F409354

General Info

Members Datasets Scaffolds Average Seq Length
328 162 656 219

Family's Representative Sequence

Representative Sequence 3300042122|Ga0450920_004820|Ga0450920_004820_483_1235
Length 250
Sequence MPYTDARHALLARLIDHAPMFPPASLSPADALVEDARAAASPHAFMLARLVWPASRLVELPPSERAISAVLDAPIPSGFPVEAVEAPPSVDPAAGDAVLLMGEVYVETPIDGGVEDRLDRLAEHGLRAKVRCGGASVPSVGALAAFVRACRERGLVFKATAGLHHAVRSNGEHGFLNLLAAAAFAGEEEGALAETDPSAFALDSGSFAWRERSGSPEELARVRRDLIHSIGSCSFFEPVDELVSLGMLPQ

Samples

Sample ID Description Type Environment
1 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.59
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450920_004820 3300042122 Bacteria 2384
2 Ga0070658_10028935 3300005327 Bacteria 4448
3 Ga0070683_100082326 3300005329 Bacteria 3014
4 Ga0070680_100078613 3300005336 Bacteria 2718
5 Ga0070680_100109697 3300005336 Bacteria 2296
6 Ga0070660_100011412 3300005339 Bacteria 6309
7 Ga0070661_100104662 3300005344 Bacteria 2109
8 Ga0070709_10043366 3300005434 Bacteria 2782
9 Ga0070709_10248034 3300005434 Bacteria 1281
10 Ga0070714_100019023 3300005435 Bacteria 5589
11 Ga0070714_100061641 3300005435 Bacteria 3222
12 Ga0070714_100340572 3300005435 Bacteria 1406
13 Ga0070713_100257243 3300005436 Bacteria 1594
14 Ga0070710_10002002 3300005437 Bacteria 9653
15 Ga0070710_10160783 3300005437 Bacteria 1392
16 Ga0070711_100033563 3300005439 Bacteria 3417
17 Ga0070681_10034131 3300005458 Bacteria 5109
18 Ga0070681_10211151 3300005458 Bacteria 1857
19 Ga0070679_100026217 3300005530 Bacteria 5721
20 Ga0070684_100185783 3300005535 Bacteria 1890
21 Ga0070684_100618455 3300005535 Bacteria 1008
22 Ga0070693_100246846 3300005547 Bacteria 1181
23 Ga0068857_100472844 3300005577 Bacteria 1174
24 Ga0068856_100037588 3300005614 Bacteria 4750
25 Ga0068856_100132023 3300005614 Bacteria 2502
26 Ga0070702_100112295 3300005615 Bacteria 1692
27 Ga0068852_100052752 3300005616 Bacteria 3496
28 Ga0068866_10137767 3300005718 Bacteria 1397
29 Ga0070717_10010996 3300006028 Bacteria 6855
30 Ga0070717_10033507 3300006028 Bacteria 4144
31 Ga0070717_10160095 3300006028 Bacteria 1952
32 Ga0070717_10626638 3300006028 Bacteria 976
33 Ga0070715_10108792 3300006163 Bacteria 1304
34 Ga0070716_100102112 3300006173 Bacteria 1760
35 Ga0070712_100012112 3300006175 Bacteria 5480
36 Ga0097621_100170600 3300006237 Bacteria 1875
37 Ga0075434_100011666 3300006871 Bacteria 8300
38 Ga0105240_10466343 3300009093 Bacteria 1410
39 Ga0105245_10136860 3300009098 Bacteria 2303
40 Ga0105245_10451222 3300009098 Bacteria 1294
41 Ga0105248_10576568 3300009177 Bacteria 1269
42 Ga0105238_10478808 3300009551 Bacteria 1244
43 Ga0105239_10488892 3300010375 Bacteria 1399
44 Ga0157369_10011368 3300013105 Bacteria 10110
45 Ga0157374_10053204 3300013296 Bacteria 3774
46 Ga0157372_10650742 3300013307 Bacteria 1227
47 Ga0182008_10237845 3300014497 Unclassified 936
48 Ga0206353_10153761 3300020082 Bacteria 1595
49 Ga0207692_10024682 3300025898 Bacteria 2798
50 Ga0207685_10143647 3300025905 Bacteria 1073
51 Ga0207699_10141955 3300025906 Bacteria 1579
52 Ga0207699_10199102 3300025906 Bacteria 1356
53 Ga0207693_10001813 3300025915 Bacteria 18731
54 Ga0207693_10015387 3300025915 Bacteria 6138
55 Ga0207663_10106061 3300025916 Bacteria 1898
56 Ga0207657_10001474 3300025919 Bacteria 25157
57 Ga0207657_10016745 3300025919 Bacteria 7058
58 Ga0207700_10009973 3300025928 Bacteria 5967
59 Ga0207700_10029365 3300025928 Bacteria 3879
60 Ga0207700_10308514 3300025928 Bacteria 1368
61 Ga0207664_10006516 3300025929 Bacteria 8033
62 Ga0207664_10007975 3300025929 Bacteria 7365
63 Ga0207664_10051097 3300025929 Bacteria 3262
64 Ga0207664_10263974 3300025929 Bacteria 1506
65 Ga0207665_10000968 3300025939 Bacteria 19437
66 Ga0207711_10423903 3300025941 Bacteria 1238
67 Ga0207661_10306895 3300025944 Bacteria 1424
68 Ga0207679_10297150 3300025945 Bacteria 1390
69 Ga0207702_10254714 3300026078 Bacteria 1650
70 Ga0207641_10361522 3300026088 Bacteria 1386
71 Ga0207674_10438995 3300026116 Bacteria 1262
72 Ga0207698_10112294 3300026142 Bacteria 2287
73 Ga0268264_10411952 3300028381 Bacteria 1301
74 Ga0265336_10001053 3300028666 Bacteria 13486
75 Ga0265338_10012905 3300028800 Bacteria 9491
76 Ga0265338_10028358 3300028800 Bacteria 5585
77 Ga0373956_0034809 3300035119 Bacteria 2219
78 Ga0373943_0001582 3300035170 Bacteria 10308
79 Ga0373946_0004632 3300035171 Bacteria 4933
80 Ga0373927_0025709 3300035695 Bacteria 3849
81 Ga0373947_0023910 3300035725 Bacteria 3557
82 Ga0373937_0017799 3300036401 Bacteria 6339
83 Ga0373937_0043656 3300036401 Bacteria 4094
84 Ga0373925_0006948 3300037068 Bacteria 8278
85 Ga0395900_0561821 3300037418 Bacteria 1085
86 Ga0395901_0050701 3300038443 Bacteria 4311
87 Ga0436360_0990257 3300039438 Bacteria 11979
88 Ga0466969_0003018 3300044656 Bacteria 8968
89 Ga0466969_0024815 3300044656 Bacteria 3083
90 Ga0466965_0009914 3300044683 Bacteria 4432
91 Ga0466965_0142390 3300044683 Bacteria 1249
92 Ga0466966_0020368 3300044684 Bacteria 4362
93 Ga0466966_0099678 3300044684 Bacteria 1797
94 Ga0466966_0144825 3300044684 Bacteria 1451
95 Ga0466961_0013260 3300044693 Bacteria 5273
96 Ga0466961_0142410 3300044693 Bacteria 1500
97 Ga0466963_0000081 3300044694 Bacteria 32755
98 Ga0466963_0000637 3300044694 Bacteria 16858
99 Ga0466963_0001598 3300044694 Bacteria 12313
100 Ga0466963_0005358 3300044694 Bacteria 7504
101 Ga0466963_0005420 3300044694 Bacteria 7469
102 Ga0466963_0008806 3300044694 Bacteria 6061
103 Ga0466963_0014146 3300044694 Bacteria 4916
104 Ga0466963_0028040 3300044694 Bacteria 3611
105 Ga0466963_0067720 3300044694 Bacteria 2396
106 Ga0466963_0200300 3300044694 Bacteria 1396
107 Ga0466964_0014788 3300044706 Bacteria 2970
108 Ga0466964_0162609 3300044706 Bacteria 1044
109 Ga0466971_0000381 3300044719 Bacteria 17046
110 Ga0466971_0003546 3300044719 Bacteria 6669
111 Ga0466971_0016849 3300044719 Bacteria 3228
112 Ga0466968_0002237 3300044735 Bacteria 7073
113 Ga0466968_0004776 3300044735 Bacteria 5073
114 Ga0466968_0058154 3300044735 Bacteria 1663
115 Ga0466968_0067786 3300044735 Bacteria 1548
116 Ga0466968_0118665 3300044735 Bacteria 1195
117 Ga0466970_0007727 3300044765 Bacteria 5395
118 Ga0466970_0058840 3300044765 Bacteria 2057
119 Ga0466970_0157043 3300044765 Bacteria 1257
120 Ga0466957_0003003 3300044842 Bacteria 9159
121 Ga0466957_0017163 3300044842 Bacteria 4238
122 Ga0466957_0024937 3300044842 Bacteria 3542
123 Ga0466957_0066644 3300044842 Bacteria 2220
124 Ga0466957_0072182 3300044842 Bacteria 2136
125 Ga0466960_0049258 3300044901 Bacteria 2027
126 Ga0466959_0003079 3300045049 Bacteria 10802
127 Ga0466959_0013131 3300045049 Bacteria 5999
128 Ga0466959_0021130 3300045049 Bacteria 4798
129 Ga0466959_0026642 3300045049 Bacteria 4285
130 Ga0466958_0007459 3300045836 Bacteria 6019
131 Ga0466958_0008906 3300045836 Bacteria 5575
132 Ga0466958_0013805 3300045836 Bacteria 4605
133 Ga0466958_0030358 3300045836 Bacteria 3210
134 Ga0466958_0034805 3300045836 Bacteria 3006
135 Ga0466958_0130572 3300045836 Bacteria 1577
136 Ga0466958_0217610 3300045836 Bacteria 1218
137 Ga0466967_0003435 3300045976 Bacteria 10337
138 Ga0466967_0006550 3300045976 Bacteria 8260
139 Ga0466967_0019946 3300045976 Bacteria 5405
140 Ga0466967_0024592 3300045976 Bacteria 4955
141 Ga0466967_0025156 3300045976 Bacteria 4905
142 Ga0466967_0026721 3300045976 Bacteria 4787
143 Ga0466967_0041892 3300045976 Bacteria 3952
144 Ga0466967_0086101 3300045976 Bacteria 2846
145 Ga0466967_0098111 3300045976 Bacteria 2675
146 Ga0466967_0152498 3300045976 Bacteria 2161
147 Ga0466967_0166327 3300045976 Bacteria 2073
148 Ga0495592_0000048 3300046454 Bacteria 114599
149 Ga0495592_0008662 3300046454 Bacteria 7637
150 Ga0495592_0068974 3300046454 Bacteria 2579
151 Ga0495592_0342982 3300046454 Unclassified 960
152 Ga0495603_0175134 3300046455 Bacteria 1242
153 Ga0495629_0009455 3300046459 Bacteria 7130
154 Ga0495629_0111241 3300046459 Bacteria 1909
155 Ga0495641_0027491 3300046461 Bacteria 2766
156 Ga0495641_0042965 3300046461 Bacteria 2091
157 Ga0495641_0091547 3300046461 Bacteria 1359
158 Ga0495651_0000276 3300046462 Bacteria 39992
159 Ga0495651_0150452 3300046462 Bacteria 1678
160 Ga0495653_0005902 3300046463 Bacteria 10024
161 Ga0495653_0060634 3300046463 Bacteria 2865
162 Ga0495580_0231493 3300046472 Bacteria 1268
163 Ga0495582_0013566 3300046473 Bacteria 4485
164 Ga0495582_0020442 3300046473 Bacteria 3625
165 Ga0495582_0050450 3300046473 Bacteria 2293
166 Ga0495639_0000216 3300046475 Bacteria 29605
167 Ga0495662_0005646 3300046476 Bacteria 6255
168 Ga0495664_0014905 3300046477 Bacteria 4413
169 Ga0495664_0064486 3300046477 Bacteria 2183
170 Ga0495664_0103798 3300046477 Bacteria 1713
171 Ga0495664_0381294 3300046477 Unclassified 847
172 Ga0495584_0029276 3300046491 Bacteria 2791
173 Ga0495584_0136828 3300046491 Bacteria 1244
174 Ga0495585_0190028 3300046492 Bacteria 1051
175 Ga0495594_0293235 3300046499 Unclassified 927
176 Ga0495607_0135772 3300046501 Bacteria 1274
177 Ga0495608_0000508 3300046511 Bacteria 26705
178 Ga0495608_0014673 3300046511 Bacteria 5436
179 Ga0495608_0208168 3300046511 Bacteria 1231
180 Ga0495618_0001821 3300046514 Bacteria 14055
181 Ga0495618_0035165 3300046514 Bacteria 3144
182 Ga0495618_0219074 3300046514 Bacteria 1201
183 Ga0495618_0323023 3300046514 Unclassified 955
184 Ga0495618_0453123 3300046514 Unclassified 778
185 Ga0495628_0000026 3300046516 Bacteria 127398
186 Ga0495628_0158290 3300046516 Bacteria 1722
187 Ga0495630_0025712 3300046517 Bacteria 4354
188 Ga0495630_0107078 3300046517 Bacteria 2117
189 Ga0495630_0209535 3300046517 Bacteria 1487
190 Ga0495630_0958917 3300046517 Unclassified 650
191 Ga0495644_0020940 3300046523 Bacteria 2495
192 Ga0495666_0002151 3300046526 Bacteria 9796
193 Ga0495642_0129615 3300046528 Bacteria 1085
194 Ga0495652_0001333 3300046529 Bacteria 27472
195 Ga0495652_0018005 3300046529 Bacteria 6302
196 Ga0495652_0086765 3300046529 Bacteria 2568
197 Ga0495652_0169819 3300046529 Bacteria 1685
198 Ga0495652_0192254 3300046529 Bacteria 1556
199 Ga0495652_0467212 3300046529 Bacteria 880
200 Ga0495665_0018715 3300046531 Bacteria 3720
201 Ga0495640_0157317 3300046533 Bacteria 1458
202 Ga0495640_0208428 3300046533 Bacteria 1236
203 Ga0495640_0260074 3300046533 Bacteria 1085
204 Ga0495586_0045518 3300046535 Bacteria 2364
205 Ga0495586_0211131 3300046535 Bacteria 1101
206 Ga0495587_0000080 3300046536 Bacteria 75321
207 Ga0495645_0000016 3300046543 Bacteria 158415
208 Ga0495645_0102819 3300046543 Bacteria 2030
209 Ga0495645_0148796 3300046543 Bacteria 1628
210 Ga0495667_0007334 3300046559 Bacteria 7479
211 Ga0495667_0140509 3300046559 Bacteria 1556
212 Ga0495667_0180177 3300046559 Bacteria 1356
213 Ga0495667_0266660 3300046559 Unclassified 1089
214 Ga0495667_0279202 3300046559 Bacteria 1060
215 Ga0495668_0189390 3300046616 Bacteria 1127
216 Ga0495634_0132109 3300046642 Unclassified 1590
217 Ga0495635_0023368 3300046663 Bacteria 4308
218 Ga0495635_0156259 3300046663 Bacteria 1552
219 Ga0495635_0408714 3300046663 Bacteria 901
220 Ga0495588_0052540 3300046674 Bacteria 2101
221 Ga0495657_0024592 3300046675 Bacteria 4287
222 Ga0495657_0239596 3300046675 Bacteria 1095
223 Ga0495599_0000016 3300046678 Bacteria 169605
224 Ga0495599_0053769 3300046678 Bacteria 2522
225 Ga0495599_0126127 3300046678 Bacteria 1591
226 Ga0495623_0000385 3300046679 Bacteria 28941
227 Ga0495646_0013431 3300046680 Bacteria 5206
228 Ga0495646_0089719 3300046680 Bacteria 1778
229 Ga0495647_0003374 3300046681 Bacteria 5118
230 Ga0495658_0005246 3300046683 Bacteria 6378
231 Ga0495658_0312972 3300046683 Bacteria 994
232 Ga0495613_0124968 3300046689 Bacteria 1845
233 Ga0495613_0132861 3300046689 Bacteria 1781
234 Ga0495613_0189722 3300046689 Bacteria 1453
235 Ga0495613_0210283 3300046689 Bacteria 1368
236 Ga0495624_0001228 3300046690 Bacteria 20224
237 Ga0495624_0080922 3300046690 Bacteria 2012
238 Ga0495670_0112923 3300046691 Bacteria 1407
239 Ga0495589_0235696 3300046794 Bacteria 857
240 Ga0495600_0045100 3300046809 Bacteria 2876
241 Ga0495600_0409899 3300046809 Unclassified 842
242 Ga0495581_0010245 3300047315 Bacteria 5421
243 Ga0495604_0000004 3300047317 Bacteria 456385
244 Ga0495604_0112184 3300047317 Bacteria 1987
245 Ga0495604_0144483 3300047317 Bacteria 1697
246 Ga0495604_0475271 3300047317 Bacteria 814
247 Ga0495674_0057911 3300047319 Bacteria 3389
248 Ga0495674_0774345 3300047319 Bacteria 748
249 Ga0495676_0009799 3300047321 Bacteria 8703
250 Ga0495680_0009342 3300047322 Bacteria 8828
251 Ga0495680_0109496 3300047322 Bacteria 2048
252 Ga0495680_0198030 3300047322 Bacteria 1442
253 Ga0495680_0506166 3300047322 Bacteria 819
254 Ga0495675_0000033 3300047444 Bacteria 98338
255 Ga0495684_0196690 3300047471 Bacteria 1488
256 Ga0495684_0228222 3300047471 Bacteria 1363
257 Ga0495593_0005275 3300047673 Bacteria 7634
258 Ga0495602_0000036 3300048088 Bacteria 133584
259 Ga0495602_0083157 3300048088 Bacteria 2683
260 Ga0495614_0017629 3300048089 Bacteria 3101
261 Ga0496100_0037718 3300048903 Bacteria 3057
262 Ga0496101_0031857 3300048904 Bacteria 3708
263 Ga0496101_0097258 3300048904 Bacteria 2198
264 Ga0496101_0115170 3300048904 Bacteria 2027
265 Ga0496102_0110295 3300048905 Bacteria 2565
266 Ga0496102_0337996 3300048905 Bacteria 1418
267 Ga0496103_0374829 3300048906 Bacteria 914
268 Ga0496104_0091448 3300048907 Bacteria 2908
269 Ga0496104_0261714 3300048907 Bacteria 1642
270 Ga0496105_0005085 3300048908 Bacteria 9969
271 Ga0496105_0086687 3300048908 Bacteria 2587
272 Ga0496105_0259817 3300048908 Bacteria 1404
273 Ga0496105_0484735 3300048908 Bacteria 972
274 Ga0496105_0618323 3300048908 Bacteria 839
275 Ga0496106_0081065 3300048909 Bacteria 2492
276 Ga0496107_0050827 3300048910 Bacteria 2988
277 Ga0496107_0069472 3300048910 Bacteria 2557
278 Ga0496108_0009379 3300048911 Bacteria 7923
279 Ga0496108_0251199 3300048911 Bacteria 1538
280 Ga0496109_0008397 3300048912 Bacteria 8779
281 Ga0496109_0146610 3300048912 Bacteria 2208
282 Ga0496109_0201280 3300048912 Bacteria 1872
283 Ga0496109_0658328 3300048912 Bacteria 984
284 Ga0496110_0509296 3300048913 Bacteria 1095
285 Ga0496111_0424941 3300048914 Unclassified 981
286 Ga0496111_0502085 3300048914 Bacteria 893
287 Ga0496112_0634786 3300048915 Bacteria 998
288 Ga0496113_0070181 3300048916 Bacteria 2662
289 Ga0496113_0237491 3300048916 Bacteria 1454
290 Ga0496113_1040035 3300048916 Bacteria 644
291 Ga0496114_0004272 3300048917 Bacteria 11059
292 Ga0496114_0048871 3300048917 Bacteria 3519
293 Ga0496114_0061548 3300048917 Bacteria 3140
294 Ga0496114_0710414 3300048917 Bacteria 881
295 Ga0496115_0005293 3300048918 Bacteria 9384
296 Ga0496115_0024018 3300048918 Bacteria 4735
297 Ga0496115_0137237 3300048918 Bacteria 2017
298 Ga0496115_0487677 3300048918 Bacteria 992
299 Ga0501067_0077271 3300049583 Bacteria 1845
300 Ga0501071_0367626 3300049587 Bacteria 1096
301 Ga0501081_0436390 3300049743 Bacteria 972
302 nmdc:mga05p37_174977_c1 3300050507 Bacteria 2615
303 nmdc:mga0n895_10080_c1 3300050512 Bacteria 8317
304 nmdc:mga0a205_104502_c1 3300050515 Bacteria 2731
305 Ga0495601_0000101 3300053077 Bacteria 47661
306 Ga0495601_0009453 3300053077 Bacteria 5767
307 Ga0495601_0165673 3300053077 Bacteria 1444
308 Ga0495601_0227462 3300053077 Bacteria 1218
309 Ga0495601_0230182 3300053077 Bacteria 1210
310 Ga0495601_0311876 3300053077 Unclassified 1024
311 Ga0495601_0506280 3300053077 Bacteria 779
312 Ga0495601_0521600 3300053077 Bacteria 766
313 Ga0495612_0000873 3300053078 Bacteria 12297
314 Ga0495612_0034944 3300053078 Bacteria 2036
315 Ga0495612_0073297 3300053078 Bacteria 1430
316 Ga0495612_0300921 3300053078 Bacteria 719
317 Ga0495595_0016393 3300053084 Bacteria 3169
318 Ga0495595_0228423 3300053084 Bacteria 929
319 Ga0495619_0000235 3300053085 Bacteria 40323
320 Ga0495619_0010931 3300053085 Bacteria 5712
321 Ga0495619_0071921 3300053085 Bacteria 2315
322 Ga0501084_0584722 3300054114 Bacteria 944
323 Ga0501082_0251263 3300060353 Bacteria 1539
324 Ga0466962_0001358 3300061719 Bacteria 11323
325 Ga0466962_0003103 3300061719 Bacteria 7896
326 Ga0466962_0020896 3300061719 Bacteria 3145
327 Ga0466962_0039864 3300061719 Bacteria 2248
328 Ga0466962_0191740 3300061719 Bacteria 997
329 Ga0450920_004820
330 Ga0070658_10028935
331 Ga0070683_100082326
332 Ga0070680_100078613
333 Ga0070680_100109697
334 Ga0070660_100011412
335 Ga0070661_100104662
336 Ga0070709_10043366
337 Ga0070709_10248034
338 Ga0070714_100019023
339 Ga0070714_100061641
340 Ga0070714_100340572
341 Ga0070713_100257243
342 Ga0070710_10002002
343 Ga0070710_10160783
344 Ga0070711_100033563
345 Ga0070681_10034131
346 Ga0070681_10211151
347 Ga0070679_100026217
348 Ga0070684_100185783
349 Ga0070684_100618455
350 Ga0070693_100246846
351 Ga0068857_100472844
352 Ga0068856_100037588
353 Ga0068856_100132023
354 Ga0070702_100112295
355 Ga0068852_100052752
356 Ga0068866_10137767
357 Ga0070717_10010996
358 Ga0070717_10033507
359 Ga0070717_10160095
360 Ga0070717_10626638
361 Ga0070715_10108792
362 Ga0070716_100102112
363 Ga0070712_100012112
364 Ga0097621_100170600
365 Ga0075434_100011666
366 Ga0105240_10466343
367 Ga0105245_10136860
368 Ga0105245_10451222
369 Ga0105248_10576568
370 Ga0105238_10478808
371 Ga0105239_10488892
372 Ga0157369_10011368
373 Ga0157374_10053204
374 Ga0157372_10650742
375 Ga0182008_10237845
376 Ga0206353_10153761
377 Ga0207692_10024682
378 Ga0207685_10143647
379 Ga0207699_10141955
380 Ga0207699_10199102
381 Ga0207693_10001813
382 Ga0207693_10015387
383 Ga0207663_10106061
384 Ga0207657_10001474
385 Ga0207657_10016745
386 Ga0207700_10009973
387 Ga0207700_10029365
388 Ga0207700_10308514
389 Ga0207664_10006516
390 Ga0207664_10007975
391 Ga0207664_10051097
392 Ga0207664_10263974
393 Ga0207665_10000968
394 Ga0207711_10423903
395 Ga0207661_10306895
396 Ga0207679_10297150
397 Ga0207702_10254714
398 Ga0207641_10361522
399 Ga0207674_10438995
400 Ga0207698_10112294
401 Ga0268264_10411952
402 Ga0265336_10001053
403 Ga0265338_10012905
404 Ga0265338_10028358
405 Ga0373956_0034809
406 Ga0373943_0001582
407 Ga0373946_0004632
408 Ga0373927_0025709
409 Ga0373947_0023910
410 Ga0373937_0017799
411 Ga0373937_0043656
412 Ga0373925_0006948
413 Ga0395900_0561821
414 Ga0395901_0050701
415 Ga0436360_0990257
416 Ga0466969_0003018
417 Ga0466969_0024815
418 Ga0466965_0009914
419 Ga0466965_0142390
420 Ga0466966_0020368
421 Ga0466966_0099678
422 Ga0466966_0144825
423 Ga0466961_0013260
424 Ga0466961_0142410
425 Ga0466963_0000081
426 Ga0466963_0000637
427 Ga0466963_0001598
428 Ga0466963_0005358
429 Ga0466963_0005420
430 Ga0466963_0008806
431 Ga0466963_0014146
432 Ga0466963_0028040
433 Ga0466963_0067720
434 Ga0466963_0200300
435 Ga0466964_0014788
436 Ga0466964_0162609
437 Ga0466971_0000381
438 Ga0466971_0003546
439 Ga0466971_0016849
440 Ga0466968_0002237
441 Ga0466968_0004776
442 Ga0466968_0058154
443 Ga0466968_0067786
444 Ga0466968_0118665
445 Ga0466970_0007727
446 Ga0466970_0058840
447 Ga0466970_0157043
448 Ga0466957_0003003
449 Ga0466957_0017163
450 Ga0466957_0024937
451 Ga0466957_0066644
452 Ga0466957_0072182
453 Ga0466960_0049258
454 Ga0466959_0003079
455 Ga0466959_0013131
456 Ga0466959_0021130
457 Ga0466959_0026642
458 Ga0466958_0007459
459 Ga0466958_0008906
460 Ga0466958_0013805
461 Ga0466958_0030358
462 Ga0466958_0034805
463 Ga0466958_0130572
464 Ga0466958_0217610
465 Ga0466967_0003435
466 Ga0466967_0006550
467 Ga0466967_0019946
468 Ga0466967_0024592
469 Ga0466967_0025156
470 Ga0466967_0026721
471 Ga0466967_0041892
472 Ga0466967_0086101
473 Ga0466967_0098111
474 Ga0466967_0152498
475 Ga0466967_0166327
476 Ga0495592_0000048
477 Ga0495592_0008662
478 Ga0495592_0068974
479 Ga0495592_0342982
480 Ga0495603_0175134
481 Ga0495629_0009455
482 Ga0495629_0111241
483 Ga0495641_0027491
484 Ga0495641_0042965
485 Ga0495641_0091547
486 Ga0495651_0000276
487 Ga0495651_0150452
488 Ga0495653_0005902
489 Ga0495653_0060634
490 Ga0495580_0231493
491 Ga0495582_0013566
492 Ga0495582_0020442
493 Ga0495582_0050450
494 Ga0495639_0000216
495 Ga0495662_0005646
496 Ga0495664_0014905
497 Ga0495664_0064486
498 Ga0495664_0103798
499 Ga0495664_0381294
500 Ga0495584_0029276
501 Ga0495584_0136828
502 Ga0495585_0190028
503 Ga0495594_0293235
504 Ga0495607_0135772
505 Ga0495608_0000508
506 Ga0495608_0014673
507 Ga0495608_0208168
508 Ga0495618_0001821
509 Ga0495618_0035165
510 Ga0495618_0219074
511 Ga0495618_0323023
512 Ga0495618_0453123
513 Ga0495628_0000026
514 Ga0495628_0158290
515 Ga0495630_0025712
516 Ga0495630_0107078
517 Ga0495630_0209535
518 Ga0495630_0958917
519 Ga0495644_0020940
520 Ga0495666_0002151
521 Ga0495642_0129615
522 Ga0495652_0001333
523 Ga0495652_0018005
524 Ga0495652_0086765
525 Ga0495652_0169819
526 Ga0495652_0192254
527 Ga0495652_0467212
528 Ga0495665_0018715
529 Ga0495640_0157317
530 Ga0495640_0208428
531 Ga0495640_0260074
532 Ga0495586_0045518
533 Ga0495586_0211131
534 Ga0495587_0000080
535 Ga0495645_0000016
536 Ga0495645_0102819
537 Ga0495645_0148796
538 Ga0495667_0007334
539 Ga0495667_0140509
540 Ga0495667_0180177
541 Ga0495667_0266660
542 Ga0495667_0279202
543 Ga0495668_0189390
544 Ga0495634_0132109
545 Ga0495635_0023368
546 Ga0495635_0156259
547 Ga0495635_0408714
548 Ga0495588_0052540
549 Ga0495657_0024592
550 Ga0495657_0239596
551 Ga0495599_0000016
552 Ga0495599_0053769
553 Ga0495599_0126127
554 Ga0495623_0000385
555 Ga0495646_0013431
556 Ga0495646_0089719
557 Ga0495647_0003374
558 Ga0495658_0005246
559 Ga0495658_0312972
560 Ga0495613_0124968
561 Ga0495613_0132861
562 Ga0495613_0189722
563 Ga0495613_0210283
564 Ga0495624_0001228
565 Ga0495624_0080922
566 Ga0495670_0112923
567 Ga0495589_0235696
568 Ga0495600_0045100
569 Ga0495600_0409899
570 Ga0495581_0010245
571 Ga0495604_0000004
572 Ga0495604_0112184
573 Ga0495604_0144483
574 Ga0495604_0475271
575 Ga0495674_0057911
576 Ga0495674_0774345
577 Ga0495676_0009799
578 Ga0495680_0009342
579 Ga0495680_0109496
580 Ga0495680_0198030
581 Ga0495680_0506166
582 Ga0495675_0000033
583 Ga0495684_0196690
584 Ga0495684_0228222
585 Ga0495593_0005275
586 Ga0495602_0000036
587 Ga0495602_0083157
588 Ga0495614_0017629
589 Ga0496100_0037718
590 Ga0496101_0031857
591 Ga0496101_0097258
592 Ga0496101_0115170
593 Ga0496102_0110295
594 Ga0496102_0337996
595 Ga0496103_0374829
596 Ga0496104_0091448
597 Ga0496104_0261714
598 Ga0496105_0005085
599 Ga0496105_0086687
600 Ga0496105_0259817
601 Ga0496105_0484735
602 Ga0496105_0618323
603 Ga0496106_0081065
604 Ga0496107_0050827
605 Ga0496107_0069472
606 Ga0496108_0009379
607 Ga0496108_0251199
608 Ga0496109_0008397
609 Ga0496109_0146610
610 Ga0496109_0201280
611 Ga0496109_0658328
612 Ga0496110_0509296
613 Ga0496111_0424941
614 Ga0496111_0502085
615 Ga0496112_0634786
616 Ga0496113_0070181
617 Ga0496113_0237491
618 Ga0496113_1040035
619 Ga0496114_0004272
620 Ga0496114_0048871
621 Ga0496114_0061548
622 Ga0496114_0710414
623 Ga0496115_0005293
624 Ga0496115_0024018
625 Ga0496115_0137237
626 Ga0496115_0487677
627 Ga0501067_0077271
628 Ga0501071_0367626
629 Ga0501081_0436390
630 nmdc:mga05p37_174977_c1
631 nmdc:mga0n895_10080_c1
632 nmdc:mga0a205_104502_c1
633 Ga0495601_0000101
634 Ga0495601_0009453
635 Ga0495601_0165673
636 Ga0495601_0227462
637 Ga0495601_0230182
638 Ga0495601_0311876
639 Ga0495601_0506280
640 Ga0495601_0521600
641 Ga0495612_0000873
642 Ga0495612_0034944
643 Ga0495612_0073297
644 Ga0495612_0300921
645 Ga0495595_0016393
646 Ga0495595_0228423
647 Ga0495619_0000235
648 Ga0495619_0010931
649 Ga0495619_0071921
650 Ga0501084_0584722
651 Ga0501082_0251263
652 Ga0466962_0001358
653 Ga0466962_0003103
654 Ga0466962_0020896
655 Ga0466962_0039864
656 Ga0466962_0191740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nfg-assembly1.cif.gz_B structure of d-hydantoinase 0.7828 88 132
4c1k-assembly1.cif.gz_E crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase 0.7576 89 131
4tv5-assembly1.cif.gz_A crystal structure of citrate synthase sbng 0.7564 82 131
1zco-assembly1.cif.gz_A crystal structure of pyrococcus furiosus 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase 0.7513 89 131
6hnv-assembly1.cif.gz_B crystal structure of aminotransferase aro9 from c. albicans with ligands 0.7483 97 139
ID Description Score Start End Superfamily
af_Q4E4E4_55_293_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.872 97 130 3.40.640.10
1xi9D02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8503 97 130 3.40.640.10
af_O53619_74_357_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8476 88 134 3.20.20.140
af_Q2FYW6_6_248_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8349 97 132 3.40.640.10
1gkpA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8078 82 129 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A538IDS7-F1-model_v4 Uncharacterized protein 0.9717 1 166
AF-A0A538IDS7-F1-model_v4 Uncharacterized protein 0.966 1 166
AF-A0A538KJV0-F1-model_v4 Uncharacterized protein 0.9485 4 217
AF-A0A538DU44-F1-model_v4 Uncharacterized protein 0.9452 4 217
AF-A0A7Y4VPH8-F1-model_v4 Uncharacterized protein 0.94 96 217

Map