F409347

General Info

Members Datasets Scaffolds Average Seq Length
328 248 189 314

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0006960|Ga0439439_0006960_55_1089
Length 344
Sequence LSELTSNGQFKAYGAAARKQPLLVLIGPTAVGKTRMSLDIAKYWNAEIISGDSMQVYRGMDIGTAKIPLDEREGIPHHLIDICEPEESYSAADFQAGAIKVIDQIAGRGRLPFIVGGTGLYVESVCYQYQFAEIGSDEAFRQEQEQYAAANGAEALHRRLAEIDPPAAERLHPNDLRRVIRALEVYHLTGQTFSEQQAGQKKDSPYELCIIGLTMDRAELYRRIEQRVDIMIEQGLVEEVKRLMERDLPPQAVAMQGLGYKEIADYLHGNCSLAAAVERLKRDTRRFAKRQLSWFRHMDDIHWIDMGENFHNNLLSIHAIIAGKFQLHIEYTSNQPFEDGGNVQ

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
3 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
4 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
5 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
6 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
7 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
8 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
9 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
10 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
11 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
12 2643221729 Bacillus sp. Root11 Isolate Unclassified
13 2643221730 Bacillus sp. Root131 Isolate Unclassified
14 2643221731 Bacillus sp. Root147 Isolate Unclassified
15 2643221732 Bacillus sp. Root239 Isolate Unclassified
16 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
17 2671180694 Paenibacillus sp. A3 Isolate Unclassified
18 2684622632 Bacillus cereus 905 Isolate Unclassified
19 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
20 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
21 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
22 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
23 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
24 2738541295 Bacillus sp. OK085 Isolate Unclassified
25 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
26 2738541358 Bacillus sp. OV752 Isolate Unclassified
27 2738543006 Bacillus sp. OK077 Isolate Unclassified
28 2738543010 Bacillus sp. YR335 Isolate Unclassified
29 2738543017 Bacillus sp. OV186 Isolate Unclassified
30 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
31 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
32 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
33 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
34 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
35 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
36 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
37 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
38 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
39 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
40 2818991441 Niallia circulans 3243 Isolate Rhizosphere
41 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
42 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
43 2818991459 Paenibacillus sp. 597 Isolate Unclassified
44 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
45 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
46 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
47 2842682962 Bacillus sp. R-72492 Isolate Unclassified
48 2842882022 Bacillus sp. R-71893 Isolate Unclassified
49 2849139964 Bacillus sp. R-71875 Isolate Unclassified
50 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
51 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
52 2857472729 Cohnella sp. R-74144 Isolate Unclassified
53 2857581216 Bacillus sp. R-71922 Isolate Unclassified
54 2857586860 Bacillus sp. R-71935 Isolate Unclassified
55 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
56 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
57 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
58 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
59 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
60 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
61 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
62 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
63 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
64 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
65 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
66 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
67 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
68 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
69 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
70 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
71 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
72 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
73 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
74 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
75 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
76 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
77 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
78 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
79 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
80 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
81 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
82 2919720352 Priestia megaterium 4340 Isolate Unclassified
83 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
84 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
85 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
86 2929004312 Priestia megaterium 1104 Isolate Unclassified
87 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
88 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
89 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
90 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
91 2938917290 Bacillus sp. CR71 Isolate Unclassified
92 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
93 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
94 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
95 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
96 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
97 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
98 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
99 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
100 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
101 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
102 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
103 2965761152 Bacillus sp. COPE52 Isolate Unclassified
104 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
105 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
106 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
107 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
108 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
109 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
110 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
111 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
112 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
113 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
114 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
115 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
116 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
117 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
118 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
119 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
120 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
121 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
122 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
123 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
124 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
125 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
126 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
127 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
128 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
129 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
130 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
131 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
132 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
133 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
134 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
135 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
136 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
137 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
138 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
146 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
158 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
191 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
234 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
235 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
236 8022792930 Bacillus sp. Xin Isolate Rhizosphere
237 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
238 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
239 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
240 8023438354 Bacillus sp. BH2 Isolate Unclassified
241 8023444577 Bacillus sp. BH32 Isolate Unclassified
242 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
243 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
244 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
245 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
246 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
247 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
248 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 57.32
Metatranscriptomes 0.3
Isolates 42.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.63
Nodule 0
Rhizoplane 9.45
Rhizosphere 43.29
Stem 0
Stem Tuber 0
Unclassified 32.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006835 3300002987 Bacteria 3352
2 JGI25159J45721_1008986 3300002987 Bacteria 2681
3 JGI25151J46595_10000200 3300003187 Bacteria 73683
4 JGI25151J46595_10004140 3300003187 Bacteria 7751
5 JGI25151J46595_10004937 3300003187 Bacteria 6962
6 JGI25151J46595_10035389 3300003187 Bacteria 1897
7 JGI25151J46595_10038357 3300003187 Bacteria 1784
8 JGI25151J46595_10064976 3300003187 Bacteria 1139
9 JGI25151J46595_10072503 3300003187 Bacteria 1035
10 JGI25151J46595_10072646 3300003187 Bacteria 1034
11 rootH1_10000119 3300003316 Bacteria 90410
12 rootH2_10293405 3300003320 Bacteria 3064
13 rootL2_10022284 3300003322 Bacteria 35547
14 Ga0006562J51391_1000047 3300003578 Bacteria 14819
15 Ga0055538_1000068 3300003751 Bacteria 97329
16 Ga0055538_1000349 3300003751 Bacteria 20267
17 Ga0055532_1000126 3300003758 Bacteria 76489
18 Ga0055535_1002640 3300003761 Bacteria 5946
19 Ga0055536_1014704 3300003781 Bacteria 2724
20 Ga0055528_1007030 3300003790 Bacteria 5029
21 Ga0055541_1002765 3300003841 Bacteria 3416
22 Ga0055541_1004547 3300003841 Bacteria 2504
23 Ga0070682_100121172 3300005337 Bacteria 1756
24 Ga0070671_100056799 3300005355 Bacteria 3257
25 Ga0070667_100354947 3300005367 Bacteria 1328
26 Ga0068857_100233690 3300005577 Bacteria 1682
27 Ga0068852_100131434 3300005616 Bacteria 2306
28 Ga0068864_100264757 3300005618 Bacteria 1600
29 Ga0105251_10091385 3300009011 Bacteria 1398
30 Ga0105244_10007990 3300009036 Bacteria 6657
31 Ga0105244_10037902 3300009036 Bacteria 2517
32 Ga0105250_10005590 3300009092 Bacteria 5622
33 Ga0105250_10010750 3300009092 Bacteria 3809
34 Ga0105250_10020132 3300009092 Bacteria 2697
35 Ga0105245_10078290 3300009098 Bacteria 3017
36 Ga0105245_10586854 3300009098 Bacteria 1139
37 Ga0105247_10150183 3300009101 Bacteria 1534
38 Ga0105243_10002092 3300009148 Bacteria 16912
39 Ga0105239_10244712 3300010375 Bacteria 2013
40 Ga0105246_10053218 3300011119 Bacteria 2785
41 Ga0105246_10286617 3300011119 Bacteria 1323
42 Ga0157371_10051395 3300013102 Bacteria 2929
43 Ga0157378_10092394 3300013297 Bacteria 2753
44 Ga0157375_10176212 3300013308 Bacteria 2288
45 Ga0157376_10054571 3300014969 Bacteria 3332
46 Ga0209784_100253 3300025224 Bacteria 33410
47 Ga0209566_100015 3300025225 Bacteria 457963
48 Ga0209566_100345 3300025225 Bacteria 40126
49 Ga0209566_100417 3300025225 Bacteria 33299
50 Ga0209147_100182 3300025229 Bacteria 76541
51 Ga0209147_100245 3300025229 Bacteria 52865
52 Ga0209147_101329 3300025229 Bacteria 9443
53 Ga0209437_101985 3300025233 Bacteria 4221
54 Ga0209258_102479 3300025242 Bacteria 4726
55 Ga0209673_1003550 3300025273 Bacteria 9101
56 Ga0209130_1001564 3300025284 Bacteria 14494
57 Ga0209130_1003080 3300025284 Bacteria 7460
58 Ga0209130_1003265 3300025284 Bacteria 7092
59 Ga0209676_1000204 3300025292 Bacteria 132896
60 Ga0209676_1000851 3300025292 Bacteria 39362
61 Ga0209676_1018375 3300025292 Bacteria 2441
62 Ga0209676_1023693 3300025292 Bacteria 2004
63 Ga0209025_1000127 3300025294 Bacteria 200766
64 Ga0209025_1000577 3300025294 Bacteria 66553
65 Ga0209025_1001655 3300025294 Bacteria 27460
66 Ga0209025_1001856 3300025294 Bacteria 24783
67 Ga0209025_1004104 3300025294 Bacteria 12964
68 Ga0209025_1004273 3300025294 Bacteria 12547
69 Ga0209025_1004899 3300025294 Bacteria 11271
70 Ga0209025_1006676 3300025294 Bacteria 8861
71 Ga0209025_1025146 3300025294 Bacteria 3042
72 Ga0209025_1029755 3300025294 Bacteria 2632
73 Ga0209025_1031804 3300025294 Bacteria 2485
74 Ga0209025_1041824 3300025294 Bacteria 1956
75 Ga0207426_1013536 3300025302 Bacteria 3019
76 Ga0207656_10108905 3300025321 Bacteria 1278
77 Ga0207696_1003717 3300025711 Bacteria 6836
78 Ga0207696_1004235 3300025711 Bacteria 6229
79 Ga0207696_1011163 3300025711 Bacteria 3250
80 Ga0207696_1025537 3300025711 Bacteria 1840
81 Ga0207696_1032448 3300025711 Bacteria 1572
82 Ga0207655_1002243 3300025728 Bacteria 15988
83 Ga0207655_1029059 3300025728 Bacteria 2596
84 Ga0207713_1025578 3300025735 Bacteria 2722
85 Ga0207644_10020955 3300025931 Bacteria 4450
86 Ga0207686_10206893 3300025934 Bacteria 1408
87 Ga0207679_10187148 3300025945 Bacteria 1718
88 Ga0207678_10058383 3300026067 Bacteria 3320
89 Ga0207678_10219836 3300026067 Bacteria 1626
90 Ga0207708_10097730 3300026075 Bacteria 2269
91 Ga0207676_10406938 3300026095 Bacteria 1273
92 Ga0207674_10044863 3300026116 Bacteria 4552
93 Ga0207683_10087162 3300026121 Bacteria 2776
94 Ga0207683_10364300 3300026121 Bacteria 1327
95 Ga0207698_10489127 3300026142 Bacteria 1195
96 Ga0209371_1011835 3300027312 Bacteria 2563
97 Ga0237817_10450 3300030083 Bacteria 6196
98 Ga0237817_10453 3300030083 Bacteria 6172
99 Ga0268256_1012886 3300030500 Bacteria 2563
100 Ga0307408_100052393 3300031548 Bacteria 2943
101 Ga0316575_10001194 3300031665 Bacteria 8205
102 Ga0307410_10194951 3300031852 Bacteria 1543
103 Ga0307409_100225279 3300031995 Bacteria 1695
104 Ga0373956_0000625 3300035119 Bacteria 14511
105 Ga0316574_0003369 3300035398 Bacteria 8233
106 Ga0316574_0045362 3300035398 Unclassified 2722
107 Ga0316584_0070189 3300036712 Bacteria 2627
108 Ga0395899_0087135 3300037312 Bacteria 2267
109 Ga0237819_00373 3300038705 Bacteria 15840
110 Ga0237819_02240 3300038705 Bacteria 4062
111 Ga0439439_0005498 3300041406 Bacteria 2895
112 Ga0439439_0006960 3300041406 Bacteria 2630
113 Ga0451797_0600402 3300041453 Bacteria 2244
114 Ga0439433_0008551 3300041999 Bacteria 2222
115 Ga0439449_0000186 3300042007 Bacteria 21698
116 Ga0439462_0000441 3300042015 Bacteria 8122
117 Ga0439462_0005735 3300042015 Bacteria 3070
118 Ga0466969_0005265 3300044656 Bacteria 6890
119 Ga0453684_0192252 3300044712 Bacteria 2386
120 Ga0466959_0003094 3300045049 Bacteria 10784
121 Ga0451576_0000067 3300045051 Bacteria 265145
122 Ga0451576_0001746 3300045051 Bacteria 35704
123 Ga0466967_0011984 3300045976 Bacteria 6605
124 Ga0466967_0098923 3300045976 Bacteria 2664
125 Ga0495590_0033014 3300046457 Bacteria 1810
126 Ga0495584_0122194 3300046491 Bacteria 1319
127 Ga0495622_0028299 3300046557 Bacteria 2617
128 Ga0495676_0053548 3300047321 Bacteria 3215
129 Ga0495683_0024943 3300047323 Bacteria 3066
130 Ga0495626_0154356 3300048091 Bacteria 966
131 Ga0496100_0039415 3300048903 Bacteria 3000
132 Ga0496101_0001169 3300048904 Bacteria 15706
133 Ga0496102_0002061 3300048905 Bacteria 17306
134 Ga0496102_0050930 3300048905 Bacteria 3772
135 Ga0496102_0305914 3300048905 Bacteria 1498
136 Ga0496103_0001039 3300048906 Bacteria 19439
137 Ga0496103_0019576 3300048906 Bacteria 4064
138 Ga0496104_0008887 3300048907 Bacteria 8927
139 Ga0496104_0249544 3300048907 Bacteria 1687
140 Ga0496105_0000223 3300048908 Bacteria 38096
141 Ga0496106_0000875 3300048909 Bacteria 21949
142 Ga0496107_0005512 3300048910 Bacteria 8661
143 Ga0496108_0000942 3300048911 Bacteria 22705
144 Ga0496108_0001567 3300048911 Bacteria 18102
145 Ga0496109_0000329 3300048912 Bacteria 44242
146 Ga0496109_0011179 3300048912 Bacteria 7703
147 Ga0496110_0000735 3300048913 Bacteria 22638
148 Ga0496110_0115704 3300048913 Bacteria 2414
149 Ga0496110_0510871 3300048913 Bacteria 1093
150 Ga0496110_0573387 3300048913 Bacteria 1025
151 Ga0496111_0001374 3300048914 Bacteria 13796
152 Ga0496111_0010810 3300048914 Bacteria 6135
153 Ga0496111_0037725 3300048914 Bacteria 3459
154 Ga0496112_0002742 3300048915 Bacteria 14273
155 Ga0496112_0074552 3300048915 Bacteria 3355
156 Ga0496112_0573706 3300048915 Bacteria 1061
157 Ga0496113_0184719 3300048916 Bacteria 1653
158 Ga0496114_0078243 3300048917 Bacteria 2790
159 Ga0496114_0156155 3300048917 Bacteria 1981
160 Ga0496116_0002870 3300048919 Bacteria 17647
161 Ga0496116_0029745 3300048919 Bacteria 3932
162 Ga0496116_0104789 3300048919 Bacteria 1679
163 Ga0496117_0012130 3300048920 Bacteria 7640
164 Ga0496118_0072233 3300048921 Bacteria 2479
165 Ga0496119_0001421 3300048922 Bacteria 28989
166 Ga0496119_0004043 3300048922 Bacteria 14816
167 Ga0496119_0006270 3300048922 Bacteria 11091
168 Ga0496120_0000470 3300048923 Bacteria 63180
169 Ga0496120_0030789 3300048923 Bacteria 3257
170 Ga0496121_0102479 3300048924 Bacteria 2205
171 Ga0496122_0008562 3300048925 Bacteria 11001
172 Ga0496122_0010989 3300048925 Bacteria 9250
173 Ga0496122_0046198 3300048925 Bacteria 3375
174 Ga0496122_0066573 3300048925 Bacteria 2601
175 Ga0496122_0135790 3300048925 Bacteria 1550
176 Ga0496123_0021751 3300048926 Bacteria 4972
177 Ga0496123_0028271 3300048926 Bacteria 4156
178 Ga0496124_0000171 3300048927 Bacteria 130630
179 Ga0496124_0000629 3300048927 Bacteria 58592
180 Ga0496124_0017594 3300048927 Bacteria 6732
181 Ga0496124_0025556 3300048927 Bacteria 5348
182 Ga0496124_0168704 3300048927 Bacteria 1698
183 Ga0496125_0000346 3300048928 Bacteria 88074
184 Ga0496125_0006548 3300048928 Bacteria 12551
185 Ga0496125_0048593 3300048928 Bacteria 3536
186 Ga0496126_0004722 3300048929 Bacteria 16076
187 Ga0496126_0023810 3300048929 Bacteria 5928
188 Ga0501070_0235630 3300049586 Bacteria 1499
189 nmdc:mga0qj67_91754_c1 3300050509 Bacteria 2441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0184719 Ga0496113_0184719_800_1621 237
2 3300025321 Ga0207656_10108905 Ga0207656_101089052 250
3 3300013308 Ga0157375_10176212 Ga0157375_101762123 269
4 3300014969 Ga0157376_10054571 Ga0157376_100545711 269
5 3300026067 Ga0207678_10219836 Ga0207678_102198362 269
6 3300026121 Ga0207683_10364300 Ga0207683_103643001 269
7 3300048917 Ga0496114_0078243 Ga0496114_0078243_1749_2723 269
8 3300048091 Ga0495626_0154356 Ga0495626_0154356_108_932 270
9 3300025294 Ga0209025_1031804 Ga0209025_10318042 273
10 3300025292 Ga0209676_1000851 Ga0209676_10008515 274
11 3300050509 nmdc:mga0qj67_91754_c1 nmdc:mga0qj67_91754_c1_813_1736 274
12 3300003751 Ga0055538_1000068 Ga0055538_100006886 276
13 3300005337 Ga0070682_100121172 Ga0070682_1001211721 276
14 3300005618 Ga0068864_100264757 Ga0068864_1002647572 276
15 3300025292 Ga0209676_1018375 Ga0209676_10183755 276
16 3300026067 Ga0207678_10058383 Ga0207678_100583832 276
17 3300026095 Ga0207676_10406938 Ga0207676_104069382 276
18 3300026142 Ga0207698_10489127 Ga0207698_104891271 276
19 3300048905 Ga0496102_0305914 Ga0496102_0305914_135_1073 276
20 3300048907 Ga0496104_0008887 Ga0496104_0008887_426_1364 276
21 3300048911 Ga0496108_0001567 Ga0496108_0001567_12541_13479 276
22 3300048912 Ga0496109_0011179 Ga0496109_0011179_3289_4227 276
23 3300048914 Ga0496111_0010810 Ga0496111_0010810_338_1276 276
24 3300048915 Ga0496112_0573706 Ga0496112_0573706_36_974 276
25 3300048917 Ga0496114_0156155 Ga0496114_0156155_762_1700 276
26 3300025294 Ga0209025_1001856 Ga0209025_100185614 277
27 3300003187 JGI25151J46595_10004937 JGI25151J46595_100049373 281
28 3300031852 Ga0307410_10194951 Ga0307410_101949512 281
29 3300048925 Ga0496122_0066573 Ga0496122_0066573_1137_2081 282
30 3300045051 Ga0451576_0000067 Ga0451576_0000067_21321_22223 285
31 3300048919 Ga0496116_0002870 Ga0496116_0002870_4057_5007 285
32 3300025294 Ga0209025_1004104 Ga0209025_100410414 288
33 3300005616 Ga0068852_100131434 Ga0068852_1001314342 289
34 3300009098 Ga0105245_10078290 Ga0105245_100782902 289
35 3300049586 Ga0501070_0235630 Ga0501070_0235630_30_944 289
36 3300005367 Ga0070667_100354947 Ga0070667_1003549472 290
37 3300005577 Ga0068857_100233690 Ga0068857_1002336901 290
38 3300025945 Ga0207679_10187148 Ga0207679_101871482 290
39 3300026075 Ga0207708_10097730 Ga0207708_100977302 290
40 3300026116 Ga0207674_10044863 Ga0207674_100448633 290
41 3300026121 Ga0207683_10087162 Ga0207683_100871622 290
42 3300048921 Ga0496118_0072233 Ga0496118_0072233_1508_2410 291
43 3300048926 Ga0496123_0028271 Ga0496123_0028271_1507_2409 291
44 iso_pu_bacteria 2563366752 2563930567 291
45 3300031665 Ga0316575_10001194 Ga0316575_100011943 293
46 3300035398 Ga0316574_0003369 Ga0316574_0003369_6576_7508 293
47 3300041453 Ga0451797_0600402 Ga0451797_0600402_692_1663 293
48 3300048920 Ga0496117_0012130 Ga0496117_0012130_3208_4188 293
49 3300048922 Ga0496119_0001421 Ga0496119_0001421_9946_10926 293
50 3300048923 Ga0496120_0000470 Ga0496120_0000470_9285_10265 293
51 3300048925 Ga0496122_0008562 Ga0496122_0008562_5858_6838 293
52 3300048927 Ga0496124_0000171 Ga0496124_0000171_82521_83501 293
53 3300048929 Ga0496126_0004722 Ga0496126_0004722_7970_8950 293
54 iso_pu_bacteria 2788500588 2791212446 294
55 iso_pu_bacteria 2818991451 2819626051 294
56 iso_pu_bacteria 2904606771 2904611187 294
57 iso_pu_bacteria 8055531788 8055533125 294
58 3300041406 Ga0439439_0005498 Ga0439439_0005498_614_1522 295
59 iso_pu_bacteria 2939593269 2939593481 295
60 3300003841 Ga0055541_1004547 Ga0055541_10045473 296
61 3300025225 Ga0209566_100345 Ga0209566_1003456 296
62 3300035119 Ga0373956_0000625 Ga0373956_0000625_9348_10289 297
63 3300036712 Ga0316584_0070189 Ga0316584_0070189_947_1885 297
64 iso_pu_bacteria 2866552031 2866553667 297
65 iso_pu_bacteria 2881633906 2881636084 297
66 iso_pu_bacteria 8056207758 8056211543 297
67 3300035398 Ga0316574_0045362 Ga0316574_0045362_10_945 298
68 3300044712 Ga0453684_0192252 Ga0453684_0192252_1449_2375 300
69 iso_pu_bacteria 2831905167 2831907142 300
70 3300013102 Ga0157371_10051395 Ga0157371_100513954 301
71 iso_pu_bacteria 2795385472 2795797601 301
72 iso_pu_bacteria 2964375228 2964378663 301
73 iso_pu_bacteria 3001267043 3001267708 301
74 iso_pu_bacteria 3006988479 3006989521 301
75 3300045051 Ga0451576_0001746 Ga0451576_0001746_6845_7768 302
76 iso_pu_bacteria 2852673933 2852675085 303
77 iso_pu_bacteria 2738543010 2739231165 304
78 iso_pu_bacteria 8002317523 8002319612 304
79 iso_pu_bacteria 8046991243 8046998632 304
80 iso_pu_bacteria 2738541299 2738837694 305
81 iso_pu_bacteria 2857604169 2857605213 305
82 iso_pu_bacteria 8022792930 8022793542 305
83 3300037312 Ga0395899_0087135 Ga0395899_0087135_167_1108 306
84 iso_pu_bacteria 2643221543 2643735563 306
85 iso_pu_bacteria 2821111986 2821112065 306
86 iso_pu_bacteria 2885526491 2885527579 306
87 iso_pu_bacteria 2904162308 2904163786 306
88 iso_pu_bacteria 2962290636 2962292736 306
89 iso_pu_bacteria 2980182181 2980189520 306
90 3300003761 Ga0055535_1002640 Ga0055535_10026404 307
91 3300003841 Ga0055541_1002765 Ga0055541_10027653 307
92 3300025225 Ga0209566_100015 Ga0209566_10001553 307
93 3300025242 Ga0209258_102479 Ga0209258_1024793 307
94 iso_pu_bacteria 2864733723 2864737981 307
95 iso_pu_bacteria 2916971899 2916974489 307
96 iso_pu_bacteria 2925326138 2925331417 307
97 3300025229 Ga0209147_100245 Ga0209147_10024537 308
98 3300025292 Ga0209676_1023693 Ga0209676_10236933 308
99 iso_pu_bacteria 2524023129 2524186087 308
100 iso_pu_bacteria 2808606364 2808868652 308
101 iso_pu_bacteria 2864997549 2865001570 308
102 iso_pu_bacteria 2889042446 2889046187 308
103 iso_pu_bacteria 2889295896 2889296990 308
104 iso_pu_bacteria 2904490793 2904493089 308
105 iso_pu_bacteria 2919160200 2919162380 308
106 iso_pu_bacteria 2931384279 2931389637 308
107 iso_pu_bacteria 2939679117 2939680937 308
108 iso_pu_bacteria 2945991243 2945991678 308
109 iso_pu_bacteria 2946053406 2946054384 308
110 iso_pu_bacteria 2981284811 2981285464 308
111 iso_pu_bacteria 2981289755 2981290411 308
112 iso_pu_bacteria 2981980479 2981980961 308
113 iso_pu_bacteria 2981985349 2981985847 308
114 iso_pu_bacteria 3001272096 3001273183 308
115 iso_pu_bacteria 3006973921 3006974923 308
116 iso_pu_bacteria 8022948649 8022949375 308
117 3300003751 Ga0055538_1000349 Ga0055538_100034920 309
118 3300025224 Ga0209784_100253 Ga0209784_10025310 309
119 3300025233 Ga0209437_101985 Ga0209437_1019852 309
120 3300027312 Ga0209371_1011835 Ga0209371_10118352 309
121 3300030500 Ga0268256_1012886 Ga0268256_10128862 309
122 3300044656 Ga0466969_0005265 Ga0466969_0005265_1007_1960 309
123 3300045049 Ga0466959_0003094 Ga0466959_0003094_5625_6578 309
124 3300048927 Ga0496124_0017594 Ga0496124_0017594_4307_5263 309
125 3300048928 Ga0496125_0048593 Ga0496125_0048593_907_1863 309
126 iso_pu_bacteria 2585428059 2587740965 309
127 iso_pu_bacteria 2593339198 2595315401 309
128 iso_pu_bacteria 2643221676 2644422278 309
129 iso_pu_bacteria 2818991441 2819570826 309
130 iso_pu_bacteria 2818991459 2819669046 309
131 iso_pu_bacteria 2857453340 2857453971 309
132 iso_pu_bacteria 2881644220 2881647248 309
133 iso_pu_bacteria 2904755435 2904762219 309
134 iso_pu_bacteria 2919425241 2919429311 309
135 iso_pu_bacteria 2928510474 2928511798 309
136 iso_pu_bacteria 2971410472 2971416932 309
137 iso_pu_bacteria 3006984091 3006985440 309
138 iso_pu_bacteria 8056533031 8056533915 309
139 iso_pu_bacteria 2671180330 2672335224 310
140 iso_pu_bacteria 2816332186 2816864070 310
141 iso_pu_bacteria 2842682962 2842688095 310
142 iso_pu_bacteria 2849139964 2849145018 310
143 iso_pu_bacteria 2857581216 2857586679 310
144 iso_pu_bacteria 2977254563 2977258238 310
145 iso_pu_bacteria 2990275345 2990279246 310
146 iso_pu_bacteria 3006826541 3006828050 310
147 iso_pu_bacteria 8057632132 8057634280 310
148 3300003320 rootH2_10293405 rootH2_102934052 311
149 iso_pu_bacteria 2671180694 2673823558 311
150 iso_pu_bacteria 2956897341 2956901259 312
151 iso_pu_bacteria 8057582654 8057586137 312
152 iso_pu_bacteria 2571042588 2573037212 313
153 iso_pu_bacteria 2576861424 2578337358 313
154 iso_pu_bacteria 2579778775 2580931486 313
155 iso_pu_bacteria 2619619294 2621275663 313
156 iso_pu_bacteria 2643221729 2644705441 313
157 iso_pu_bacteria 2643221730 2644710134 313
158 iso_pu_bacteria 2684622632 2685151682 313
159 iso_pu_bacteria 2695420987 2698321539 313
160 iso_pu_bacteria 2703719227 2705995621 313
161 iso_pu_bacteria 2718218445 2721506844 313
162 iso_pu_bacteria 2721755693 2723604486 313
163 iso_pu_bacteria 2728369359 2730135122 313
164 iso_pu_bacteria 2738541358 2739155176 313
165 iso_pu_bacteria 2738543006 2739207503 313
166 iso_pu_bacteria 2751185905 2753810057 313
167 iso_pu_bacteria 2802428803 2802436758 313
168 iso_pu_bacteria 2818991443 2819580852 313
169 iso_pu_bacteria 2881636855 2881637305 313
170 iso_pu_bacteria 2889276214 2889280385 313
171 iso_pu_bacteria 2904595352 2904595674 313
172 iso_pu_bacteria 2919414237 2919414453 313
173 iso_pu_bacteria 2929233124 2929237369 313
174 iso_pu_bacteria 2938917290 2938921564 313
175 iso_pu_bacteria 2939702853 2939705683 313
176 iso_pu_bacteria 2947426588 2947430458 313
177 iso_pu_bacteria 2965761152 2965765363 313
178 iso_pu_bacteria 2971511577 2971511823 313
179 iso_pu_bacteria 2979083700 2979087325 313
180 iso_pu_bacteria 2980176882 2980176963 313
181 iso_pu_bacteria 2996706504 2996710232 313
182 iso_pu_bacteria 3001892409 3001893381 313
183 iso_pu_bacteria 648028048 648170531 313
184 iso_pu_bacteria 8022621104 8022623571 313
185 iso_pu_bacteria 8023438354 8023440456 313
186 iso_pu_bacteria 8023444577 8023446520 313
187 3300003187 JGI25151J46595_10004140 JGI25151J46595_100041407 314
188 3300003316 rootH1_10000119 rootH1_100001199 314
189 3300003322 rootL2_10022284 rootL2_100222847 314
190 3300003578 Ga0006562J51391_1000047 Ga0006562J51391_100004711 314
191 3300003790 Ga0055528_1007030 Ga0055528_10070303 314
192 3300005355 Ga0070671_100056799 Ga0070671_1000567992 314
193 3300009098 Ga0105245_10586854 Ga0105245_105868541 314
194 3300009101 Ga0105247_10150183 Ga0105247_101501831 314
195 3300009148 Ga0105243_10002092 Ga0105243_1000209210 314
196 3300010375 Ga0105239_10244712 Ga0105239_102447122 314
197 3300011119 Ga0105246_10053218 Ga0105246_100532182 314
198 3300013297 Ga0157378_10092394 Ga0157378_100923942 314
199 3300025273 Ga0209673_1003550 Ga0209673_10035503 314
200 3300025302 Ga0207426_1013536 Ga0207426_10135361 314
201 3300025711 Ga0207696_1003717 Ga0207696_10037172 314
202 3300025728 Ga0207655_1029059 Ga0207655_10290593 314
203 3300025735 Ga0207713_1025578 Ga0207713_10255782 314
204 3300025931 Ga0207644_10020955 Ga0207644_100209555 314
205 3300025934 Ga0207686_10206893 Ga0207686_102068932 314
206 3300031548 Ga0307408_100052393 Ga0307408_1000523934 314
207 3300046491 Ga0495584_0122194 Ga0495584_0122194_219_1196 314
208 3300047321 Ga0495676_0053548 Ga0495676_0053548_1536_2513 314
209 3300047323 Ga0495683_0024943 Ga0495683_0024943_1265_2242 314
210 3300048903 Ga0496100_0039415 Ga0496100_0039415_84_1061 314
211 3300048904 Ga0496101_0001169 Ga0496101_0001169_12790_13767 314
212 3300048905 Ga0496102_0002061 Ga0496102_0002061_14390_15367 314
213 3300048906 Ga0496103_0001039 Ga0496103_0001039_9572_10549 314
214 3300048907 Ga0496104_0249544 Ga0496104_0249544_45_1022 314
215 3300048908 Ga0496105_0000223 Ga0496105_0000223_9378_10355 314
216 3300048909 Ga0496106_0000875 Ga0496106_0000875_2950_3927 314
217 3300048910 Ga0496107_0005512 Ga0496107_0005512_3772_4749 314
218 3300048911 Ga0496108_0000942 Ga0496108_0000942_12839_13816 314
219 3300048912 Ga0496109_0000329 Ga0496109_0000329_8833_9810 314
220 3300048913 Ga0496110_0000735 Ga0496110_0000735_5153_6136 314
221 3300048913 Ga0496110_0510871 Ga0496110_0510871_45_1022 314
222 3300048914 Ga0496111_0001374 Ga0496111_0001374_4041_5018 314
223 3300048914 Ga0496111_0037725 Ga0496111_0037725_1267_2250 314
224 3300048915 Ga0496112_0002742 Ga0496112_0002742_1282_2259 314
225 3300048919 Ga0496116_0104789 Ga0496116_0104789_371_1363 314
226 3300048922 Ga0496119_0004043 Ga0496119_0004043_3905_4882 314
227 3300048924 Ga0496121_0102479 Ga0496121_0102479_1039_2016 314
228 3300048925 Ga0496122_0010989 Ga0496122_0010989_4233_5210 314
229 3300048925 Ga0496122_0046198 Ga0496122_0046198_373_1362 314
230 3300048927 Ga0496124_0025556 Ga0496124_0025556_2494_3471 314
231 3300048928 Ga0496125_0006548 Ga0496125_0006548_8582_9559 314
232 3300048929 Ga0496126_0023810 Ga0496126_0023810_2069_3046 314
233 iso_pu_bacteria 2593339131 2595089362 314
234 iso_pu_bacteria 2643221731 2644716210 314
235 iso_pu_bacteria 2643221732 2644723920 314
236 iso_pu_bacteria 2738543017 2739268423 314
237 iso_pu_bacteria 2757320391 2757565117 314
238 iso_pu_bacteria 2775507177 2777763435 314
239 iso_pu_bacteria 2775507192 2777838388 314
240 iso_pu_bacteria 2818991465 2819709682 314
241 iso_pu_bacteria 2842882022 2842884061 314
242 iso_pu_bacteria 2857472729 2857475835 314
243 iso_pu_bacteria 2857586860 2857588448 314
244 iso_pu_bacteria 2904524088 2904524909 314
245 iso_pu_bacteria 2919143609 2919146502 314
246 iso_pu_bacteria 2919517244 2919518418 314
247 iso_pu_bacteria 2919720352 2919722783 314
248 iso_pu_bacteria 2928093941 2928096657 314
249 iso_pu_bacteria 2929004312 2929005936 314
250 iso_pu_bacteria 2936340661 2936343447 314
251 iso_pu_bacteria 2960319331 2960320408 314
252 iso_pu_bacteria 2960375949 2960379669 314
253 iso_pu_bacteria 3006978542 3006979323 314
254 iso_pu_bacteria 8022893055 8022897735 314
255 iso_pu_bacteria 8022914991 8022916914 314
256 3300003758 Ga0055532_1000126 Ga0055532_100012647 315
257 3300025225 Ga0209566_100417 Ga0209566_1004173 315
258 3300025229 Ga0209147_100182 Ga0209147_10018230 315
259 3300025292 Ga0209676_1000204 Ga0209676_100020475 315
260 3300025294 Ga0209025_1000127 Ga0209025_100012764 315
261 3300025294 Ga0209025_1004273 Ga0209025_10042731 315
262 3300025294 Ga0209025_1006676 Ga0209025_100667610 315
263 3300048905 Ga0496102_0050930 Ga0496102_0050930_963_1919 315
264 3300048906 Ga0496103_0019576 Ga0496103_0019576_569_1525 315
265 3300048922 Ga0496119_0006270 Ga0496119_0006270_9100_10074 315
266 3300048923 Ga0496120_0030789 Ga0496120_0030789_1571_2545 315
267 3300048927 Ga0496124_0168704 Ga0496124_0168704_432_1406 315
268 3300002987 JGI25159J45721_1008986 JGI25159J45721_10089863 316
269 3300003187 JGI25151J46595_10035389 JGI25151J46595_100353893 316
270 3300003187 JGI25151J46595_10038357 JGI25151J46595_100383573 316
271 3300009036 Ga0105244_10037902 Ga0105244_100379023 316
272 3300009092 Ga0105250_10020132 Ga0105250_100201323 316
273 3300011119 Ga0105246_10286617 Ga0105246_102866171 316
274 3300025284 Ga0209130_1003080 Ga0209130_10030806 316
275 3300025294 Ga0209025_1001655 Ga0209025_10016559 316
276 3300025294 Ga0209025_1004899 Ga0209025_10048992 316
277 3300025294 Ga0209025_1041824 Ga0209025_10418243 316
278 3300025711 Ga0207696_1025537 Ga0207696_10255372 316
279 3300031995 Ga0307409_100225279 Ga0307409_1002252793 316
280 3300045976 Ga0466967_0098923 Ga0466967_0098923_1272_2240 316
281 3300046557 Ga0495622_0028299 Ga0495622_0028299_398_1363 316
282 3300048913 Ga0496110_0115704 Ga0496110_0115704_677_1642 316
283 3300048915 Ga0496112_0074552 Ga0496112_0074552_2222_3187 316
284 iso_pu_bacteria 2738541295 2738814881 316
285 iso_pu_bacteria 2936361878 2936365482 316
286 3300002987 JGI25159J45721_1006835 JGI25159J45721_10068352 317
287 3300003187 JGI25151J46595_10000200 JGI25151J46595_1000020025 317
288 3300003187 JGI25151J46595_10064976 JGI25151J46595_100649762 317
289 3300003187 JGI25151J46595_10072503 JGI25151J46595_100725031 317
290 3300003187 JGI25151J46595_10072646 JGI25151J46595_100726461 317
291 3300003781 Ga0055536_1014704 Ga0055536_10147043 317
292 3300009011 Ga0105251_10091385 Ga0105251_100913851 317
293 3300009036 Ga0105244_10007990 Ga0105244_100079905 317
294 3300009092 Ga0105250_10005590 Ga0105250_100055905 317
295 3300009092 Ga0105250_10010750 Ga0105250_100107501 317
296 3300025229 Ga0209147_101329 Ga0209147_10132910 317
297 3300025284 Ga0209130_1001564 Ga0209130_100156414 317
298 3300025284 Ga0209130_1003265 Ga0209130_10032651 317
299 3300025294 Ga0209025_1000577 Ga0209025_100057760 317
300 3300025294 Ga0209025_1025146 Ga0209025_10251463 317
301 3300025294 Ga0209025_1029755 Ga0209025_10297553 317
302 3300025711 Ga0207696_1004235 Ga0207696_10042351 317
303 3300025711 Ga0207696_1011163 Ga0207696_10111631 317
304 3300025711 Ga0207696_1032448 Ga0207696_10324481 317
305 3300025728 Ga0207655_1002243 Ga0207655_10022433 317
306 3300030083 Ga0237817_10450 Ga0237817_104505 317
307 3300030083 Ga0237817_10453 Ga0237817_104535 317
308 3300038705 Ga0237819_00373 Ga0237819_00373_409_1362 317
309 3300038705 Ga0237819_02240 Ga0237819_02240_432_1385 317
310 3300041406 Ga0439439_0006960 Ga0439439_0006960_55_1089 317
311 3300041999 Ga0439433_0008551 Ga0439433_0008551_772_1758 317
312 3300042007 Ga0439449_0000186 Ga0439449_0000186_19905_20939 317
313 3300042015 Ga0439462_0000441 Ga0439462_0000441_5708_6742 317
314 3300042015 Ga0439462_0005735 Ga0439462_0005735_291_1277 317
315 3300045976 Ga0466967_0011984 Ga0466967_0011984_1119_2072 317
316 3300046457 Ga0495590_0033014 Ga0495590_0033014_178_1188 317
317 3300048913 Ga0496110_0573387 Ga0496110_0573387_47_1000 317
318 3300048919 Ga0496116_0029745 Ga0496116_0029745_2863_3891 317
319 3300048925 Ga0496122_0135790 Ga0496122_0135790_42_1070 317
320 3300048926 Ga0496123_0021751 Ga0496123_0021751_3350_4378 317
321 3300048927 Ga0496124_0000629 Ga0496124_0000629_34925_35953 317
322 3300048928 Ga0496125_0000346 Ga0496125_0000346_62775_63803 317
323 iso_pu_bacteria 2791355222 2793184379 317
324 iso_pu_bacteria 2865002811 2865004310 317
325 iso_pu_bacteria 2888578766 2888582559 317
326 iso_pu_bacteria 2889049205 2889055232 317
327 iso_pu_bacteria 2904113452 2904115565 317
328 iso_pu_bacteria 8057977335 8057980640 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

55

298

0.97

PF01745

IPT

Isopentenyl transferase

20

79

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9556 6 310
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9363 6 310
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9185 5 308
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.908 8 312
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8996 8 312
ID Description Score Start End Superfamily
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9982 203 283 1.10.287.890
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9864 6 120 3.40.50.300
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9857 203 283 1.10.287.890
af_A0A0P0X3E8_17_159_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9713 8 118 3.40.50.300
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 5 112 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X0QW13-F1-model_v4 IPPT-domain-containing protein 0.9913 9 112 GO:0005524
GO:0005739
GO:0006400
GO:0052381
AF-A0A496JYQ4-F1-model_v4 deleted 0.9849 5 106
AF-A0A0B0DB55-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9786 4 287 GO:0005524
GO:0006400
GO:0052381
AF-A0A496JYQ4-F1-model_v4 deleted 0.9754 5 106
AF-A0A0B0DB55-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9752 4 287 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
90.92 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map