F409313

General Info

Members Datasets Scaffolds Average Seq Length
328 217 656 128

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0134322|Ga0373936_0134322_156_572
Length 138
Sequence MTRQSDIIPAMTNNLASFAIHVDEVDRARAFYEAVFGWVFEPWGPPGFYLIHTGDEASPGIQGLMHKRRVPRSGTGLNGFEATFAVGDVDAIAARVEASGGKLTMQKSVIPTVGALIRFLDTEGNDVGAMRYDTVPHT

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
217 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.3
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 0
Rhizoplane 3.96
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 13.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0134322 3300035113 Unclassified 1065
2 JGI25165J46597_1000024 3300003214 Bacteria 335150
3 Ga0065707_10545022 3300005295 Bacteria 725
4 Ga0070658_10459249 3300005327 Bacteria 1098
5 Ga0070658_10574140 3300005327 Bacteria 976
6 Ga0070676_10042532 3300005328 Bacteria 2638
7 Ga0070683_100000049 3300005329 Bacteria 93310
8 Ga0070683_100018355 3300005329 Bacteria 6194
9 Ga0070683_100305147 3300005329 Bacteria 1514
10 Ga0070683_101224705 3300005329 Bacteria 721
11 Ga0070670_100350164 3300005331 Bacteria 1297
12 Ga0068869_100470328 3300005334 Bacteria 1045
13 Ga0070666_10304843 3300005335 Bacteria 1135
14 Ga0070682_100080216 3300005337 Bacteria 2109
15 Ga0070682_100795928 3300005337 Bacteria 768
16 Ga0068868_100952329 3300005338 Bacteria 783
17 Ga0070691_10515076 3300005341 Bacteria 694
18 Ga0070661_100414801 3300005344 Bacteria 1066
19 Ga0070692_10100512 3300005345 Bacteria 1585
20 Ga0070668_100029769 3300005347 Bacteria 4148
21 Ga0070668_101494609 3300005347 Unclassified 617
22 Ga0070669_100000206 3300005353 Bacteria 50220
23 Ga0070669_100129564 3300005353 Bacteria 1934
24 Ga0070675_100114530 3300005354 Bacteria 2285
25 Ga0070674_100516316 3300005356 Bacteria 997
26 Ga0070673_100953654 3300005364 Bacteria 797
27 Ga0070688_100439982 3300005365 Bacteria 973
28 Ga0070659_101783725 3300005366 Bacteria 551
29 Ga0070667_101260140 3300005367 Unclassified 692
30 Ga0070714_100598023 3300005435 Unclassified 1059
31 Ga0070713_100784275 3300005436 Bacteria 913
32 Ga0070694_101359685 3300005444 Bacteria 598
33 Ga0070663_101189058 3300005455 Bacteria 669
34 Ga0070678_100179756 3300005456 Bacteria 1731
35 Ga0070678_100691499 3300005456 Bacteria 918
36 Ga0070662_100038774 3300005457 Bacteria 3385
37 Ga0070681_11093775 3300005458 Bacteria 718
38 Ga0070685_10101674 3300005466 Bacteria 1756
39 Ga0070706_100189070 3300005467 Bacteria 1924
40 Ga0070707_100116306 3300005468 Bacteria 2595
41 Ga0070698_100021665 3300005471 Bacteria 6728
42 Ga0070698_100113118 3300005471 Bacteria 2679
43 Ga0070699_100001011 3300005518 Bacteria 26146
44 Ga0070679_100426549 3300005530 Bacteria 1271
45 Ga0070684_100000040 3300005535 Bacteria 93306
46 Ga0070684_100568922 3300005535 Bacteria 1052
47 Ga0068853_100091679 3300005539 Bacteria 2673
48 Ga0068853_101114681 3300005539 Bacteria 761
49 Ga0070672_100532111 3300005543 Bacteria 1019
50 Ga0070672_100628973 3300005543 Bacteria 936
51 Ga0070672_100718127 3300005543 Bacteria 876
52 Ga0070686_100013784 3300005544 Bacteria 4638
53 Ga0070693_100355720 3300005547 Bacteria 1004
54 Ga0070693_100830431 3300005547 Bacteria 687
55 Ga0070665_100537724 3300005548 Bacteria 1180
56 Ga0070665_100798316 3300005548 Unclassified 957
57 Ga0070704_101165215 3300005549 Bacteria 702
58 Ga0068855_100181822 3300005563 Bacteria 2377
59 Ga0068855_100225944 3300005563 Unclassified 2098
60 Ga0068857_100080041 3300005577 Bacteria 2917
61 Ga0068854_100332899 3300005578 Bacteria 1238
62 Ga0068854_100947372 3300005578 Bacteria 759
63 Ga0070702_100417434 3300005615 Bacteria 964
64 Ga0068852_100250193 3300005616 Bacteria 1698
65 Ga0068852_100988039 3300005616 Bacteria 860
66 Ga0068852_101225939 3300005616 Bacteria 771
67 Ga0068859_100576685 3300005617 Bacteria 1219
68 Ga0068859_101031982 3300005617 Bacteria 903
69 Ga0068864_100000930 3300005618 Bacteria 24547
70 Ga0068864_100257104 3300005618 Bacteria 1623
71 Ga0068864_100259989 3300005618 Bacteria 1615
72 Ga0068864_101290573 3300005618 Bacteria 730
73 Ga0068866_10307347 3300005718 Bacteria 993
74 Ga0068861_100000282 3300005719 Bacteria 28556
75 Ga0068861_100420582 3300005719 Bacteria 1190
76 Ga0068861_101444636 3300005719 Unclassified 673
77 Ga0068851_10276707 3300005834 Bacteria 959
78 Ga0068863_100003339 3300005841 Bacteria 15846
79 Ga0068858_100001536 3300005842 Bacteria 23689
80 Ga0068858_100061071 3300005842 Bacteria 3484
81 Ga0068858_100688276 3300005842 Bacteria 995
82 Ga0068860_100003973 3300005843 Bacteria 15185
83 Ga0068860_100043953 3300005843 Bacteria 4260
84 Ga0068862_100000291 3300005844 Bacteria 55364
85 Ga0068862_100523247 3300005844 Bacteria 1129
86 Ga0068862_101046411 3300005844 Unclassified 809
87 Ga0068862_101252873 3300005844 Bacteria 742
88 Ga0068862_102427223 3300005844 Unclassified 536
89 Ga0070717_10129619 3300006028 Bacteria 2168
90 Ga0070717_10460429 3300006028 Bacteria 1147
91 Ga0070716_100602091 3300006173 Bacteria 827
92 Ga0097621_101702698 3300006237 Bacteria 600
93 Ga0068871_100385747 3300006358 Bacteria 1245
94 Ga0075428_100745561 3300006844 Unclassified 1042
95 Ga0068865_100134454 3300006881 Bacteria 1856
96 Ga0068865_100902541 3300006881 Bacteria 768
97 Ga0097620_100576678 3300006931 Bacteria 1219
98 Ga0097620_101032012 3300006931 Bacteria 903
99 Ga0105240_10025313 3300009093 Bacteria 7800
100 Ga0105240_10064690 3300009093 Unclassified 4543
101 Ga0105240_10198014 3300009093 Bacteria 2356
102 Ga0111539_10141255 3300009094 Bacteria 2819
103 Ga0105245_10042104 3300009098 Bacteria 4074
104 Ga0105245_11161275 3300009098 Bacteria 819
105 Ga0105245_12298733 3300009098 Bacteria 593
106 Ga0105247_10012066 3300009101 Bacteria 5191
107 Ga0105243_10445492 3300009148 Bacteria 1214
108 Ga0105243_10485223 3300009148 Bacteria 1167
109 Ga0105243_10567950 3300009148 Bacteria 1087
110 Ga0105243_10783461 3300009148 Unclassified 938
111 Ga0105241_10100015 3300009174 Bacteria 2304
112 Ga0105242_10605906 3300009176 Bacteria 1059
113 Ga0105248_10444328 3300009177 Bacteria 1461
114 Ga0105248_11528577 3300009177 Unclassified 756
115 Ga0105237_10009969 3300009545 Bacteria 10137
116 Ga0105237_10316438 3300009545 Bacteria 1564
117 Ga0105238_10124928 3300009551 Bacteria 2552
118 Ga0105238_10539403 3300009551 Unclassified 1170
119 Ga0105238_10815051 3300009551 Bacteria 949
120 Ga0105238_11016959 3300009551 Bacteria 850
121 Ga0105238_12053074 3300009551 Bacteria 605
122 Ga0105249_10000067 3300009553 Bacteria 149492
123 Ga0105249_11469614 3300009553 Bacteria 754
124 Ga0105239_10076777 3300010375 Bacteria 3675
125 Ga0105239_10554193 3300010375 Bacteria 1309
126 Ga0105239_10892702 3300010375 Bacteria 1020
127 Ga0105246_10351277 3300011119 Unclassified 1208
128 Ga0157369_10050064 3300013105 Bacteria 4527
129 Ga0157369_10249311 3300013105 Bacteria 1853
130 Ga0157369_11682963 3300013105 Bacteria 645
131 Ga0157378_10021500 3300013297 Bacteria 5674
132 Ga0157378_11019921 3300013297 Bacteria 862
133 Ga0163162_11143063 3300013306 Bacteria 883
134 Ga0163162_11159064 3300013306 Bacteria 877
135 Ga0157372_10327131 3300013307 Bacteria 1785
136 Ga0157372_10432045 3300013307 Bacteria 1535
137 Ga0157372_10782534 3300013307 Bacteria 1109
138 Ga0157375_10183234 3300013308 Bacteria 2246
139 Ga0157375_10557545 3300013308 Bacteria 1307
140 Ga0157375_12612197 3300013308 Bacteria 603
141 Ga0157375_13765127 3300013308 Bacteria 504
142 Ga0163163_10048747 3300014325 Bacteria 4166
143 Ga0163163_12251586 3300014325 Bacteria 604
144 Ga0157380_10348622 3300014326 Bacteria 1384
145 Ga0157380_10392614 3300014326 Bacteria 1313
146 Ga0157379_10210769 3300014968 Unclassified 1759
147 Ga0157376_10200992 3300014969 Bacteria 1834
148 Ga0213876_10008392 3300021384 Bacteria 5589
149 Ga0209437_101412 3300025233 Bacteria 5988
150 Ga0209233_1000084 3300025261 Bacteria 335222
151 Ga0209455_1045120 3300025272 Bacteria 647
152 Ga0207642_10475535 3300025899 Bacteria 761
153 Ga0207710_10004697 3300025900 Bacteria 5927
154 Ga0207710_10053387 3300025900 Bacteria 1819
155 Ga0207688_10005454 3300025901 Bacteria 6914
156 Ga0207647_10128829 3300025904 Unclassified 1488
157 Ga0207645_10026781 3300025907 Bacteria 3725
158 Ga0207643_10194904 3300025908 Bacteria 1231
159 Ga0207643_10533518 3300025908 Bacteria 752
160 Ga0207695_10039118 3300025913 Bacteria 5100
161 Ga0207671_10023783 3300025914 Bacteria 4617
162 Ga0207662_10054466 3300025918 Bacteria 2385
163 Ga0207657_10038609 3300025919 Bacteria 4249
164 Ga0207652_10394451 3300025921 Bacteria 1249
165 Ga0207652_10552304 3300025921 Bacteria 1035
166 Ga0207646_10113291 3300025922 Bacteria 2435
167 Ga0207646_10339065 3300025922 Bacteria 1358
168 Ga0207681_10000022 3300025923 Bacteria 230079
169 Ga0207694_10061779 3300025924 Bacteria 2916
170 Ga0207694_10738909 3300025924 Unclassified 830
171 Ga0207694_10851056 3300025924 Bacteria 771
172 Ga0207650_10893978 3300025925 Bacteria 754
173 Ga0207659_10455035 3300025926 Bacteria 1078
174 Ga0207687_10167167 3300025927 Bacteria 1693
175 Ga0207700_10585738 3300025928 Bacteria 992
176 Ga0207664_10372639 3300025929 Unclassified 1266
177 Ga0207690_10109853 3300025932 Bacteria 1984
178 Ga0207706_10163059 3300025933 Bacteria 1959
179 Ga0207709_10542560 3300025935 Bacteria 913
180 Ga0207670_10205666 3300025936 Bacteria 1498
181 Ga0207669_10040765 3300025937 Bacteria 2697
182 Ga0207704_10101020 3300025938 Bacteria 1923
183 Ga0207691_10166274 3300025940 Bacteria 1933
184 Ga0207691_10237481 3300025940 Bacteria 1576
185 Ga0207689_10006963 3300025942 Bacteria 9941
186 Ga0207689_10122102 3300025942 Bacteria 2142
187 Ga0207661_10000050 3300025944 Bacteria 93646
188 Ga0207661_10004102 3300025944 Bacteria 10181
189 Ga0207661_10430914 3300025944 Bacteria 1199
190 Ga0207679_10116687 3300025945 Bacteria 2117
191 Ga0207667_10190207 3300025949 Bacteria 2106
192 Ga0207667_10814850 3300025949 Bacteria 929
193 Ga0207651_10175948 3300025960 Bacteria 1693
194 Ga0207712_10000054 3300025961 Bacteria 148878
195 Ga0207712_10040203 3300025961 Bacteria 3208
196 Ga0207712_10152316 3300025961 Bacteria 1787
197 Ga0207668_10091378 3300025972 Bacteria 2237
198 Ga0207668_10119108 3300025972 Bacteria 1996
199 Ga0207658_11033693 3300025986 Unclassified 750
200 Ga0207677_11404475 3300026023 Unclassified 643
201 Ga0207677_11864550 3300026023 Bacteria 558
202 Ga0207703_10001249 3300026035 Bacteria 23830
203 Ga0207703_10047548 3300026035 Bacteria 3460
204 Ga0207639_10223800 3300026041 Bacteria 1627
205 Ga0207639_10801157 3300026041 Bacteria 878
206 Ga0207639_11475693 3300026041 Bacteria 638
207 Ga0207678_10141668 3300026067 Bacteria 2052
208 Ga0207708_10193679 3300026075 Bacteria 1619
209 Ga0207702_10460198 3300026078 Bacteria 1235
210 Ga0207702_11488948 3300026078 Bacteria 670
211 Ga0207641_10002808 3300026088 Bacteria 15847
212 Ga0207648_10020066 3300026089 Bacteria 6029
213 Ga0207648_11230598 3300026089 Bacteria 703
214 Ga0207676_10000239 3300026095 Bacteria 47772
215 Ga0207676_10058951 3300026095 Bacteria 3030
216 Ga0207674_10113009 3300026116 Bacteria 2689
217 Ga0207674_10181210 3300026116 Bacteria 2058
218 Ga0207675_100000041 3300026118 Bacteria 90476
219 Ga0207675_100007434 3300026118 Bacteria 10353
220 Ga0207683_10239272 3300026121 Bacteria 1656
221 Ga0207683_11405281 3300026121 Bacteria 645
222 Ga0207698_10336327 3300026142 Bacteria 1420
223 Ga0207698_11803992 3300026142 Unclassified 627
224 Ga0207428_10294066 3300027907 Unclassified 1203
225 Ga0207428_10839522 3300027907 Bacteria 651
226 Ga0265357_1000828 3300028023 Unclassified 2045
227 Ga0268266_10033420 3300028379 Bacteria 4372
228 Ga0268266_10237855 3300028379 Unclassified 1679
229 Ga0268266_10670901 3300028379 Unclassified 998
230 Ga0268265_10000299 3300028380 Bacteria 55179
231 Ga0268265_10867097 3300028380 Bacteria 884
232 Ga0268265_10991961 3300028380 Unclassified 829
233 Ga0268265_12379919 3300028380 Unclassified 536
234 Ga0268264_10006025 3300028381 Bacteria 10259
235 Ga0268264_10032357 3300028381 Bacteria 4291
236 Ga0268264_10061340 3300028381 Bacteria 3154
237 Ga0307515_10012792 3300028794 Bacteria 15749
238 Ga0265324_10182654 3300029957 Unclassified 712
239 Ga0307512_10004289 3300030522 Bacteria 15728
240 Ga0265771_1003999 3300031010 Unclassified 876
241 Ga0307513_10002376 3300031456 Bacteria 26125
242 Ga0307513_10009775 3300031456 Bacteria 12115
243 Ga0307513_10091263 3300031456 Bacteria 3105
244 Ga0307509_10575528 3300031507 Bacteria 801
245 Ga0307408_100285063 3300031548 Bacteria 1377
246 Ga0307508_10000310 3300031616 Bacteria 59124
247 Ga0307508_10004318 3300031616 Bacteria 13923
248 Ga0307508_10006507 3300031616 Bacteria 10986
249 Ga0307508_10039714 3300031616 Bacteria 4227
250 Ga0307516_10006829 3300031730 Bacteria 13304
251 Ga0307416_100598699 3300032002 Bacteria 1182
252 Ga0307510_10235092 3300033180 Bacteria 1332
253 Ga0373955_0102407 3300035172 Bacteria 1646
254 Ga0373927_0698959 3300035695 Unclassified 670
255 Ga0373933_0698827 3300035724 Unclassified 667
256 Ga0373947_0080854 3300035725 Bacteria 2011
257 Ga0373937_0967078 3300036401 Unclassified 800
258 Ga0373925_0136282 3300037068 Bacteria 1918
259 Ga0395899_0296033 3300037312 Bacteria 1097
260 Ga0395900_0077768 3300037418 Bacteria 3409
261 Ga0395905_0566904 3300037471 Bacteria 1037
262 Ga0436365_0122556 3300039437 Bacteria 1089
263 Ga0436365_0524618 3300039437 Bacteria 3009
264 Ga0436365_1628668 3300039437 Bacteria 5992
265 Ga0436362_1205607 3300039453 Bacteria 577
266 Ga0439443_001782 3300042003 Bacteria 2460
267 Ga0439448_0077306 3300042005 Bacteria 1114
268 Ga0466961_0554102 3300044693 Bacteria 692
269 Ga0466963_0072858 3300044694 Bacteria 2315
270 Ga0466967_0421132 3300045976 Bacteria 1302
271 Ga0495638_0074333 3300046460 Bacteria 2073
272 Ga0495650_0015740 3300046471 Bacteria 3867
273 Ga0495580_0269106 3300046472 Unclassified 1164
274 Ga0495585_0228149 3300046492 Unclassified 937
275 Ga0495628_0229459 3300046516 Bacteria 1392
276 Ga0495642_0052074 3300046528 Bacteria 1686
277 Ga0495652_0528888 3300046529 Unclassified 814
278 Ga0495645_0005721 3300046543 Bacteria 8565
279 Ga0495645_0756504 3300046543 Unclassified 586
280 Ga0495645_0787669 3300046543 Bacteria 571
281 Ga0495625_0155594 3300046660 Bacteria 1534
282 Ga0495625_0526159 3300046660 Bacteria 719
283 Ga0495599_0637348 3300046678 Unclassified 618
284 Ga0495671_0019311 3300046692 Bacteria 3606
285 Ga0495674_0236935 3300047319 Unclassified 1505
286 Ga0495675_0372099 3300047444 Bacteria 837
287 Ga0495684_0680932 3300047471 Bacteria 684
288 Ga0495686_0119532 3300047472 Bacteria 1572
289 Ga0496100_0336914 3300048903 Bacteria 1137
290 Ga0496102_0532875 3300048905 Bacteria 1097
291 Ga0496105_1055129 3300048908 Bacteria 605
292 Ga0496106_0911702 3300048909 Bacteria 694
293 Ga0496107_0296145 3300048910 Bacteria 1204
294 Ga0496108_0168182 3300048911 Bacteria 1896
295 Ga0496109_0152009 3300048912 Bacteria 2167
296 Ga0496109_0942108 3300048912 Bacteria 801
297 Ga0496110_1475332 3300048913 Bacteria 590
298 Ga0496111_1014682 3300048914 Bacteria 594
299 Ga0496112_1699643 3300048915 Bacteria 544
300 Ga0496113_0288498 3300048916 Bacteria 1313
301 Ga0496114_0236750 3300048917 Bacteria 1605
302 Ga0496120_0337643 3300048923 Unclassified 680
303 Ga0496126_0504590 3300048929 Bacteria 966
304 Ga0496126_0911581 3300048929 Bacteria 666
305 nmdc:mga08y16_1129334_c1 3300050511 Bacteria 757
306 nmdc:mga08y16_92945_c1 3300050511 Bacteria 3143
307 nmdc:mga0n895_112346_c1 3300050512 Bacteria 2741
308 nmdc:mga0rr50_1738125_c1 3300050513 Unclassified 525
309 Ga0500643_055473 3300053087 Bacteria 1122
310 Ga0500644_0004837 3300053088 Bacteria 3385
311 Ga0500646_0031415 3300053090 Bacteria 1462
312 Ga0500646_0108080 3300053090 Unclassified 881
313 Ga0500583_0250818 3300053092 Bacteria 874
314 Ga0500651_0045561 3300053093 Bacteria 2759
315 Ga0500641_0071139 3300053096 Unclassified 1464
316 Ga0500641_0161354 3300053096 Bacteria 966
317 Ga0500650_0087882 3300053098 Bacteria 1455
318 Ga0500562_028550 3300053108 Bacteria 1467
319 Ga0500569_003110 3300053109 Bacteria 3353
320 Ga0500594_0004608 3300053118 Bacteria 3042
321 Ga0500595_005210 3300053119 Bacteria 5701
322 Ga0500559_0035270 3300053136 Bacteria 2160
323 Ga0500559_0043038 3300053136 Bacteria 1972
324 Ga0500568_0090327 3300053139 Bacteria 1155
325 Ga0500616_0087905 3300053153 Bacteria 1546
326 Ga0500645_070148 3300053730 Bacteria 1006
327 Ga0500587_002303 3300053739 Bacteria 2720
328 2915362420 2915358134 Bacteria 6050864
329 Ga0373936_0134322
330 JGI25165J46597_1000024
331 Ga0065707_10545022
332 Ga0070658_10459249
333 Ga0070658_10574140
334 Ga0070676_10042532
335 Ga0070683_100000049
336 Ga0070683_100018355
337 Ga0070683_100305147
338 Ga0070683_101224705
339 Ga0070670_100350164
340 Ga0068869_100470328
341 Ga0070666_10304843
342 Ga0070682_100080216
343 Ga0070682_100795928
344 Ga0068868_100952329
345 Ga0070691_10515076
346 Ga0070661_100414801
347 Ga0070692_10100512
348 Ga0070668_100029769
349 Ga0070668_101494609
350 Ga0070669_100000206
351 Ga0070669_100129564
352 Ga0070675_100114530
353 Ga0070674_100516316
354 Ga0070673_100953654
355 Ga0070688_100439982
356 Ga0070659_101783725
357 Ga0070667_101260140
358 Ga0070714_100598023
359 Ga0070713_100784275
360 Ga0070694_101359685
361 Ga0070663_101189058
362 Ga0070678_100179756
363 Ga0070678_100691499
364 Ga0070662_100038774
365 Ga0070681_11093775
366 Ga0070685_10101674
367 Ga0070706_100189070
368 Ga0070707_100116306
369 Ga0070698_100021665
370 Ga0070698_100113118
371 Ga0070699_100001011
372 Ga0070679_100426549
373 Ga0070684_100000040
374 Ga0070684_100568922
375 Ga0068853_100091679
376 Ga0068853_101114681
377 Ga0070672_100532111
378 Ga0070672_100628973
379 Ga0070672_100718127
380 Ga0070686_100013784
381 Ga0070693_100355720
382 Ga0070693_100830431
383 Ga0070665_100537724
384 Ga0070665_100798316
385 Ga0070704_101165215
386 Ga0068855_100181822
387 Ga0068855_100225944
388 Ga0068857_100080041
389 Ga0068854_100332899
390 Ga0068854_100947372
391 Ga0070702_100417434
392 Ga0068852_100250193
393 Ga0068852_100988039
394 Ga0068852_101225939
395 Ga0068859_100576685
396 Ga0068859_101031982
397 Ga0068864_100000930
398 Ga0068864_100257104
399 Ga0068864_100259989
400 Ga0068864_101290573
401 Ga0068866_10307347
402 Ga0068861_100000282
403 Ga0068861_100420582
404 Ga0068861_101444636
405 Ga0068851_10276707
406 Ga0068863_100003339
407 Ga0068858_100001536
408 Ga0068858_100061071
409 Ga0068858_100688276
410 Ga0068860_100003973
411 Ga0068860_100043953
412 Ga0068862_100000291
413 Ga0068862_100523247
414 Ga0068862_101046411
415 Ga0068862_101252873
416 Ga0068862_102427223
417 Ga0070717_10129619
418 Ga0070717_10460429
419 Ga0070716_100602091
420 Ga0097621_101702698
421 Ga0068871_100385747
422 Ga0075428_100745561
423 Ga0068865_100134454
424 Ga0068865_100902541
425 Ga0097620_100576678
426 Ga0097620_101032012
427 Ga0105240_10025313
428 Ga0105240_10064690
429 Ga0105240_10198014
430 Ga0111539_10141255
431 Ga0105245_10042104
432 Ga0105245_11161275
433 Ga0105245_12298733
434 Ga0105247_10012066
435 Ga0105243_10445492
436 Ga0105243_10485223
437 Ga0105243_10567950
438 Ga0105243_10783461
439 Ga0105241_10100015
440 Ga0105242_10605906
441 Ga0105248_10444328
442 Ga0105248_11528577
443 Ga0105237_10009969
444 Ga0105237_10316438
445 Ga0105238_10124928
446 Ga0105238_10539403
447 Ga0105238_10815051
448 Ga0105238_11016959
449 Ga0105238_12053074
450 Ga0105249_10000067
451 Ga0105249_11469614
452 Ga0105239_10076777
453 Ga0105239_10554193
454 Ga0105239_10892702
455 Ga0105246_10351277
456 Ga0157369_10050064
457 Ga0157369_10249311
458 Ga0157369_11682963
459 Ga0157378_10021500
460 Ga0157378_11019921
461 Ga0163162_11143063
462 Ga0163162_11159064
463 Ga0157372_10327131
464 Ga0157372_10432045
465 Ga0157372_10782534
466 Ga0157375_10183234
467 Ga0157375_10557545
468 Ga0157375_12612197
469 Ga0157375_13765127
470 Ga0163163_10048747
471 Ga0163163_12251586
472 Ga0157380_10348622
473 Ga0157380_10392614
474 Ga0157379_10210769
475 Ga0157376_10200992
476 Ga0213876_10008392
477 Ga0209437_101412
478 Ga0209233_1000084
479 Ga0209455_1045120
480 Ga0207642_10475535
481 Ga0207710_10004697
482 Ga0207710_10053387
483 Ga0207688_10005454
484 Ga0207647_10128829
485 Ga0207645_10026781
486 Ga0207643_10194904
487 Ga0207643_10533518
488 Ga0207695_10039118
489 Ga0207671_10023783
490 Ga0207662_10054466
491 Ga0207657_10038609
492 Ga0207652_10394451
493 Ga0207652_10552304
494 Ga0207646_10113291
495 Ga0207646_10339065
496 Ga0207681_10000022
497 Ga0207694_10061779
498 Ga0207694_10738909
499 Ga0207694_10851056
500 Ga0207650_10893978
501 Ga0207659_10455035
502 Ga0207687_10167167
503 Ga0207700_10585738
504 Ga0207664_10372639
505 Ga0207690_10109853
506 Ga0207706_10163059
507 Ga0207709_10542560
508 Ga0207670_10205666
509 Ga0207669_10040765
510 Ga0207704_10101020
511 Ga0207691_10166274
512 Ga0207691_10237481
513 Ga0207689_10006963
514 Ga0207689_10122102
515 Ga0207661_10000050
516 Ga0207661_10004102
517 Ga0207661_10430914
518 Ga0207679_10116687
519 Ga0207667_10190207
520 Ga0207667_10814850
521 Ga0207651_10175948
522 Ga0207712_10000054
523 Ga0207712_10040203
524 Ga0207712_10152316
525 Ga0207668_10091378
526 Ga0207668_10119108
527 Ga0207658_11033693
528 Ga0207677_11404475
529 Ga0207677_11864550
530 Ga0207703_10001249
531 Ga0207703_10047548
532 Ga0207639_10223800
533 Ga0207639_10801157
534 Ga0207639_11475693
535 Ga0207678_10141668
536 Ga0207708_10193679
537 Ga0207702_10460198
538 Ga0207702_11488948
539 Ga0207641_10002808
540 Ga0207648_10020066
541 Ga0207648_11230598
542 Ga0207676_10000239
543 Ga0207676_10058951
544 Ga0207674_10113009
545 Ga0207674_10181210
546 Ga0207675_100000041
547 Ga0207675_100007434
548 Ga0207683_10239272
549 Ga0207683_11405281
550 Ga0207698_10336327
551 Ga0207698_11803992
552 Ga0207428_10294066
553 Ga0207428_10839522
554 Ga0265357_1000828
555 Ga0268266_10033420
556 Ga0268266_10237855
557 Ga0268266_10670901
558 Ga0268265_10000299
559 Ga0268265_10867097
560 Ga0268265_10991961
561 Ga0268265_12379919
562 Ga0268264_10006025
563 Ga0268264_10032357
564 Ga0268264_10061340
565 Ga0307515_10012792
566 Ga0265324_10182654
567 Ga0307512_10004289
568 Ga0265771_1003999
569 Ga0307513_10002376
570 Ga0307513_10009775
571 Ga0307513_10091263
572 Ga0307509_10575528
573 Ga0307408_100285063
574 Ga0307508_10000310
575 Ga0307508_10004318
576 Ga0307508_10006507
577 Ga0307508_10039714
578 Ga0307516_10006829
579 Ga0307416_100598699
580 Ga0307510_10235092
581 Ga0373955_0102407
582 Ga0373927_0698959
583 Ga0373933_0698827
584 Ga0373947_0080854
585 Ga0373937_0967078
586 Ga0373925_0136282
587 Ga0395899_0296033
588 Ga0395900_0077768
589 Ga0395905_0566904
590 Ga0436365_0122556
591 Ga0436365_0524618
592 Ga0436365_1628668
593 Ga0436362_1205607
594 Ga0439443_001782
595 Ga0439448_0077306
596 Ga0466961_0554102
597 Ga0466963_0072858
598 Ga0466967_0421132
599 Ga0495638_0074333
600 Ga0495650_0015740
601 Ga0495580_0269106
602 Ga0495585_0228149
603 Ga0495628_0229459
604 Ga0495642_0052074
605 Ga0495652_0528888
606 Ga0495645_0005721
607 Ga0495645_0756504
608 Ga0495645_0787669
609 Ga0495625_0155594
610 Ga0495625_0526159
611 Ga0495599_0637348
612 Ga0495671_0019311
613 Ga0495674_0236935
614 Ga0495675_0372099
615 Ga0495684_0680932
616 Ga0495686_0119532
617 Ga0496100_0336914
618 Ga0496102_0532875
619 Ga0496105_1055129
620 Ga0496106_0911702
621 Ga0496107_0296145
622 Ga0496108_0168182
623 Ga0496109_0152009
624 Ga0496109_0942108
625 Ga0496110_1475332
626 Ga0496111_1014682
627 Ga0496112_1699643
628 Ga0496113_0288498
629 Ga0496114_0236750
630 Ga0496120_0337643
631 Ga0496126_0504590
632 Ga0496126_0911581
633 nmdc:mga08y16_1129334_c1
634 nmdc:mga08y16_92945_c1
635 nmdc:mga0n895_112346_c1
636 nmdc:mga0rr50_1738125_c1
637 Ga0500643_055473
638 Ga0500644_0004837
639 Ga0500646_0031415
640 Ga0500646_0108080
641 Ga0500583_0250818
642 Ga0500651_0045561
643 Ga0500641_0071139
644 Ga0500641_0161354
645 Ga0500650_0087882
646 Ga0500562_028550
647 Ga0500569_003110
648 Ga0500594_0004608
649 Ga0500595_005210
650 Ga0500559_0035270
651 Ga0500559_0043038
652 Ga0500568_0090327
653 Ga0500616_0087905
654 Ga0500645_070148
655 Ga0500587_002303
656 2915362420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

128

0.84

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

15

54

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8039 4 121
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7996 1 122
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.7982 1 124
5xob-assembly1.cif.gz_Z crystal structure of apo tias (trnaile2 agmatidine synthetase) 0.7932 91 123
3amu-assembly1.cif.gz_A crystal structure of the tias-trna(ile2)-ampcpp-agmatine complex 0.7919 91 123
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8471 69 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8333 71 122 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8328 69 121 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8202 69 128 3.30.720.110
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8193 7 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D3X103-F1-model_v4 VOC domain-containing protein 0.9397 67 125
AF-A0A1F8RBE9-F1-model_v4 VOC domain-containing protein 0.9391 68 124
AF-A0A8B0KLH4-F1-model_v4 deleted 0.9316 68 124
AF-A0A3N5VQ70-F1-model_v4 Glyoxalase 0.925 68 125
AF-A0A7J5BWP4-F1-model_v4 VOC family protein 0.9217 1 123

Map