F409374

General Info

Members Datasets Scaffolds Average Seq Length
328 203 656 242

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0003977|Ga0495603_0003977_6048_6851
Length 267
Sequence VSASGLVRDHTVYSCVMGSRAFGLATDGSDTDRRGVFLAPTALFWRFEKPPTHVEGPAEEQFSWELERFCALALRANPNILECLHSPLVEYADDTGRELLALRQAFLSRRAHETFARYAVGQRKKLEADVRTHGAPRWKHAMHLLRLLMSSRDLLRTGSLTIDVREQREPLLAVKRGEVSWGEVETWMSRLATEAAEAAGRSPLPPEPDHARVEDFLIRVRRASALQDADAVLADPGTGRSSPGAVEADPDDEVVQSVVRGRGVRQR

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
25 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
29 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
30 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
31 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
32 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
33 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
34 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
35 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
36 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
37 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
38 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
39 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
40 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
153 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
154 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
155 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
156 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
164 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
165 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
166 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
167 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
168 2643221548 Streptomyces sp. Root55 Isolate Unclassified
169 2643221578 Streptomyces sp. Root63 Isolate Unclassified
170 2643221670 Streptomyces sp. Root431 Isolate Unclassified
171 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
172 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
173 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
174 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
175 2808606448 Streptomyces sp. 193411 Isolate Unclassified
176 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
177 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
178 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
179 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
180 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
181 2862574272 Streptomyces sp. AcE210 Isolate Nodule
182 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
183 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
184 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
185 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
186 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
187 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
188 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
189 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
190 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
191 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
192 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
193 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
194 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
195 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
196 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
197 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
198 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
199 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
200 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
201 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
202 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
203 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.89
Metatranscriptomes 0.61
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0.91
Rhizoplane 1.22
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0003977 3300046455 Bacteria 8804
2 JGI24739J22299_10055904 3300001989 Bacteria 1260
3 JGI24737J22298_10009698 3300001990 Bacteria 3192
4 JGI24738J21930_10021161 3300002075 Bacteria 1350
5 Ga0006562J51391_1069085 3300003578 Bacteria 2230
6 Ga0006562J51391_1069088 3300003578 Bacteria 1170
7 Ga0070681_10299896 3300005458 Bacteria 1517
8 Ga0081455_10033245 3300005937 Bacteria 4637
9 Ga0105251_10178524 3300009011 Bacteria 956
10 Ga0105244_10054141 3300009036 Bacteria 2037
11 Ga0105246_10015054 3300011119 Bacteria 4875
12 Ga0157369_10274029 3300013105 Bacteria 1758
13 Ga0157372_10199482 3300013307 Bacteria 2318
14 Ga0207426_1004219 3300025302 Bacteria 7147
15 Ga0207647_10009943 3300025904 Bacteria 6738
16 Ga0207691_10290755 3300025940 Bacteria 1405
17 Ga0307517_10001681 3300028786 Bacteria 36578
18 Ga0307515_10000544 3300028794 Bacteria 88859
19 Ga0307515_10034544 3300028794 Bacteria 8270
20 Ga0307511_10000584 3300030521 Bacteria 39032
21 Ga0307511_10186007 3300030521 Bacteria 1108
22 Ga0307512_10001375 3300030522 Bacteria 34556
23 Ga0307512_10069359 3300030522 Bacteria 2636
24 Ga0307513_10011667 3300031456 Bacteria 10903
25 Ga0307509_10040125 3300031507 Bacteria 5093
26 Ga0307509_10068109 3300031507 Bacteria 3725
27 Ga0307509_10151142 3300031507 Bacteria 2237
28 Ga0307508_10014111 3300031616 Bacteria 7289
29 Ga0307508_10165045 3300031616 Bacteria 1818
30 Ga0307516_10009612 3300031730 Bacteria 10765
31 Ga0307518_10053702 3300031838 Bacteria 2928
32 Ga0307518_10109112 3300031838 Bacteria 1973
33 Ga0307409_100278353 3300031995 Bacteria 1545
34 Ga0307507_10020768 3300033179 Bacteria 7337
35 Ga0307507_10036257 3300033179 Bacteria 5045
36 Ga0307510_10031922 3300033180 Bacteria 5941
37 Ga0307510_10059356 3300033180 Bacteria 3951
38 Ga0307510_10189075 3300033180 Bacteria 1609
39 Ga0439436_0001841 3300041404 Bacteria 6260
40 Ga0451791_1622916 3300041451 Bacteria 1932
41 Ga0451853_0533830 3300041512 Bacteria 4048
42 Ga0439433_0006730 3300041999 Bacteria 2475
43 Ga0439432_037851 3300042006 Bacteria 1538
44 Ga0439449_0130124 3300042007 Bacteria 935
45 Ga0439457_000036 3300042014 Bacteria 28398
46 Ga0450894_000736 3300042131 Bacteria 5395
47 Ga0450898_007926 3300042134 Bacteria 1663
48 Ga0450899_004035 3300042135 Bacteria 1573
49 Ga0450899_005719 3300042135 Bacteria 1338
50 Ga0450908_025684 3300042184 Bacteria 1028
51 Ga0466969_0007123 3300044656 Bacteria 5953
52 Ga0466972_0010571 3300044658 Bacteria 4632
53 Ga0466965_0002912 3300044683 Bacteria 7398
54 Ga0466966_0003500 3300044684 Bacteria 10355
55 Ga0466961_0003805 3300044693 Bacteria 9442
56 Ga0466963_0000252 3300044694 Bacteria 23516
57 Ga0466964_0010111 3300044706 Bacteria 3556
58 Ga0466971_0000928 3300044719 Bacteria 12038
59 Ga0466970_0004837 3300044765 Bacteria 6644
60 Ga0466957_0001360 3300044842 Bacteria 12764
61 Ga0466959_0001407 3300045049 Bacteria 14698
62 Ga0466958_0001780 3300045836 Bacteria 10445
63 Ga0466967_0060878 3300045976 Bacteria 3348
64 Ga0495592_0008656 3300046454 Bacteria 7640
65 Ga0495603_0000645 3300046455 Bacteria 19643
66 Ga0495603_0001256 3300046455 Bacteria 14795
67 Ga0495603_0002198 3300046455 Bacteria 11484
68 Ga0495603_0013705 3300046455 Bacteria 4905
69 Ga0495603_0023368 3300046455 Bacteria 3742
70 Ga0495603_0076220 3300046455 Bacteria 1968
71 Ga0495590_0143514 3300046457 Bacteria 863
72 Ga0495629_0001740 3300046459 Bacteria 17065
73 Ga0495629_0005592 3300046459 Bacteria 9384
74 Ga0495629_0010156 3300046459 Bacteria 6863
75 Ga0495629_0025600 3300046459 Bacteria 4192
76 Ga0495629_0026910 3300046459 Bacteria 4085
77 Ga0495629_0035578 3300046459 Bacteria 3519
78 Ga0495629_0078170 3300046459 Bacteria 2310
79 Ga0495629_0109799 3300046459 Bacteria 1923
80 Ga0495638_0187344 3300046460 Bacteria 1176
81 Ga0495651_0018017 3300046462 Bacteria 5468
82 Ga0495651_0020870 3300046462 Bacteria 5085
83 Ga0495651_0038125 3300046462 Bacteria 3742
84 Ga0495582_0071819 3300046473 Bacteria 1915
85 Ga0495605_0007596 3300046474 Bacteria 6147
86 Ga0495605_0161914 3300046474 Bacteria 993
87 Ga0495639_0011394 3300046475 Bacteria 3834
88 Ga0495662_0006466 3300046476 Bacteria 5851
89 Ga0495662_0012960 3300046476 Bacteria 4061
90 Ga0495664_0252490 3300046477 Bacteria 1066
91 Ga0495585_0062800 3300046492 Bacteria 2039
92 Ga0495585_0199767 3300046492 Bacteria 1019
93 Ga0495594_0003027 3300046499 Bacteria 8710
94 Ga0495594_0012155 3300046499 Bacteria 4483
95 Ga0495594_0014807 3300046499 Bacteria 4092
96 Ga0495594_0059662 3300046499 Bacteria 2110
97 Ga0495594_0072922 3300046499 Bacteria 1910
98 Ga0495596_0030642 3300046500 Bacteria 2152
99 Ga0495583_0029904 3300046506 Bacteria 2660
100 Ga0495606_0006425 3300046507 Bacteria 10844
101 Ga0495606_0373160 3300046507 Bacteria 750
102 Ga0495608_0079504 3300046511 Bacteria 2132
103 Ga0495616_0009613 3300046513 Bacteria 5641
104 Ga0495618_0131820 3300046514 Bacteria 1599
105 Ga0495620_0027862 3300046515 Bacteria 2636
106 Ga0495620_0028253 3300046515 Bacteria 2611
107 Ga0495628_0018233 3300046516 Bacteria 5819
108 Ga0495628_0051038 3300046516 Bacteria 3271
109 Ga0495628_0073672 3300046516 Bacteria 2660
110 Ga0495628_0115814 3300046516 Bacteria 2058
111 Ga0495630_0067754 3300046517 Bacteria 2683
112 Ga0495630_0165818 3300046517 Bacteria 1682
113 Ga0495631_0025033 3300046518 Bacteria 2751
114 Ga0495631_0110132 3300046518 Bacteria 1184
115 Ga0495643_0042915 3300046522 Bacteria 2462
116 Ga0495644_0069139 3300046523 Bacteria 1327
117 Ga0495648_0127522 3300046524 Bacteria 1357
118 Ga0495666_0046469 3300046526 Bacteria 2093
119 Ga0495652_0010007 3300046529 Bacteria 8595
120 Ga0495652_0050913 3300046529 Bacteria 3539
121 Ga0495652_0072494 3300046529 Bacteria 2870
122 Ga0495654_0033886 3300046530 Bacteria 2581
123 Ga0495640_0015323 3300046533 Bacteria 5771
124 Ga0495640_0050545 3300046533 Bacteria 2863
125 Ga0495586_0013489 3300046535 Bacteria 4335
126 Ga0495587_0006754 3300046536 Bacteria 7471
127 Ga0495597_0073769 3300046542 Bacteria 1466
128 Ga0495645_0043495 3300046543 Bacteria 3276
129 Ga0495622_0010679 3300046557 Bacteria 4236
130 Ga0495633_0027352 3300046558 Bacteria 2788
131 Ga0495667_0081596 3300046559 Bacteria 2102
132 Ga0495667_0162306 3300046559 Bacteria 1437
133 Ga0495668_0012167 3300046616 Bacteria 5114
134 Ga0495668_0092106 3300046616 Bacteria 1660
135 Ga0495634_0001367 3300046642 Bacteria 22125
136 Ga0495634_0013634 3300046642 Bacteria 5871
137 Ga0495634_0074981 3300046642 Bacteria 2222
138 Ga0495611_0087858 3300046648 Bacteria 1435
139 Ga0495625_0006079 3300046660 Bacteria 10831
140 Ga0495625_0021785 3300046660 Bacteria 4923
141 Ga0495625_0212443 3300046660 Bacteria 1271
142 Ga0495635_0002384 3300046663 Bacteria 12796
143 Ga0495635_0020280 3300046663 Bacteria 4631
144 Ga0495588_0009759 3300046674 Bacteria 4450
145 Ga0495588_0032886 3300046674 Bacteria 2616
146 Ga0495588_0057560 3300046674 Bacteria 2008
147 Ga0495657_0008917 3300046675 Bacteria 7637
148 Ga0495657_0012100 3300046675 Bacteria 6420
149 Ga0495657_0013710 3300046675 Bacteria 5970
150 Ga0495657_0018343 3300046675 Bacteria 5068
151 Ga0495657_0039823 3300046675 Bacteria 3227
152 Ga0495657_0136563 3300046675 Bacteria 1531
153 Ga0495623_0089553 3300046679 Bacteria 1891
154 Ga0495646_0000565 3300046680 Bacteria 20093
155 Ga0495646_0195151 3300046680 Bacteria 1105
156 Ga0495658_0034698 3300046683 Bacteria 2770
157 Ga0495658_0149399 3300046683 Bacteria 1434
158 Ga0495613_0000902 3300046689 Bacteria 22826
159 Ga0495613_0004703 3300046689 Bacteria 10243
160 Ga0495613_0007538 3300046689 Bacteria 8099
161 Ga0495613_0010349 3300046689 Bacteria 6928
162 Ga0495613_0061882 3300046689 Bacteria 2740
163 Ga0495613_0123056 3300046689 Bacteria 1861
164 Ga0495613_0130136 3300046689 Bacteria 1802
165 Ga0495613_0328412 3300046689 Bacteria 1054
166 Ga0495624_0072957 3300046690 Bacteria 2134
167 Ga0495624_0172522 3300046690 Bacteria 1319
168 Ga0495670_0261166 3300046691 Bacteria 924
169 Ga0495671_0008163 3300046692 Bacteria 5907
170 Ga0495649_0106708 3300046694 Bacteria 1486
171 Ga0495589_0017473 3300046794 Bacteria 3681
172 Ga0495589_0019311 3300046794 Bacteria 3496
173 Ga0495589_0033629 3300046794 Bacteria 2573
174 Ga0495589_0120453 3300046794 Bacteria 1263
175 Ga0495600_0009081 3300046809 Bacteria 6132
176 Ga0495600_0014050 3300046809 Bacteria 5042
177 Ga0495660_0078111 3300046810 Bacteria 1740
178 Ga0495660_0132422 3300046810 Bacteria 1249
179 Ga0495581_0002415 3300047315 Bacteria 10549
180 Ga0495581_0043577 3300047315 Bacteria 2595
181 Ga0495604_0000467 3300047317 Bacteria 35655
182 Ga0495604_0049703 3300047317 Bacteria 3256
183 Ga0495604_0089962 3300047317 Bacteria 2280
184 Ga0495604_0180603 3300047317 Bacteria 1476
185 Ga0495636_0002199 3300047318 Bacteria 7483
186 Ga0495636_0009780 3300047318 Bacteria 3776
187 Ga0495636_0013349 3300047318 Bacteria 3260
188 Ga0495636_0059990 3300047318 Bacteria 1607
189 Ga0495676_0001932 3300047321 Bacteria 18181
190 Ga0495676_0006825 3300047321 Bacteria 10495
191 Ga0495676_0019228 3300047321 Bacteria 6009
192 Ga0495676_0019628 3300047321 Bacteria 5943
193 Ga0495676_0036682 3300047321 Bacteria 4090
194 Ga0495676_0055461 3300047321 Bacteria 3141
195 Ga0495676_0058800 3300047321 Bacteria 3022
196 Ga0495676_0242050 3300047321 Bacteria 1235
197 Ga0495676_0343755 3300047321 Bacteria 998
198 Ga0495680_0072409 3300047322 Bacteria 2621
199 Ga0495687_002131 3300047443 Bacteria 16543
200 Ga0495687_003185 3300047443 Bacteria 12198
201 Ga0495687_063822 3300047443 Bacteria 1506
202 Ga0495675_0010206 3300047444 Bacteria 5860
203 Ga0495675_0040369 3300047444 Bacteria 2974
204 Ga0495675_0120750 3300047444 Bacteria 1632
205 Ga0495677_0010204 3300047445 Bacteria 3454
206 Ga0495685_012108 3300047447 Bacteria 2918
207 Ga0495685_029129 3300047447 Bacteria 1899
208 Ga0495685_035709 3300047447 Bacteria 1707
209 Ga0495685_057647 3300047447 Bacteria 1311
210 Ga0495681_0019835 3300047470 Bacteria 3659
211 Ga0495681_0037626 3300047470 Bacteria 2381
212 Ga0495684_0126731 3300047471 Bacteria 1920
213 Ga0495684_0287399 3300047471 Bacteria 1185
214 Ga0495686_0031824 3300047472 Bacteria 3417
215 Ga0495593_0003049 3300047673 Bacteria 10095
216 Ga0495593_0046559 3300047673 Bacteria 2310
217 Ga0495593_0070157 3300047673 Bacteria 1821
218 Ga0495593_0077407 3300047673 Bacteria 1723
219 Ga0495602_0025014 3300048088 Bacteria 5785
220 Ga0495614_0000065 3300048089 Bacteria 34118
221 Ga0495614_0004099 3300048089 Bacteria 6558
222 Ga0495614_0009822 3300048089 Bacteria 4227
223 Ga0495614_0018691 3300048089 Bacteria 3001
224 Ga0496105_0053046 3300048908 Bacteria 3349
225 Ga0496108_0978645 3300048911 Bacteria 723
226 Ga0496109_0079148 3300048912 Bacteria 3028
227 Ga0495682_0024153 3300049460 Bacteria 2268
228 Ga0501031_0001586 3300049568 Bacteria 14185
229 Ga0501031_0017709 3300049568 Bacteria 4632
230 Ga0501032_0004433 3300049569 Bacteria 10582
231 Ga0501032_0140277 3300049569 Bacteria 1592
232 Ga0501034_0006556 3300049571 Bacteria 12502
233 Ga0501034_0009171 3300049571 Bacteria 10378
234 Ga0501036_0020757 3300049572 Bacteria 5517
235 Ga0501036_0118401 3300049572 Bacteria 2237
236 Ga0501037_0002604 3300049573 Bacteria 13016
237 Ga0501038_0003349 3300049574 Bacteria 14946
238 Ga0501041_0008113 3300049577 Bacteria 6183
239 Ga0501043_0003438 3300049579 Bacteria 13006
240 Ga0501043_0199113 3300049579 Bacteria 1555
241 Ga0501043_0368298 3300049579 Bacteria 1089
242 Ga0501046_0034300 3300049580 Bacteria 4096
243 Ga0501046_0134120 3300049580 Bacteria 1877
244 Ga0501047_0005369 3300049581 Bacteria 12041
245 Ga0501047_0013690 3300049581 Bacteria 7700
246 Ga0501047_0052970 3300049581 Bacteria 3922
247 Ga0501047_0065526 3300049581 Bacteria 3502
248 Ga0501047_0356745 3300049581 Bacteria 1298
249 Ga0501048_0025909 3300049582 Bacteria 4272
250 Ga0501067_0008423 3300049583 Bacteria 5722
251 Ga0501068_0000620 3300049584 Bacteria 18087
252 Ga0501069_0008921 3300049585 Bacteria 5287
253 Ga0501069_0272899 3300049585 Bacteria 989
254 Ga0501071_0006494 3300049587 Bacteria 7589
255 Ga0501072_0006507 3300049588 Bacteria 8897
256 Ga0501075_0297879 3300049591 Bacteria 1229
257 Ga0501076_0081371 3300049592 Bacteria 2600
258 Ga0501077_0076005 3300049593 Bacteria 2127
259 Ga0501079_0000640 3300049741 Bacteria 23320
260 Ga0501080_0051983 3300049742 Bacteria 3813
261 Ga0501080_0116940 3300049742 Bacteria 2471
262 Ga0501083_0002591 3300049744 Bacteria 12445
263 Ga0501035_0003540 3300049822 Bacteria 14913
264 Ga0501035_0032311 3300049822 Bacteria 4762
265 Ga0501035_0069351 3300049822 Bacteria 3126
266 Ga0501035_0517617 3300049822 Bacteria 980
267 Ga0501044_0003290 3300049823 Bacteria 18196
268 Ga0501044_0009258 3300049823 Bacteria 10759
269 Ga0501044_0014601 3300049823 Bacteria 8469
270 Ga0501044_0058652 3300049823 Bacteria 3946
271 Ga0501044_0638751 3300049823 Bacteria 954
272 Ga0501045_0051370 3300049824 Bacteria 3008
273 Ga0501045_0487076 3300049824 Bacteria 916
274 Ga0495655_0062624 3300053083 Bacteria 1019
275 Ga0500644_0051697 3300053088 Bacteria 1412
276 Ga0500647_0067098 3300053091 Bacteria 1725
277 Ga0500640_010176 3300053095 Bacteria 3791
278 Ga0500560_037675 3300053107 Bacteria 1500
279 Ga0500560_137135 3300053107 Bacteria 817
280 Ga0500614_003125 3300053123 Bacteria 3595
281 Ga0500600_0152006 3300053149 Bacteria 1150
282 Ga0500636_0196098 3300053177 Bacteria 1072
283 Ga0500565_026617 3300053734 Bacteria 735
284 Ga0501084_0020499 3300054114 Bacteria 5513
285 Ga0501082_0029892 3300060353 Bacteria 4693
286 Ga0466962_0000087 3300061719 Bacteria 37548
287 Ga0530510_0027111 3300061734 Bacteria 4104
288 2547406805 2547132111 Bacteria 8013147
289 2585296695 2582581312 Bacteria 7308206
290 2585315416 2582581314 Bacteria 11452267
291 2616695969 2616644814 Bacteria 11555299
292 2616900499 2616644941 Bacteria 8510691
293 2643759888 2643221548 Bacteria 8053412
294 2643904775 2643221578 Bacteria 9213798
295 2644389413 2643221670 Bacteria 6497041
296 2644405959 2643221673 Bacteria 9196637
297 2644460416 2643221682 Bacteria 6743283
298 2785345404 2784746763 Bacteria 9783172
299 2808918731 2808606375 Bacteria 9466072
300 2809230576 2808606448 Bacteria 8656184
301 2812482089 2811994917 Bacteria 7761064
302 2862180388 2862178590 Bacteria 8583590
303 2862294111 2862290372 Bacteria 7471434
304 2862390917 2862382967 Bacteria 10317375
305 2862513014 2862507626 Bacteria 9425308
306 2862583377 2862574272 Bacteria 10567477
307 2863406665 2863404153 Bacteria 9672205
308 2875392963 2875391855 Bacteria 7600475
309 2935396390 2935390628 Bacteria 7043367
310 2946051730 2946045630 Bacteria 8527308
311 2947231527 2947224130 Bacteria 9938529
312 2954010738 2954002825 Bacteria 9173742
313 2966604094 2966598605 Bacteria 7676064
314 2990065363 2990059506 Bacteria 9321252
315 2997454036 2997451912 Bacteria 8492419
316 3006326041 3006321560 Bacteria 8247479
317 3006399676 3006393351 Bacteria 6615579
318 3006487805 3006486233 Bacteria 8157040
319 3006495326 3006493962 Bacteria 8825450
320 8008561644 8008558824 Bacteria 10610750
321 8008580467 8008574985 Bacteria 7815457
322 8023624638 8023623736 Bacteria 8593882
323 8025416464 8025413630 Bacteria 7014048
324 8025479330 8025478263 Bacteria 8209203
325 8025536963 8025530807 Bacteria 8495698
326 8048412014 8048406513 Bacteria 8936924
327 8056450915 8056447290 Bacteria 7680491
328 8056835397 8056829672 Bacteria 9045328
329 Ga0495603_0003977
330 JGI24739J22299_10055904
331 JGI24737J22298_10009698
332 JGI24738J21930_10021161
333 Ga0006562J51391_1069085
334 Ga0006562J51391_1069088
335 Ga0070681_10299896
336 Ga0081455_10033245
337 Ga0105251_10178524
338 Ga0105244_10054141
339 Ga0105246_10015054
340 Ga0157369_10274029
341 Ga0157372_10199482
342 Ga0207426_1004219
343 Ga0207647_10009943
344 Ga0207691_10290755
345 Ga0307517_10001681
346 Ga0307515_10000544
347 Ga0307515_10034544
348 Ga0307511_10000584
349 Ga0307511_10186007
350 Ga0307512_10001375
351 Ga0307512_10069359
352 Ga0307513_10011667
353 Ga0307509_10040125
354 Ga0307509_10068109
355 Ga0307509_10151142
356 Ga0307508_10014111
357 Ga0307508_10165045
358 Ga0307516_10009612
359 Ga0307518_10053702
360 Ga0307518_10109112
361 Ga0307409_100278353
362 Ga0307507_10020768
363 Ga0307507_10036257
364 Ga0307510_10031922
365 Ga0307510_10059356
366 Ga0307510_10189075
367 Ga0439436_0001841
368 Ga0451791_1622916
369 Ga0451853_0533830
370 Ga0439433_0006730
371 Ga0439432_037851
372 Ga0439449_0130124
373 Ga0439457_000036
374 Ga0450894_000736
375 Ga0450898_007926
376 Ga0450899_004035
377 Ga0450899_005719
378 Ga0450908_025684
379 Ga0466969_0007123
380 Ga0466972_0010571
381 Ga0466965_0002912
382 Ga0466966_0003500
383 Ga0466961_0003805
384 Ga0466963_0000252
385 Ga0466964_0010111
386 Ga0466971_0000928
387 Ga0466970_0004837
388 Ga0466957_0001360
389 Ga0466959_0001407
390 Ga0466958_0001780
391 Ga0466967_0060878
392 Ga0495592_0008656
393 Ga0495603_0000645
394 Ga0495603_0001256
395 Ga0495603_0002198
396 Ga0495603_0013705
397 Ga0495603_0023368
398 Ga0495603_0076220
399 Ga0495590_0143514
400 Ga0495629_0001740
401 Ga0495629_0005592
402 Ga0495629_0010156
403 Ga0495629_0025600
404 Ga0495629_0026910
405 Ga0495629_0035578
406 Ga0495629_0078170
407 Ga0495629_0109799
408 Ga0495638_0187344
409 Ga0495651_0018017
410 Ga0495651_0020870
411 Ga0495651_0038125
412 Ga0495582_0071819
413 Ga0495605_0007596
414 Ga0495605_0161914
415 Ga0495639_0011394
416 Ga0495662_0006466
417 Ga0495662_0012960
418 Ga0495664_0252490
419 Ga0495585_0062800
420 Ga0495585_0199767
421 Ga0495594_0003027
422 Ga0495594_0012155
423 Ga0495594_0014807
424 Ga0495594_0059662
425 Ga0495594_0072922
426 Ga0495596_0030642
427 Ga0495583_0029904
428 Ga0495606_0006425
429 Ga0495606_0373160
430 Ga0495608_0079504
431 Ga0495616_0009613
432 Ga0495618_0131820
433 Ga0495620_0027862
434 Ga0495620_0028253
435 Ga0495628_0018233
436 Ga0495628_0051038
437 Ga0495628_0073672
438 Ga0495628_0115814
439 Ga0495630_0067754
440 Ga0495630_0165818
441 Ga0495631_0025033
442 Ga0495631_0110132
443 Ga0495643_0042915
444 Ga0495644_0069139
445 Ga0495648_0127522
446 Ga0495666_0046469
447 Ga0495652_0010007
448 Ga0495652_0050913
449 Ga0495652_0072494
450 Ga0495654_0033886
451 Ga0495640_0015323
452 Ga0495640_0050545
453 Ga0495586_0013489
454 Ga0495587_0006754
455 Ga0495597_0073769
456 Ga0495645_0043495
457 Ga0495622_0010679
458 Ga0495633_0027352
459 Ga0495667_0081596
460 Ga0495667_0162306
461 Ga0495668_0012167
462 Ga0495668_0092106
463 Ga0495634_0001367
464 Ga0495634_0013634
465 Ga0495634_0074981
466 Ga0495611_0087858
467 Ga0495625_0006079
468 Ga0495625_0021785
469 Ga0495625_0212443
470 Ga0495635_0002384
471 Ga0495635_0020280
472 Ga0495588_0009759
473 Ga0495588_0032886
474 Ga0495588_0057560
475 Ga0495657_0008917
476 Ga0495657_0012100
477 Ga0495657_0013710
478 Ga0495657_0018343
479 Ga0495657_0039823
480 Ga0495657_0136563
481 Ga0495623_0089553
482 Ga0495646_0000565
483 Ga0495646_0195151
484 Ga0495658_0034698
485 Ga0495658_0149399
486 Ga0495613_0000902
487 Ga0495613_0004703
488 Ga0495613_0007538
489 Ga0495613_0010349
490 Ga0495613_0061882
491 Ga0495613_0123056
492 Ga0495613_0130136
493 Ga0495613_0328412
494 Ga0495624_0072957
495 Ga0495624_0172522
496 Ga0495670_0261166
497 Ga0495671_0008163
498 Ga0495649_0106708
499 Ga0495589_0017473
500 Ga0495589_0019311
501 Ga0495589_0033629
502 Ga0495589_0120453
503 Ga0495600_0009081
504 Ga0495600_0014050
505 Ga0495660_0078111
506 Ga0495660_0132422
507 Ga0495581_0002415
508 Ga0495581_0043577
509 Ga0495604_0000467
510 Ga0495604_0049703
511 Ga0495604_0089962
512 Ga0495604_0180603
513 Ga0495636_0002199
514 Ga0495636_0009780
515 Ga0495636_0013349
516 Ga0495636_0059990
517 Ga0495676_0001932
518 Ga0495676_0006825
519 Ga0495676_0019228
520 Ga0495676_0019628
521 Ga0495676_0036682
522 Ga0495676_0055461
523 Ga0495676_0058800
524 Ga0495676_0242050
525 Ga0495676_0343755
526 Ga0495680_0072409
527 Ga0495687_002131
528 Ga0495687_003185
529 Ga0495687_063822
530 Ga0495675_0010206
531 Ga0495675_0040369
532 Ga0495675_0120750
533 Ga0495677_0010204
534 Ga0495685_012108
535 Ga0495685_029129
536 Ga0495685_035709
537 Ga0495685_057647
538 Ga0495681_0019835
539 Ga0495681_0037626
540 Ga0495684_0126731
541 Ga0495684_0287399
542 Ga0495686_0031824
543 Ga0495593_0003049
544 Ga0495593_0046559
545 Ga0495593_0070157
546 Ga0495593_0077407
547 Ga0495602_0025014
548 Ga0495614_0000065
549 Ga0495614_0004099
550 Ga0495614_0009822
551 Ga0495614_0018691
552 Ga0496105_0053046
553 Ga0496108_0978645
554 Ga0496109_0079148
555 Ga0495682_0024153
556 Ga0501031_0001586
557 Ga0501031_0017709
558 Ga0501032_0004433
559 Ga0501032_0140277
560 Ga0501034_0006556
561 Ga0501034_0009171
562 Ga0501036_0020757
563 Ga0501036_0118401
564 Ga0501037_0002604
565 Ga0501038_0003349
566 Ga0501041_0008113
567 Ga0501043_0003438
568 Ga0501043_0199113
569 Ga0501043_0368298
570 Ga0501046_0034300
571 Ga0501046_0134120
572 Ga0501047_0005369
573 Ga0501047_0013690
574 Ga0501047_0052970
575 Ga0501047_0065526
576 Ga0501047_0356745
577 Ga0501048_0025909
578 Ga0501067_0008423
579 Ga0501068_0000620
580 Ga0501069_0008921
581 Ga0501069_0272899
582 Ga0501071_0006494
583 Ga0501072_0006507
584 Ga0501075_0297879
585 Ga0501076_0081371
586 Ga0501077_0076005
587 Ga0501079_0000640
588 Ga0501080_0051983
589 Ga0501080_0116940
590 Ga0501083_0002591
591 Ga0501035_0003540
592 Ga0501035_0032311
593 Ga0501035_0069351
594 Ga0501035_0517617
595 Ga0501044_0003290
596 Ga0501044_0009258
597 Ga0501044_0014601
598 Ga0501044_0058652
599 Ga0501044_0638751
600 Ga0501045_0051370
601 Ga0501045_0487076
602 Ga0495655_0062624
603 Ga0500644_0051697
604 Ga0500647_0067098
605 Ga0500640_010176
606 Ga0500560_037675
607 Ga0500560_137135
608 Ga0500614_003125
609 Ga0500600_0152006
610 Ga0500636_0196098
611 Ga0500565_026617
612 Ga0501084_0020499
613 Ga0501082_0029892
614 Ga0466962_0000087
615 Ga0530510_0027111
616 2547406805
617 2585296695
618 2585315416
619 2616695969
620 2616900499
621 2643759888
622 2643904775
623 2644389413
624 2644405959
625 2644460416
626 2785345404
627 2808918731
628 2809230576
629 2812482089
630 2862180388
631 2862294111
632 2862390917
633 2862513014
634 2862583377
635 2863406665
636 2875392963
637 2935396390
638 2946051730
639 2947231527
640 2954010738
641 2966604094
642 2990065363
643 2997454036
644 3006326041
645 3006399676
646 3006487805
647 3006495326
648 8008561644
649 8008580467
650 8023624638
651 8025416464
652 8025479330
653 8025536963
654 8048412014
655 8056450915
656 8056835397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10127

RlaP

RNA repair pathway DNA polymerase beta family

5

219

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c66-assembly2.cif.gz_B yeast poly(a) polymerase in complex with fip1 residues 80-105 0.8096 14 38
2o1p-assembly1.cif.gz_A structure of yeast poly(a) polymerase in a somewhat closed state 0.7825 14 38
1q79-assembly1.cif.gz_A crystal structure of mammalian poly(a) polymerase 0.6716 7 37
4lt6-assembly2.cif.gz_B crystal structure of human poly(a) polymerase gamma 0.6377 4 38
2rff-assembly1.cif.gz_A crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution 0.5995 9 68
ID Description Score Start End Superfamily
af_O13798_905_1013_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.8747 14 37 1.10.1410.10
af_Q4E647_38_172_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.874 14 38 3.30.460.10
af_Q4E647_39_147_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.874 14 38 3.30.460.10
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8299 8 37 3.30.460.10
2hhpA02 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8078 14 38 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7M3LTQ1-F1-model_v4 Nucleotidyltransferase 0.9791 101 224
AF-A0A8A3TAC5-F1-model_v4 deleted 0.9626 81 225
AF-A0A1E5PJP1-F1-model_v4 Nucleotidyltransferase 0.9602 17 225 GO:0016740
AF-A0A7Y6FMN0-F1-model_v4 deleted 0.9601 6 225
AF-A0A0N1GM60-F1-model_v4 Nucleotidyltransferase 0.9592 6 227 GO:0016740

Map