 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
13 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
14 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
15 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
16 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
17 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
18 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
19 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
20 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
21 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
22 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
234 8002775197 Frankia nepalensis CN7 Isolate Nodule
235 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
236 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
237 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
238 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
239 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.77
Metatranscriptomes 0
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 6.4
Rhizoplane 0.61
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 4.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000095 3300001915 Bacteria 22931
2 JGI24740J21852_10000562 3300001979 Bacteria 15954
3 JGI25156J39149_1007937 3300002705 Bacteria 2728
4 JGI25159J45721_1001461 3300002987 Bacteria 9740
5 rootH1_10030891 3300003316 Bacteria 2527
6 rootH2_10029516 3300003320 Bacteria 26870
7 Ga0055538_1002454 3300003751 Bacteria 2713
8 Ga0055539_1000095 3300003752 Bacteria 102639
9 Ga0055539_1000198 3300003752 Bacteria 48821
10 Ga0055533_1000008 3300003756 Bacteria 575861
11 Ga0055533_1003885 3300003756 Bacteria 2848
12 Ga0055525_1000281 3300003759 Bacteria 46722
13 Ga0055541_1004348 3300003841 Bacteria 2578
14 Ga0070666_10046890 3300005335 Bacteria 2900
15 Ga0070660_100049920 3300005339 Bacteria 3218
16 Ga0070661_100000301 3300005344 Bacteria 39891
17 Ga0070661_100188820 3300005344 Bacteria 1571
18 Ga0070668_100013220 3300005347 Bacteria 6157
19 Ga0070673_100071927 3300005364 Bacteria 2780
20 Ga0070673_100162669 3300005364 Unclassified 1899
21 Ga0070709_10017593 3300005434 Bacteria 4103
22 Ga0070714_100401543 3300005435 Bacteria 1295
23 Ga0070713_100434580 3300005436 Bacteria 1230
24 Ga0070710_10066882 3300005437 Bacteria 2061
25 Ga0070663_100000025 3300005455 Bacteria 101896
26 Ga0070663_100125960 3300005455 Bacteria 1940
27 Ga0070678_100086688 3300005456 Bacteria 2389
28 Ga0070699_100002556 3300005518 Bacteria 16341
29 Ga0070697_100173498 3300005536 Bacteria 1826
30 Ga0070697_100178276 3300005536 Bacteria 1800
31 Ga0068853_100006217 3300005539 Bacteria 9458
32 Ga0068855_100126946 3300005563 Bacteria 2915
33 Ga0070664_100000020 3300005564 Bacteria 119858
34 Ga0068857_100150880 3300005577 Bacteria 2105
35 Ga0068856_100053049 3300005614 Bacteria 3999
36 Ga0068856_100277413 3300005614 Bacteria 1693
37 Ga0070702_100031655 3300005615 Bacteria 2897
38 Ga0068859_100179153 3300005617 Bacteria 2202
39 Ga0068864_100133290 3300005618 Bacteria 2234
40 Ga0068863_100110774 3300005841 Bacteria 2614
41 Ga0068862_100120833 3300005844 Bacteria 2309
42 Ga0081455_10007078 3300005937 Bacteria 11901
43 Ga0081455_10090105 3300005937 Bacteria 2488
44 Ga0081540_1003695 3300005983 Bacteria 11992
45 Ga0081540_1050335 3300005983 Bacteria 2070
46 Ga0075365_10056339 3300006038 Bacteria 2613
47 Ga0070715_10015037 3300006163 Bacteria 2879
48 Ga0070716_100264715 3300006173 Bacteria 1178
49 Ga0070716_100286309 3300006173 Bacteria 1140
50 Ga0070712_100081234 3300006175 Bacteria 2348
51 Ga0097621_100011572 3300006237 Bacteria 6503
52 Ga0097621_100043625 3300006237 Bacteria 3615
53 Ga0075430_100000103 3300006846 Bacteria 51038
54 Ga0075430_100301746 3300006846 Bacteria 1325
55 Ga0075431_100047408 3300006847 Bacteria 4430
56 Ga0075431_100159906 3300006847 Bacteria 2316
57 Ga0075431_100305820 3300006847 Bacteria 1606
58 Ga0075433_10004526 3300006852 Bacteria 10842
59 Ga0075434_100002179 3300006871 Bacteria 17077
60 Ga0075434_100041910 3300006871 Bacteria 4537
61 Ga0075429_100083425 3300006880 Bacteria 2786
62 Ga0075436_100008918 3300006914 Bacteria 6866
63 Ga0097620_100179152 3300006931 Bacteria 2202
64 Ga0075435_100172842 3300007076 Bacteria 1823
65 Ga0105240_10440037 3300009093 Bacteria 1461
66 Ga0111539_10325442 3300009094 Bacteria 1789
67 Ga0105245_10121116 3300009098 Bacteria 2444
68 Ga0114129_10003672 3300009147 Bacteria 21588
69 Ga0114129_10013512 3300009147 Bacteria 11636
70 Ga0114129_10209027 3300009147 Bacteria 2639
71 Ga0105248_10017622 3300009177 Bacteria 7878
72 Ga0105248_10028706 3300009177 Bacteria 6200
73 Ga0157373_10011170 3300013100 Bacteria 6608
74 Ga0157371_10000082 3300013102 Bacteria 149981
75 Ga0157370_10000423 3300013104 Bacteria 53080
76 Ga0157369_10051414 3300013105 Bacteria 4459
77 Ga0157374_10015445 3300013296 Bacteria 6697
78 Ga0157378_10040549 3300013297 Bacteria 4129
79 Ga0163162_10036214 3300013306 Bacteria 4916
80 Ga0157372_10000122 3300013307 Bacteria 83503
81 Ga0163163_10071488 3300014325 Bacteria 3458
82 Ga0157376_10006945 3300014969 Bacteria 8027
83 Ga0213873_10013951 3300021358 Bacteria 1773
84 Ga0213872_10006196 3300021361 Bacteria 6039
85 Ga0213872_10006306 3300021361 Bacteria 5978
86 Ga0209784_100055 3300025224 Bacteria 177507
87 Ga0209784_100466 3300025224 Bacteria 16871
88 Ga0209566_100002 3300025225 Bacteria 2614868
89 Ga0209674_100015 3300025226 Bacteria 697299
90 Ga0209674_100090 3300025226 Bacteria 175563
91 Ga0209563_100017 3300025230 Bacteria 796449
92 Ga0209563_100095 3300025230 Bacteria 165592
93 Ga0209563_100198 3300025230 Bacteria 33000
94 Ga0209677_100037 3300025253 Bacteria 286702
95 Ga0209677_100069 3300025253 Bacteria 144999
96 Ga0209759_1000546 3300025256 Bacteria 38996
97 Ga0209759_1010266 3300025256 Bacteria 2756
98 Ga0209759_1015604 3300025256 Bacteria 1953
99 Ga0207426_1038755 3300025302 Bacteria 1499
100 Ga0207688_10022796 3300025901 Bacteria 3429
101 Ga0207685_10026547 3300025905 Bacteria 2016
102 Ga0207684_10042604 3300025910 Bacteria 3848
103 Ga0207684_10111646 3300025910 Bacteria 2340
104 Ga0207695_10377586 3300025913 Bacteria 1303
105 Ga0207693_10195988 3300025915 Bacteria 1589
106 Ga0207663_10034967 3300025916 Bacteria 3010
107 Ga0207657_10075456 3300025919 Bacteria 2845
108 Ga0207649_10000065 3300025920 Bacteria 94778
109 Ga0207687_10024189 3300025927 Bacteria 4055
110 Ga0207700_10168001 3300025928 Bacteria 1827
111 Ga0207664_10455706 3300025929 Bacteria 1142
112 Ga0207690_10028947 3300025932 Bacteria 3516
113 Ga0207665_10004853 3300025939 Bacteria 8952
114 Ga0207665_10139496 3300025939 Bacteria 1727
115 Ga0207689_10045660 3300025942 Bacteria 3621
116 Ga0207679_10000028 3300025945 Bacteria 187787
117 Ga0207679_10080306 3300025945 Bacteria 2490
118 Ga0207651_10031448 3300025960 Bacteria 3393
119 Ga0207668_10008929 3300025972 Bacteria 5995
120 Ga0207639_10133149 3300026041 Bacteria 2061
121 Ga0207678_10000136 3300026067 Bacteria 61264
122 Ga0207678_10004789 3300026067 Bacteria 12146
123 Ga0207702_10000149 3300026078 Bacteria 81592
124 Ga0207702_10574806 3300026078 Bacteria 1104
125 Ga0207676_10053739 3300026095 Bacteria 3153
126 Ga0207674_10323681 3300026116 Bacteria 1491
127 Ga0207674_10372623 3300026116 Bacteria 1380
128 Ga0207683_10074757 3300026121 Bacteria 2998
129 Ga0207428_10290922 3300027907 Bacteria 1211
130 Ga0307517_10165535 3300028786 Eukaryota 1470
131 Ga0373926_0018747 3300035083 Bacteria 2382
132 Ga0373934_0001299 3300035086 Bacteria 9100
133 Ga0373923_0002539 3300035111 Bacteria 5643
134 Ga0373936_0005503 3300035113 Bacteria 4778
135 Ga0373936_0006741 3300035113 Bacteria 4321
136 Ga0373953_0008528 3300035117 Bacteria 3485
137 Ga0373953_0021818 3300035117 Bacteria 2407
138 Ga0373954_0007777 3300035118 Bacteria 4691
139 Ga0373954_0024699 3300035118 Bacteria 2741
140 Ga0373956_0006192 3300035119 Bacteria 4786
141 Ga0373957_0002784 3300035120 Bacteria 5036
142 Ga0373955_0004202 3300035172 Bacteria 6354
143 Ga0373924_0007436 3300035410 Bacteria 3956
144 Ga0373935_0023905 3300035692 Bacteria 3755
145 Ga0373935_0167448 3300035692 Bacteria 1501
146 Ga0373927_0000681 3300035695 Bacteria 25866
147 Ga0373933_0002554 3300035724 Bacteria 10210
148 Ga0373933_0005054 3300035724 Bacteria 7197
149 Ga0373937_0014930 3300036401 Bacteria 6859
150 Ga0373937_0037885 3300036401 Bacteria 4394
151 Ga0395905_0000484 3300037471 Bacteria 54907
152 Ga0436361_0234917 3300039447 Bacteria 14328
153 Ga0436361_0608376 3300039447 Bacteria 19212
154 Ga0436361_0655142 3300039447 Bacteria 1953
155 Ga0436361_1092317 3300039447 Bacteria 1255
156 Ga0439461_0007096 3300041410 Bacteria 1973
157 Ga0439465_0047137 3300041413 Bacteria 1404
158 Ga0439431_0008242 3300041997 Bacteria 2339
159 Ga0466972_0006924 3300044658 Bacteria 5685
160 Ga0466966_0002962 3300044684 Bacteria 11175
161 Ga0466961_0004789 3300044693 Bacteria 8521
162 Ga0466964_0027080 3300044706 Bacteria 2248
163 Ga0466970_0017793 3300044765 Bacteria 3674
164 Ga0466959_0027154 3300045049 Bacteria 4246
165 Ga0466959_0031575 3300045049 Bacteria 3919
166 Ga0466967_0036695 3300045976 Bacteria 4187
167 Ga0495592_0001819 3300046454 Bacteria 14986
168 Ga0495592_0099783 3300046454 Bacteria 2070
169 Ga0495591_003781 3300046458 Bacteria 7651
170 Ga0495629_0008830 3300046459 Bacteria 7412
171 Ga0495641_0003545 3300046461 Eukaryota 11600
172 Ga0495641_0009415 3300046461 Bacteria 5802
173 Ga0495651_0007548 3300046462 Bacteria 8319
174 Ga0495651_0023758 3300046462 Bacteria 4765
175 Ga0495651_0054388 3300046462 Eukaryota 3079
176 Ga0495580_0004987 3300046472 Bacteria 11082
177 Ga0495580_0006191 3300046472 Bacteria 9784
178 Ga0495580_0031706 3300046472 Bacteria 3817
179 Ga0495580_0111660 3300046472 Bacteria 1898
180 Ga0495582_0082424 3300046473 Bacteria 1787
181 Ga0495662_0013524 3300046476 Bacteria 3973
182 Ga0495662_0028414 3300046476 Bacteria 2699
183 Ga0495664_0012693 3300046477 Bacteria 4771
184 Ga0495664_0035470 3300046477 Bacteria 2937
185 Ga0495584_0025245 3300046491 Bacteria 3013
186 Ga0495596_0012280 3300046500 Bacteria 3671
187 Ga0495607_0080098 3300046501 Bacteria 1797
188 Ga0495583_0000324 3300046506 Bacteria 75413
189 Ga0495606_0000487 3300046507 Bacteria 64941
190 Ga0495608_0001297 3300046511 Bacteria 17779
191 Ga0495608_0023894 3300046511 Bacteria 4181
192 Ga0495608_0120055 3300046511 Eukaryota 1686
193 Ga0495608_0187056 3300046511 Eukaryota 1309
194 Ga0495618_0001439 3300046514 Bacteria 15961
195 Ga0495618_0024796 3300046514 Eukaryota 3718
196 Ga0495618_0049214 3300046514 Bacteria 2661
197 Ga0495620_0036898 3300046515 Eukaryota 2182
198 Ga0495628_0006405 3300046516 Bacteria 10282
199 Ga0495628_0014087 3300046516 Bacteria 6712
200 Ga0495630_0000680 3300046517 Bacteria 24316
201 Ga0495630_0009569 3300046517 Bacteria 6968
202 Ga0495648_0002735 3300046524 Bacteria 15929
203 Ga0495666_0000120 3300046526 Bacteria 32561
204 Ga0495666_0008970 3300046526 Bacteria 5004
205 Ga0495652_0000053 3300046529 Eukaryota 117054
206 Ga0495652_0010056 3300046529 Eukaryota 8577
207 Ga0495652_0084959 3300046529 Bacteria 2602
208 Ga0495665_0005605 3300046531 Bacteria 6765
209 Ga0495640_0004132 3300046533 Bacteria 11616
210 Ga0495640_0044716 3300046533 Bacteria 3077
211 Ga0495586_0050930 3300046535 Bacteria 2240
212 Ga0495587_0002451 3300046536 Bacteria 12378
213 Ga0495587_0006299 3300046536 Bacteria 7742
214 Ga0495645_0010992 3300046543 Eukaryota 6359
215 Ga0495645_0065319 3300046543 Bacteria 2632
216 Ga0495622_0035604 3300046557 Bacteria 2321
217 Ga0495667_0008689 3300046559 Bacteria 6895
218 Ga0495668_0015708 3300046616 Bacteria 4413
219 Ga0495668_0135124 3300046616 Bacteria 1350
220 Ga0495634_0013209 3300046642 Bacteria 5969
221 Ga0495634_0039485 3300046642 Bacteria 3213
222 Ga0495611_0028480 3300046648 Eukaryota 2446
223 Ga0495625_0008790 3300046660 Bacteria 8553
224 Ga0495635_0007446 3300046663 Bacteria 7640
225 Ga0495661_0002143 3300046665 Bacteria 15471
226 Ga0495657_0021121 3300046675 Bacteria 4673
227 Ga0495657_0096933 3300046675 Eukaryota 1884
228 Ga0495599_0008117 3300046678 Bacteria 6375
229 Ga0495599_0010321 3300046678 Bacteria 5713
230 Ga0495623_0001410 3300046679 Eukaryota 16310
231 Ga0495646_0012954 3300046680 Bacteria 5302
232 Ga0495647_0006453 3300046681 Bacteria 3884
233 Ga0495658_0066405 3300046683 Bacteria 2083
234 Ga0495613_0002556 3300046689 Bacteria 13692
235 Ga0495613_0044380 3300046689 Bacteria 3289
236 Ga0495624_0006337 3300046690 Bacteria 8408
237 Ga0495624_0037871 3300046690 Eukaryota 3101
238 Ga0495671_0048255 3300046692 Bacteria 2125
239 Ga0495649_0000207 3300046694 Bacteria 51510
240 Ga0495589_0004958 3300046794 Bacteria 7052
241 Ga0495600_0001350 3300046809 Bacteria 13532
242 Ga0495600_0008438 3300046809 Bacteria 6328
243 Ga0495604_0014415 3300047317 Bacteria 6305
244 Ga0495604_0033153 3300047317 Bacteria 4089
245 Ga0495674_0021493 3300047319 Bacteria 5968
246 Ga0495674_0085728 3300047319 Bacteria 2697
247 Ga0495676_0007408 3300047321 Bacteria 10070
248 Ga0495680_0037221 3300047322 Bacteria 3899
249 Ga0495680_0040854 3300047322 Bacteria 3691
250 Ga0495680_0053803 3300047322 Eukaryota 3130
251 Ga0495683_0004809 3300047323 Bacteria 7576
252 Ga0495683_0043337 3300047323 Bacteria 2266
253 Ga0495675_0014478 3300047444 Bacteria 4985
254 Ga0495675_0247893 3300047444 Bacteria 1070
255 Ga0495679_001038 3300047446 Bacteria 16983
256 Ga0495673_0005575 3300047469 Bacteria 7587
257 Ga0495684_0007374 3300047471 Bacteria 8524
258 Ga0495686_0001489 3300047472 Bacteria 25384
259 Ga0495593_0001773 3300047673 Bacteria 12782
260 Ga0495602_0001531 3300048088 Eukaryota 23000
261 Ga0495602_0008341 3300048088 Eukaryota 10823
262 Ga0495602_0025460 3300048088 Eukaryota 5726
263 Ga0495602_0128577 3300048088 Bacteria 2024
264 Ga0495614_0004342 3300048089 Bacteria 6391
265 Ga0496106_0077201 3300048909 Bacteria 2554
266 Ga0496112_0081541 3300048915 Bacteria 3199
267 Ga0496117_0137436 3300048920 Bacteria 1470
268 Ga0496118_0010703 3300048921 Bacteria 9043
269 Ga0496118_0024599 3300048921 Bacteria 5193
270 Ga0496121_0000031 3300048924 Bacteria 384119
271 Ga0496121_0026825 3300048924 Bacteria 5412
272 Ga0496125_0015121 3300048928 Bacteria 7483
273 Ga0496126_0000248 3300048929 Bacteria 116557
274 Ga0495682_0011031 3300049460 Bacteria 3483
275 Ga0501047_0039140 3300049581 Bacteria 4587
276 nmdc:mga05p37_287_c1 3300050507 Bacteria 52760
277 nmdc:mga05p37_47997_c1 3300050507 Bacteria 5251
278 nmdc:mga05p37_524828_c1 3300050507 Bacteria 1354
279 nmdc:mga09592_36965_c1 3300050508 Bacteria 4092
280 nmdc:mga06r32_133646_c1 3300050510 Bacteria 2455
281 nmdc:mga06r32_16650_c1 3300050510 Bacteria 6700
282 nmdc:mga06r32_99223_c1 3300050510 Bacteria 2856
283 nmdc:mga08y16_312459_c1 3300050511 Bacteria 1618
284 nmdc:mga0n895_3093_c1 3300050512 Bacteria 13247
285 nmdc:mga0n895_624138_c1 3300050512 Bacteria 1078
286 nmdc:mga0n895_82262_c1 3300050512 Bacteria 3209
287 nmdc:mga0rr50_580_c1 3300050513 Bacteria 19575
288 nmdc:mga08x19_3433_c1 3300050514 Bacteria 9446
289 nmdc:mga0a205_234875_c1 3300050515 Bacteria 1716
290 nmdc:mga0a205_5267_c1 3300050515 Bacteria 11649
291 Ga0495601_0091723 3300053077 Bacteria 1956
292 Ga0500635_0000041 3300053080 Bacteria 90865
293 Ga0495595_0016594 3300053084 Bacteria 3154
294 Ga0495619_0013478 3300053085 Bacteria 5150
295 Ga0500578_0074417 3300053086 Bacteria 2164
296 Ga0500651_0003992 3300053093 Bacteria 8182
297 Ga0500555_054662 3300053103 Bacteria 1085
298 Ga0500595_024699 3300053119 Bacteria 2094
299 Ga0500642_0012984 3300053130 Bacteria 3043
300 Ga0500616_0053332 3300053153 Bacteria 2122
301 Ga0500661_003427 3300055283 Bacteria 2976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0036695 Ga0466967_0036695_46_1098 280
2 iso_pu_bacteria 2932784394 2932788015 292
3 iso_pu_bacteria 2932828146 2932832849 292
4 iso_pu_bacteria 2935638405 2935640658 292
5 iso_pu_bacteria 2935665750 2935668851 292
6 iso_pu_bacteria 2935694250 2935696871 292
7 iso_pu_bacteria 2935703347 2935709038 292
8 iso_pu_bacteria 2935801545 2935804768 292
9 iso_pu_bacteria 2935827899 2935832165 292
10 iso_pu_bacteria 2935837841 2935841005 292
11 iso_pu_bacteria 2935992306 2935995781 292
12 iso_pu_bacteria 2936002035 2936005692 292
13 iso_pu_bacteria 2941538514 2941541733 292
14 iso_pu_bacteria 8016511872 8016517363 292
15 iso_pu_bacteria 8017057580 8017059243 292
16 iso_pu_bacteria 8019576017 8019576389 292
17 iso_pu_bacteria 8019586578 8019594264 292
18 iso_pu_bacteria 8019608314 8019611216 292
19 3300046501 Ga0495607_0080098 Ga0495607_0080098_896_1780 294
20 3300050512 nmdc:mga0n895_82262_c1 nmdc:mga0n895_82262_c1_16_903 295
21 3300053153 Ga0500616_0053332 Ga0500616_0053332_356_1330 300
22 3300003752 Ga0055539_1000198 Ga0055539_10001987 301
23 3300003756 Ga0055533_1000008 Ga0055533_100000871 301
24 3300025226 Ga0209674_100015 Ga0209674_100015593 301
25 3300025230 Ga0209563_100017 Ga0209563_100017690 301
26 3300025253 Ga0209677_100037 Ga0209677_100037190 301
27 3300053103 Ga0500555_054662 Ga0500555_054662_64_1035 307
28 3300025302 Ga0207426_1038755 Ga0207426_10387551 315
29 iso_pu_bacteria 2884338543 2884338576 319
30 iso_pu_bacteria 2513237141 2513894975 320
31 iso_pu_bacteria 2808606384 2808967809 320
32 iso_pu_bacteria 2808606390 2809002640 320
33 iso_pu_bacteria 2808606391 2809009918 320
34 iso_pu_bacteria 2884693830 2884698378 320
35 iso_pu_bacteria 2895442618 2895450973 320
36 iso_pu_bacteria 8002775197 8002779042 320
37 iso_pu_bacteria 2510065045 2510247223 321
38 iso_pu_bacteria 2718217991 2719637760 321
39 3300005435 Ga0070714_100401543 Ga0070714_1004015432 322
40 3300025929 Ga0207664_10455706 Ga0207664_104557061 322
41 3300028786 Ga0307517_10165535 Ga0307517_101655351 322
42 3300046461 Ga0495641_0003545 Ga0495641_0003545_2967_4067 322
43 3300046462 Ga0495651_0054388 Ga0495651_0054388_1363_2394 322
44 3300046511 Ga0495608_0120055 Ga0495608_0120055_313_1413 322
45 3300046511 Ga0495608_0187056 Ga0495608_0187056_50_1027 322
46 3300046514 Ga0495618_0024796 Ga0495618_0024796_2458_3558 322
47 3300046515 Ga0495620_0036898 Ga0495620_0036898_121_1098 322
48 3300046529 Ga0495652_0000053 Ga0495652_0000053_58942_59919 322
49 3300046529 Ga0495652_0010056 Ga0495652_0010056_6495_7595 322
50 3300046543 Ga0495645_0010992 Ga0495645_0010992_1480_2457 322
51 3300046648 Ga0495611_0028480 Ga0495611_0028480_546_1523 322
52 3300046675 Ga0495657_0096933 Ga0495657_0096933_572_1672 322
53 3300046679 Ga0495623_0001410 Ga0495623_0001410_3744_4721 322
54 3300046690 Ga0495624_0037871 Ga0495624_0037871_1656_2756 322
55 3300047322 Ga0495680_0053803 Ga0495680_0053803_1557_2657 322
56 3300048088 Ga0495602_0001531 Ga0495602_0001531_7878_8978 322
57 3300048088 Ga0495602_0008341 Ga0495602_0008341_758_1735 322
58 3300048088 Ga0495602_0025460 Ga0495602_0025460_858_1841 322
59 3300002987 JGI25159J45721_1001461 JGI25159J45721_10014616 323
60 3300005335 Ga0070666_10046890 Ga0070666_100468903 323
61 3300005937 Ga0081455_10007078 Ga0081455_1000707811 323
62 3300005937 Ga0081455_10090105 Ga0081455_100901053 323
63 3300005983 Ga0081540_1050335 Ga0081540_10503352 323
64 3300006173 Ga0070716_100264715 Ga0070716_1002647151 323
65 3300006173 Ga0070716_100286309 Ga0070716_1002863091 323
66 3300006846 Ga0075430_100000103 Ga0075430_10000010322 323
67 3300006846 Ga0075430_100301746 Ga0075430_1003017462 323
68 3300006847 Ga0075431_100047408 Ga0075431_1000474082 323
69 3300006847 Ga0075431_100305820 Ga0075431_1003058202 323
70 3300006852 Ga0075433_10004526 Ga0075433_1000452621 323
71 3300006871 Ga0075434_100002179 Ga0075434_1000021796 323
72 3300006880 Ga0075429_100083425 Ga0075429_1000834252 323
73 3300006914 Ga0075436_100008918 Ga0075436_1000089184 323
74 3300007076 Ga0075435_100172842 Ga0075435_1001728421 323
75 3300009147 Ga0114129_10003672 Ga0114129_100036722 323
76 3300009147 Ga0114129_10013512 Ga0114129_100135122 323
77 3300009177 Ga0105248_10017622 Ga0105248_100176225 323
78 3300013105 Ga0157369_10051414 Ga0157369_100514145 323
79 3300025939 Ga0207665_10139496 Ga0207665_101394962 323
80 3300027907 Ga0207428_10290922 Ga0207428_102909222 323
81 3300035117 Ga0373953_0008528 Ga0373953_0008528_110_1081 323
82 3300035118 Ga0373954_0024699 Ga0373954_0024699_133_1104 323
83 3300035724 Ga0373933_0002554 Ga0373933_0002554_2562_3533 323
84 3300036401 Ga0373937_0014930 Ga0373937_0014930_3206_4177 323
85 3300041410 Ga0439461_0007096 Ga0439461_0007096_369_1340 323
86 3300041413 Ga0439465_0047137 Ga0439465_0047137_325_1296 323
87 3300041997 Ga0439431_0008242 Ga0439431_0008242_1065_2036 323
88 3300046454 Ga0495592_0001819 Ga0495592_0001819_13832_14803 323
89 3300046458 Ga0495591_003781 Ga0495591_003781_6210_7181 323
90 3300046459 Ga0495629_0008830 Ga0495629_0008830_5027_5998 323
91 3300046462 Ga0495651_0007548 Ga0495651_0007548_5149_6120 323
92 3300046472 Ga0495580_0004987 Ga0495580_0004987_3252_4223 323
93 3300046476 Ga0495662_0028414 Ga0495662_0028414_37_1008 323
94 3300046477 Ga0495664_0012693 Ga0495664_0012693_2368_3339 323
95 3300046500 Ga0495596_0012280 Ga0495596_0012280_522_1493 323
96 3300046511 Ga0495608_0001297 Ga0495608_0001297_15158_16129 323
97 3300046514 Ga0495618_0001439 Ga0495618_0001439_7566_8537 323
98 3300046516 Ga0495628_0006405 Ga0495628_0006405_2917_3888 323
99 3300046517 Ga0495630_0009569 Ga0495630_0009569_1848_2819 323
100 3300046524 Ga0495648_0002735 Ga0495648_0002735_8028_8999 323
101 3300046526 Ga0495666_0000120 Ga0495666_0000120_29027_29998 323
102 3300046531 Ga0495665_0005605 Ga0495665_0005605_4045_5016 323
103 3300046533 Ga0495640_0004132 Ga0495640_0004132_2913_3884 323
104 3300046536 Ga0495587_0002451 Ga0495587_0002451_10180_11151 323
105 3300046543 Ga0495645_0065319 Ga0495645_0065319_372_1343 323
106 3300046642 Ga0495634_0013209 Ga0495634_0013209_3782_4753 323
107 3300046663 Ga0495635_0007446 Ga0495635_0007446_5139_6110 323
108 3300046665 Ga0495661_0002143 Ga0495661_0002143_4023_4994 323
109 3300046678 Ga0495599_0010321 Ga0495599_0010321_1531_2502 323
110 3300046680 Ga0495646_0012954 Ga0495646_0012954_3978_4949 323
111 3300046689 Ga0495613_0002556 Ga0495613_0002556_155_1126 323
112 3300046690 Ga0495624_0006337 Ga0495624_0006337_5590_6561 323
113 3300046692 Ga0495671_0048255 Ga0495671_0048255_16_987 323
114 3300046794 Ga0495589_0004958 Ga0495589_0004958_1229_2200 323
115 3300046809 Ga0495600_0001350 Ga0495600_0001350_7526_8497 323
116 3300047317 Ga0495604_0014415 Ga0495604_0014415_3782_4753 323
117 3300047319 Ga0495674_0085728 Ga0495674_0085728_312_1283 323
118 3300047321 Ga0495676_0007408 Ga0495676_0007408_1905_2876 323
119 3300047322 Ga0495680_0040854 Ga0495680_0040854_1229_2200 323
120 3300047323 Ga0495683_0004809 Ga0495683_0004809_1610_2581 323
121 3300047444 Ga0495675_0014478 Ga0495675_0014478_2168_3139 323
122 3300047446 Ga0495679_001038 Ga0495679_001038_9498_10469 323
123 3300047469 Ga0495673_0005575 Ga0495673_0005575_978_1949 323
124 3300047472 Ga0495686_0001489 Ga0495686_0001489_7462_8433 323
125 3300047673 Ga0495593_0001773 Ga0495593_0001773_5193_6164 323
126 3300048088 Ga0495602_0128577 Ga0495602_0128577_700_1671 323
127 3300048089 Ga0495614_0004342 Ga0495614_0004342_761_1732 323
128 3300048920 Ga0496117_0137436 Ga0496117_0137436_318_1289 323
129 3300048921 Ga0496118_0010703 Ga0496118_0010703_17_988 323
130 3300048921 Ga0496118_0024599 Ga0496118_0024599_3575_4546 323
131 3300048924 Ga0496121_0000031 Ga0496121_0000031_78043_79014 323
132 3300048924 Ga0496121_0026825 Ga0496121_0026825_3363_4388 323
133 3300048929 Ga0496126_0000248 Ga0496126_0000248_107683_108654 323
134 3300049460 Ga0495682_0011031 Ga0495682_0011031_2280_3251 323
135 3300049581 Ga0501047_0039140 Ga0501047_0039140_2717_3688 323
136 3300050507 nmdc:mga05p37_287_c1 nmdc:mga05p37_287_c1_29245_30216 323
137 3300050507 nmdc:mga05p37_47997_c1 nmdc:mga05p37_47997_c1_1778_2749 323
138 3300050507 nmdc:mga05p37_524828_c1 nmdc:mga05p37_524828_c1_289_1263 323
139 3300050508 nmdc:mga09592_36965_c1 nmdc:mga09592_36965_c1_1346_2317 323
140 3300050510 nmdc:mga06r32_16650_c1 nmdc:mga06r32_16650_c1_4218_5231 323
141 3300050510 nmdc:mga06r32_99223_c1 nmdc:mga06r32_99223_c1_323_1387 323
142 3300050511 nmdc:mga08y16_312459_c1 nmdc:mga08y16_312459_c1_374_1438 323
143 3300050512 nmdc:mga0n895_3093_c1 nmdc:mga0n895_3093_c1_853_1824 323
144 3300050512 nmdc:mga0n895_624138_c1 nmdc:mga0n895_624138_c1_34_1005 323
145 3300050513 nmdc:mga0rr50_580_c1 nmdc:mga0rr50_580_c1_16335_17306 323
146 3300050514 nmdc:mga08x19_3433_c1 nmdc:mga08x19_3433_c1_6078_7049 323
147 3300050515 nmdc:mga0a205_234875_c1 nmdc:mga0a205_234875_c1_106_1080 323
148 3300050515 nmdc:mga0a205_5267_c1 nmdc:mga0a205_5267_c1_3963_4934 323
149 3300053077 Ga0495601_0091723 Ga0495601_0091723_754_1725 323
150 3300003320 rootH2_10029516 rootH2_100295162 324
151 3300005344 Ga0070661_100188820 Ga0070661_1001888202 324
152 3300005347 Ga0070668_100013220 Ga0070668_1000132205 324
153 3300005434 Ga0070709_10017593 Ga0070709_100175934 324
154 3300005436 Ga0070713_100434580 Ga0070713_1004345802 324
155 3300005437 Ga0070710_10066882 Ga0070710_100668821 324
156 3300005455 Ga0070663_100125960 Ga0070663_1001259602 324
157 3300005456 Ga0070678_100086688 Ga0070678_1000866882 324
158 3300005518 Ga0070699_100002556 Ga0070699_1000025565 324
159 3300005539 Ga0068853_100006217 Ga0068853_1000062172 324
160 3300005563 Ga0068855_100126946 Ga0068855_1001269463 324
161 3300005614 Ga0068856_100277413 Ga0068856_1002774131 324
162 3300005615 Ga0070702_100031655 Ga0070702_1000316551 324
163 3300005617 Ga0068859_100179153 Ga0068859_1001791533 324
164 3300005618 Ga0068864_100133290 Ga0068864_1001332902 324
165 3300005841 Ga0068863_100110774 Ga0068863_1001107743 324
166 3300005844 Ga0068862_100120833 Ga0068862_1001208332 324
167 3300005983 Ga0081540_1003695 Ga0081540_100369512 324
168 3300006038 Ga0075365_10056339 Ga0075365_100563393 324
169 3300006163 Ga0070715_10015037 Ga0070715_100150373 324
170 3300006175 Ga0070712_100081234 Ga0070712_1000812343 324
171 3300006237 Ga0097621_100043625 Ga0097621_1000436252 324
172 3300006847 Ga0075431_100159906 Ga0075431_1001599062 324
173 3300006871 Ga0075434_100041910 Ga0075434_1000419105 324
174 3300006931 Ga0097620_100179152 Ga0097620_1001791523 324
175 3300009098 Ga0105245_10121116 Ga0105245_101211162 324
176 3300009147 Ga0114129_10209027 Ga0114129_102090273 324
177 3300009177 Ga0105248_10028706 Ga0105248_100287066 324
178 3300013296 Ga0157374_10015445 Ga0157374_100154458 324
179 3300013297 Ga0157378_10040549 Ga0157378_100405494 324
180 3300013306 Ga0163162_10036214 Ga0163162_100362143 324
181 3300014325 Ga0163163_10071488 Ga0163163_100714882 324
182 3300021358 Ga0213873_10013951 Ga0213873_100139512 324
183 3300025901 Ga0207688_10022796 Ga0207688_100227962 324
184 3300025905 Ga0207685_10026547 Ga0207685_100265472 324
185 3300025910 Ga0207684_10042604 Ga0207684_100426042 324
186 3300025910 Ga0207684_10111646 Ga0207684_101116463 324
187 3300025915 Ga0207693_10195988 Ga0207693_101959882 324
188 3300025916 Ga0207663_10034967 Ga0207663_100349673 324
189 3300025927 Ga0207687_10024189 Ga0207687_100241893 324
190 3300025928 Ga0207700_10168001 Ga0207700_101680012 324
191 3300025939 Ga0207665_10004853 Ga0207665_100048539 324
192 3300025942 Ga0207689_10045660 Ga0207689_100456602 324
193 3300025945 Ga0207679_10080306 Ga0207679_100803063 324
194 3300025972 Ga0207668_10008929 Ga0207668_100089295 324
195 3300026041 Ga0207639_10133149 Ga0207639_101331492 324
196 3300026067 Ga0207678_10004789 Ga0207678_1000478911 324
197 3300026078 Ga0207702_10574806 Ga0207702_105748062 324
198 3300026095 Ga0207676_10053739 Ga0207676_100537393 324
199 3300026116 Ga0207674_10372623 Ga0207674_103726232 324
200 3300026121 Ga0207683_10074757 Ga0207683_100747573 324
201 3300039447 Ga0436361_0608376 Ga0436361_0608376_11257_12231 324
202 3300039447 Ga0436361_0655142 Ga0436361_0655142_938_1912 324
203 3300046472 Ga0495580_0006191 Ga0495580_0006191_1341_2315 324
204 3300048909 Ga0496106_0077201 Ga0496106_0077201_1074_2048 324
205 3300048915 Ga0496112_0081541 Ga0496112_0081541_824_1798 324
206 3300050510 nmdc:mga06r32_133646_c1 nmdc:mga06r32_133646_c1_1259_2233 324
207 3300005339 Ga0070660_100049920 Ga0070660_1000499204 325
208 3300005364 Ga0070673_100071927 Ga0070673_1000719271 325
209 3300005364 Ga0070673_100162669 Ga0070673_1001626692 325
210 3300005536 Ga0070697_100178276 Ga0070697_1001782762 325
211 3300006237 Ga0097621_100011572 Ga0097621_1000115724 325
212 3300009093 Ga0105240_10440037 Ga0105240_104400372 325
213 3300014969 Ga0157376_10006945 Ga0157376_100069459 325
214 3300021361 Ga0213872_10006196 Ga0213872_100061966 325
215 3300021361 Ga0213872_10006306 Ga0213872_100063065 325
216 3300025256 Ga0209759_1000546 Ga0209759_100054619 325
217 3300025256 Ga0209759_1015604 Ga0209759_10156042 325
218 3300025913 Ga0207695_10377586 Ga0207695_103775862 325
219 3300025919 Ga0207657_10075456 Ga0207657_100754563 325
220 3300025932 Ga0207690_10028947 Ga0207690_100289472 325
221 3300025960 Ga0207651_10031448 Ga0207651_100314484 325
222 3300035113 Ga0373936_0005503 Ga0373936_0005503_943_1920 325
223 3300039447 Ga0436361_0234917 Ga0436361_0234917_9808_10785 325
224 3300039447 Ga0436361_1092317 Ga0436361_1092317_200_1183 325
225 3300045049 Ga0466959_0031575 Ga0466959_0031575_1717_2694 325
226 3300046491 Ga0495584_0025245 Ga0495584_0025245_335_1357 325
227 3300046616 Ga0495668_0135124 Ga0495668_0135124_80_1102 325
228 3300053093 Ga0500651_0003992 Ga0500651_0003992_5927_6949 325
229 3300053119 Ga0500595_024699 Ga0500595_024699_633_1655 325
230 3300053130 Ga0500642_0012984 Ga0500642_0012984_105_1127 325
231 3300003316 rootH1_10030891 rootH1_100308912 326
232 3300009094 Ga0111539_10325442 Ga0111539_103254422 326
233 3300035083 Ga0373926_0018747 Ga0373926_0018747_1133_2113 326
234 3300035086 Ga0373934_0001299 Ga0373934_0001299_3622_4602 326
235 3300035111 Ga0373923_0002539 Ga0373923_0002539_2236_3216 326
236 3300035113 Ga0373936_0006741 Ga0373936_0006741_3299_4279 326
237 3300035117 Ga0373953_0021818 Ga0373953_0021818_291_1271 326
238 3300035118 Ga0373954_0007777 Ga0373954_0007777_3024_4004 326
239 3300035119 Ga0373956_0006192 Ga0373956_0006192_1874_2854 326
240 3300035120 Ga0373957_0002784 Ga0373957_0002784_1767_2747 326
241 3300035172 Ga0373955_0004202 Ga0373955_0004202_5084_6064 326
242 3300035410 Ga0373924_0007436 Ga0373924_0007436_2263_3243 326
243 3300035692 Ga0373935_0023905 Ga0373935_0023905_2697_3677 326
244 3300035692 Ga0373935_0167448 Ga0373935_0167448_379_1359 326
245 3300035695 Ga0373927_0000681 Ga0373927_0000681_14010_14990 326
246 3300035724 Ga0373933_0005054 Ga0373933_0005054_3569_4549 326
247 3300036401 Ga0373937_0037885 Ga0373937_0037885_1009_1989 326
248 3300044658 Ga0466972_0006924 Ga0466972_0006924_1523_2503 326
249 3300044706 Ga0466964_0027080 Ga0466964_0027080_570_1550 326
250 3300046454 Ga0495592_0099783 Ga0495592_0099783_82_1062 326
251 3300046461 Ga0495641_0009415 Ga0495641_0009415_2495_3475 326
252 3300046462 Ga0495651_0023758 Ga0495651_0023758_1874_2854 326
253 3300046472 Ga0495580_0031706 Ga0495580_0031706_120_1100 326
254 3300046472 Ga0495580_0111660 Ga0495580_0111660_189_1169 326
255 3300046473 Ga0495582_0082424 Ga0495582_0082424_89_1069 326
256 3300046476 Ga0495662_0013524 Ga0495662_0013524_1310_2290 326
257 3300046477 Ga0495664_0035470 Ga0495664_0035470_1668_2648 326
258 3300046506 Ga0495583_0000324 Ga0495583_0000324_64738_65718 326
259 3300046507 Ga0495606_0000487 Ga0495606_0000487_45622_46602 326
260 3300046511 Ga0495608_0023894 Ga0495608_0023894_1398_2378 326
261 3300046514 Ga0495618_0049214 Ga0495618_0049214_1631_2611 326
262 3300046516 Ga0495628_0014087 Ga0495628_0014087_2987_3967 326
263 3300046517 Ga0495630_0000680 Ga0495630_0000680_5424_6404 326
264 3300046526 Ga0495666_0008970 Ga0495666_0008970_1990_2970 326
265 3300046529 Ga0495652_0084959 Ga0495652_0084959_712_1692 326
266 3300046533 Ga0495640_0044716 Ga0495640_0044716_324_1304 326
267 3300046535 Ga0495586_0050930 Ga0495586_0050930_1137_2117 326
268 3300046536 Ga0495587_0006299 Ga0495587_0006299_4793_5773 326
269 3300046557 Ga0495622_0035604 Ga0495622_0035604_179_1159 326
270 3300046559 Ga0495667_0008689 Ga0495667_0008689_2344_3324 326
271 3300046616 Ga0495668_0015708 Ga0495668_0015708_2923_3903 326
272 3300046642 Ga0495634_0039485 Ga0495634_0039485_1662_2642 326
273 3300046660 Ga0495625_0008790 Ga0495625_0008790_2958_3938 326
274 3300046675 Ga0495657_0021121 Ga0495657_0021121_1926_2906 326
275 3300046678 Ga0495599_0008117 Ga0495599_0008117_3645_4625 326
276 3300046681 Ga0495647_0006453 Ga0495647_0006453_1726_2706 326
277 3300046683 Ga0495658_0066405 Ga0495658_0066405_780_1760 326
278 3300046689 Ga0495613_0044380 Ga0495613_0044380_1301_2281 326
279 3300046694 Ga0495649_0000207 Ga0495649_0000207_38656_39636 326
280 3300046809 Ga0495600_0008438 Ga0495600_0008438_1726_2706 326
281 3300047317 Ga0495604_0033153 Ga0495604_0033153_2298_3278 326
282 3300047319 Ga0495674_0021493 Ga0495674_0021493_4486_5466 326
283 3300047322 Ga0495680_0037221 Ga0495680_0037221_503_1483 326
284 3300047323 Ga0495683_0043337 Ga0495683_0043337_33_1013 326
285 3300047444 Ga0495675_0247893 Ga0495675_0247893_17_997 326
286 3300047471 Ga0495684_0007374 Ga0495684_0007374_1137_2117 326
287 3300053080 Ga0500635_0000041 Ga0500635_0000041_44577_45572 326
288 3300053084 Ga0495595_0016594 Ga0495595_0016594_671_1651 326
289 3300053085 Ga0495619_0013478 Ga0495619_0013478_2379_3359 326
290 3300053086 Ga0500578_0074417 Ga0500578_0074417_166_1146 326
291 3300055283 Ga0500661_003427 Ga0500661_003427_1824_2804 326
292 3300005536 Ga0070697_100173498 Ga0070697_1001734982 327
293 3300037471 Ga0395905_0000484 Ga0395905_0000484_30273_31256 327
294 3300001915 JGI24741J21665_1000095 JGI24741J21665_100009520 328
295 3300001979 JGI24740J21852_10000562 JGI24740J21852_100005628 328
296 3300002705 JGI25156J39149_1007937 JGI25156J39149_10079372 328
297 3300003751 Ga0055538_1002454 Ga0055538_10024543 328
298 3300003752 Ga0055539_1000095 Ga0055539_100009532 328
299 3300003756 Ga0055533_1003885 Ga0055533_10038852 328
300 3300003759 Ga0055525_1000281 Ga0055525_100028121 328
301 3300003841 Ga0055541_1004348 Ga0055541_10043482 328
302 3300005344 Ga0070661_100000301 Ga0070661_10000030126 328
303 3300005455 Ga0070663_100000025 Ga0070663_10000002538 328
304 3300005564 Ga0070664_100000020 Ga0070664_10000002056 328
305 3300005577 Ga0068857_100150880 Ga0068857_1001508802 328
306 3300005614 Ga0068856_100053049 Ga0068856_1000530492 328
307 3300013100 Ga0157373_10011170 Ga0157373_100111707 328
308 3300013102 Ga0157371_10000082 Ga0157371_1000008270 328
309 3300013104 Ga0157370_10000423 Ga0157370_1000042334 328
310 3300013307 Ga0157372_10000122 Ga0157372_1000012284 328
311 3300025224 Ga0209784_100055 Ga0209784_100055124 328
312 3300025224 Ga0209784_100466 Ga0209784_1004663 328
313 3300025225 Ga0209566_100002 Ga0209566_1000022429 328
314 3300025226 Ga0209674_100090 Ga0209674_10009062 328
315 3300025230 Ga0209563_100095 Ga0209563_10009548 328
316 3300025230 Ga0209563_100198 Ga0209563_10019832 328
317 3300025253 Ga0209677_100069 Ga0209677_10006929 328
318 3300025256 Ga0209759_1010266 Ga0209759_10102662 328
319 3300025920 Ga0207649_10000065 Ga0207649_1000006526 328
320 3300025945 Ga0207679_10000028 Ga0207679_1000002869 328
321 3300026067 Ga0207678_10000136 Ga0207678_1000013626 328
322 3300026078 Ga0207702_10000149 Ga0207702_1000014915 328
323 3300026116 Ga0207674_10323681 Ga0207674_103236812 328
324 3300044684 Ga0466966_0002962 Ga0466966_0002962_1145_2134 328
325 3300044693 Ga0466961_0004789 Ga0466961_0004789_2071_3060 328
326 3300044765 Ga0466970_0017793 Ga0466970_0017793_1445_2434 328
327 3300045049 Ga0466959_0027154 Ga0466959_0027154_2919_3908 328
328 3300048928 Ga0496125_0015121 Ga0496125_0015121_2588_3574 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

67

152

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

196

320

0.81

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

220

363

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.8909 1 325
1wly-assembly1.cif.gz_A crystal structure of 2-haloacrylate reductase 0.8793 1 328
1wly-assembly1.cif.gz_A crystal structure of 2-haloacrylate reductase 0.8768 1 328
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.8761 1 325
8j6e-assembly1.cif.gz_A structure insights into the nadph quinone oxidoreductase from leishmania donovani 0.8754 2 328
ID Description Score Start End Superfamily
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.905 127 249 3.40.50.720
4rvuB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9034 126 265 3.40.50.720
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9032 126 265 3.40.50.720
af_P96826_2_321_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9006 2 325 3.30.360.10
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8996 2 115 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A427Y2Z1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9675 2 325 GO:0016651
GO:0070402
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.954 124 235 GO:0016491
AF-A0A428U2E7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9504 1 325 GO:0016491
AF-A0A6I8LGR2-F1-model_v4 NADPH:quinone reductase related Zn-dependent oxidoreductase 0.945 1 325 GO:0016651
GO:0070402
AF-A0A427Y2Z1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9445 2 325 GO:0016651
GO:0070402

Feature Viewer

pLDDT pTM Quality
92.6 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map