F409293

General Info

Members Datasets Scaffolds Average Seq Length
328 191 656 248

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10008453|Ga0265330_100084534
Length 291
Sequence MKSSARRSMRFAGWHGISSAGVLPRQQYRGRAGTPGAPLSNDPMNKGMNQPVVGATPAGAQDRESAAAAVREMFTSIAPRYDLLNHVLSFNIDRWARRFEAILKRPDARVLDLCCGTGDMTFALRRRAGSEAAKILGADFSHAMLRRAAAKTKCTGLHWIEADTLRLPFPDGHFDLVTSAFGFRNLADYDAGLHEIARVLRLGGECGILDFGEPGGLIGRCYRLYFRKVLPAIGTLLSGVRGPYAYLPASVERFPAPDEMLGRMRHARFREVSWTPYTFGVAGLYRGVKSV

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.49
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 27.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10008453 3300031235 Bacteria 4954
2 rootH2_10008502 3300003320 Bacteria 9507
3 rootL2_10096042 3300003322 Bacteria 1822
4 Ga0070658_10507910 3300005327 Viruses 1042
5 Ga0070683_100133328 3300005329 Bacteria 2351
6 Ga0070683_100210377 3300005329 Unclassified 1848
7 Ga0070690_100154301 3300005330 Bacteria 1569
8 Ga0068869_100012038 3300005334 Bacteria 5699
9 Ga0070680_100483041 3300005336 Bacteria 1059
10 Ga0070682_100062221 3300005337 Bacteria 2364
11 Ga0068868_100126332 3300005338 Unclassified 2090
12 Ga0070669_100165309 3300005353 Unclassified 1722
13 Ga0070669_100302943 3300005353 Bacteria 1286
14 Ga0070659_100035241 3300005366 Bacteria 3896
15 Ga0070709_10098032 3300005434 Unclassified 1947
16 Ga0070709_10110804 3300005434 Bacteria 1845
17 Ga0070709_10177671 3300005434 Unclassified 1493
18 Ga0070709_10317015 3300005434 Unclassified 1143
19 Ga0070714_100473769 3300005435 Bacteria 1192
20 Ga0070713_100133530 3300005436 Bacteria 2191
21 Ga0070710_10035148 3300005437 Unclassified 2731
22 Ga0070710_10050340 3300005437 Bacteria 2335
23 Ga0070711_100059564 3300005439 Unclassified 2652
24 Ga0070711_100369496 3300005439 Bacteria 1157
25 Ga0070694_100390265 3300005444 Bacteria 1088
26 Ga0070708_100003488 3300005445 Bacteria 12311
27 Ga0070708_100152007 3300005445 Unclassified 2153
28 Ga0070681_10026962 3300005458 Bacteria 5777
29 Ga0070681_10316840 3300005458 Bacteria 1469
30 Ga0068867_100135173 3300005459 Unclassified 1921
31 Ga0070685_10074413 3300005466 Unclassified 2021
32 Ga0070706_100133349 3300005467 Unclassified 2318
33 Ga0070706_100285163 3300005467 Bacteria 1541
34 Ga0070706_100492787 3300005467 Unclassified 1140
35 Ga0070707_100041410 3300005468 Bacteria 4409
36 Ga0070707_100171676 3300005468 Bacteria 2113
37 Ga0070707_100434743 3300005468 Bacteria 1273
38 Ga0070699_100008978 3300005518 Bacteria 8658
39 Ga0070679_100188164 3300005530 Bacteria 2034
40 Ga0070679_100550199 3300005530 Unclassified 1098
41 Ga0070697_100000345 3300005536 Bacteria 36544
42 Ga0070693_100123714 3300005547 Bacteria 1607
43 Ga0070693_100137931 3300005547 Bacteria 1532
44 Ga0070693_100402271 3300005547 Bacteria 950
45 Ga0070665_100163786 3300005548 Bacteria 2226
46 Ga0070704_100094749 3300005549 Bacteria 2234
47 Ga0068855_100046115 3300005563 Bacteria 5153
48 Ga0068855_100704774 3300005563 Unclassified 1080
49 Ga0070664_100420224 3300005564 Bacteria 1224
50 Ga0068854_100274526 3300005578 Bacteria 1355
51 Ga0068856_100005971 3300005614 Bacteria 11986
52 Ga0068859_100025551 3300005617 Bacteria 5923
53 Ga0068864_100020681 3300005618 Bacteria 5508
54 Ga0068861_100228622 3300005719 Unclassified 1576
55 Ga0068851_10154478 3300005834 Bacteria 1256
56 Ga0068863_100038879 3300005841 Unclassified 4527
57 Ga0068863_100131399 3300005841 Bacteria 2391
58 Ga0068863_100696341 3300005841 Bacteria 1010
59 Ga0068858_100014582 3300005842 Bacteria 7405
60 Ga0068858_100520041 3300005842 Bacteria 1151
61 Ga0068860_100044783 3300005843 Unclassified 4217
62 Ga0068860_100269944 3300005843 Unclassified 1660
63 Ga0068862_100228180 3300005844 Unclassified 1688
64 Ga0070717_10002066 3300006028 Bacteria 14052
65 Ga0070717_10021908 3300006028 Bacteria 5042
66 Ga0070717_10054464 3300006028 Bacteria 3298
67 Ga0070717_10088225 3300006028 Bacteria 2614
68 Ga0070717_10156834 3300006028 Bacteria 1972
69 Ga0070717_10167863 3300006028 Unclassified 1907
70 Ga0070717_10209177 3300006028 Bacteria 1711
71 Ga0070717_10486831 3300006028 Unclassified 1114
72 Ga0070715_10002962 3300006163 Bacteria 5313
73 Ga0070716_100000963 3300006173 Bacteria 12483
74 Ga0070716_100138718 3300006173 Bacteria 1547
75 Ga0070716_100174348 3300006173 Bacteria 1406
76 Ga0070716_100184021 3300006173 Bacteria 1374
77 Ga0070712_100001489 3300006175 Bacteria 14297
78 Ga0070712_100032630 3300006175 Bacteria 3517
79 Ga0070712_100043032 3300006175 Bacteria 3107
80 Ga0070712_100183309 3300006175 Unclassified 1633
81 Ga0097621_100148497 3300006237 Bacteria 2009
82 Ga0097621_100245746 3300006237 Unclassified 1566
83 Ga0097621_100462956 3300006237 Unclassified 1144
84 Ga0068871_100281732 3300006358 Bacteria 1454
85 Ga0075434_100312304 3300006871 Unclassified 1592
86 Ga0075434_100451150 3300006871 Unclassified 1307
87 Ga0097620_100025552 3300006931 Bacteria 5923
88 Ga0099795_10003888 3300007788 Bacteria 3768
89 Ga0099795_10150904 3300007788 Unclassified 952
90 Ga0105240_10005223 3300009093 Bacteria 19427
91 Ga0105240_10029627 3300009093 Bacteria 7126
92 Ga0105240_10579868 3300009093 Bacteria 1237
93 Ga0105245_10307707 3300009098 Bacteria 1557
94 Ga0105245_10972523 3300009098 Unclassified 892
95 Ga0105241_10072223 3300009174 Bacteria 2681
96 Ga0105241_10520376 3300009174 Unclassified 1064
97 Ga0105242_10000502 3300009176 Bacteria 30880
98 Ga0105242_10320169 3300009176 Unclassified 1422
99 Ga0105248_10003827 3300009177 Bacteria 16681
100 Ga0105248_10014332 3300009177 Bacteria 8725
101 Ga0105248_10099775 3300009177 Bacteria 3272
102 Ga0105237_10313986 3300009545 Unclassified 1571
103 Ga0105238_10114872 3300009551 Unclassified 2671
104 Ga0099796_10011858 3300010159 Unclassified 2445
105 Ga0099796_10024308 3300010159 Bacteria 1901
106 Ga0105239_10031937 3300010375 Bacteria 5786
107 Ga0105239_10075524 3300010375 Bacteria 3706
108 Ga0105239_10144666 3300010375 Unclassified 2651
109 Ga0105239_10386303 3300010375 Bacteria 1583
110 Ga0105246_10590286 3300011119 Bacteria 958
111 Ga0157374_10018844 3300013296 Bacteria 6100
112 Ga0157374_10028773 3300013296 Bacteria 5023
113 Ga0157374_10196826 3300013296 Bacteria 1972
114 Ga0157374_10212349 3300013296 Bacteria 1897
115 Ga0157378_10010895 3300013297 Bacteria 7952
116 Ga0157378_10018974 3300013297 Bacteria 6044
117 Ga0157378_10058486 3300013297 Bacteria 3438
118 Ga0157378_10079010 3300013297 Unclassified 2969
119 Ga0157378_10277926 3300013297 Unclassified 1613
120 Ga0163162_10229116 3300013306 Unclassified 1988
121 Ga0157372_10028458 3300013307 Bacteria 6099
122 Ga0157372_10105722 3300013307 Bacteria 3220
123 Ga0157372_10254269 3300013307 Bacteria 2040
124 Ga0157372_10327707 3300013307 Unclassified 1783
125 Ga0157375_10098583 3300013308 Unclassified 2999
126 Ga0157375_10348305 3300013308 Bacteria 1647
127 Ga0157375_10694338 3300013308 Bacteria 1171
128 Ga0163163_10002549 3300014325 Bacteria 15435
129 Ga0163163_10165892 3300014325 Bacteria 2254
130 Ga0163163_10322956 3300014325 Bacteria 1597
131 Ga0182008_10059914 3300014497 Bacteria 1877
132 Ga0157379_10106827 3300014968 Bacteria 2513
133 Ga0157376_10175817 3300014969 Bacteria 1953
134 Ga0157376_10396676 3300014969 Bacteria 1333
135 Ga0182007_10008656 3300015262 Bacteria 4164
136 Ga0182007_10029361 3300015262 Bacteria 1883
137 Ga0182005_1018388 3300015265 Bacteria 1931
138 Ga0163161_10049245 3300017792 Bacteria 3044
139 Ga0213872_10003182 3300021361 Bacteria 9205
140 Ga0213872_10003690 3300021361 Bacteria 8382
141 Ga0213872_10055102 3300021361 Bacteria 1802
142 Ga0213871_10000469 3300021441 Bacteria 5479
143 Ga0207692_10002644 3300025898 Bacteria 6892
144 Ga0207699_10046227 3300025906 Bacteria 2545
145 Ga0207699_10148254 3300025906 Unclassified 1549
146 Ga0207699_10321993 3300025906 Bacteria 1085
147 Ga0207684_10379454 3300025910 Unclassified 1216
148 Ga0207654_10047941 3300025911 Bacteria 2443
149 Ga0207654_10085006 3300025911 Bacteria 1914
150 Ga0207654_10392736 3300025911 Unclassified 963
151 Ga0207707_10056523 3300025912 Bacteria 3414
152 Ga0207707_10362205 3300025912 Unclassified 1248
153 Ga0207707_10620177 3300025912 Bacteria 914
154 Ga0207695_10020145 3300025913 Bacteria 7649
155 Ga0207695_10079555 3300025913 Bacteria 3322
156 Ga0207671_10218843 3300025914 Unclassified 1491
157 Ga0207693_10009791 3300025915 Bacteria 7801
158 Ga0207693_10054407 3300025915 Bacteria 3139
159 Ga0207693_10056885 3300025915 Bacteria 3066
160 Ga0207693_10138206 3300025915 Bacteria 1916
161 Ga0207693_10535415 3300025915 Unclassified 914
162 Ga0207663_10307704 3300025916 Unclassified 1186
163 Ga0207662_10084569 3300025918 Bacteria 1941
164 Ga0207649_10015693 3300025920 Bacteria 4256
165 Ga0207646_10016435 3300025922 Bacteria 6943
166 Ga0207646_10036812 3300025922 Bacteria 4416
167 Ga0207681_10150172 3300025923 Unclassified 1745
168 Ga0207681_10298894 3300025923 Bacteria 1273
169 Ga0207700_10022051 3300025928 Unclassified 4362
170 Ga0207700_10112145 3300025928 Unclassified 2196
171 Ga0207700_10127366 3300025928 Bacteria 2073
172 Ga0207700_10208206 3300025928 Bacteria 1652
173 Ga0207664_10026317 3300025929 Unclassified 4395
174 Ga0207664_10041502 3300025929 Unclassified 3584
175 Ga0207664_10168558 3300025929 Unclassified 1872
176 Ga0207664_10288874 3300025929 Bacteria 1441
177 Ga0207686_10000169 3300025934 Bacteria 49795
178 Ga0207686_10340669 3300025934 Unclassified 1126
179 Ga0207709_10150997 3300025935 Bacteria 1609
180 Ga0207704_10378480 3300025938 Bacteria 1110
181 Ga0207665_10001295 3300025939 Bacteria 16905
182 Ga0207665_10019673 3300025939 Bacteria 4440
183 Ga0207665_10097552 3300025939 Bacteria 2046
184 Ga0207665_10160392 3300025939 Bacteria 1617
185 Ga0207665_10169259 3300025939 Bacteria 1577
186 Ga0207665_10278370 3300025939 Bacteria 1244
187 Ga0207711_10005939 3300025941 Bacteria 10321
188 Ga0207689_10000185 3300025942 Bacteria 54094
189 Ga0207661_10136017 3300025944 Bacteria 2110
190 Ga0207679_10591213 3300025945 Unclassified 999
191 Ga0207667_10052784 3300025949 Bacteria 4279
192 Ga0207651_10246189 3300025960 Bacteria 1460
193 Ga0207640_10156269 3300025981 Bacteria 1682
194 Ga0207703_10018445 3300026035 Bacteria 5449
195 Ga0207703_10025452 3300026035 Unclassified 4654
196 Ga0207639_10001850 3300026041 Bacteria 14229
197 Ga0207678_10226724 3300026067 Viruses 1600
198 Ga0207702_10266480 3300026078 Bacteria 1614
199 Ga0207641_10049472 3300026088 Unclassified 3552
200 Ga0207641_10331014 3300026088 Bacteria 1447
201 Ga0207648_10014438 3300026089 Bacteria 7300
202 Ga0207676_10224969 3300026095 Unclassified 1674
203 Ga0207676_10434465 3300026095 Unclassified 1234
204 Ga0207676_10699396 3300026095 Unclassified 982
205 Ga0207675_100141178 3300026118 Unclassified 2288
206 Ga0207683_10207359 3300026121 Bacteria 1783
207 Ga0207698_10062206 3300026142 Bacteria 2914
208 Ga0209179_1007635 3300027512 Bacteria 1792
209 Ga0268265_10032089 3300028380 Bacteria 3801
210 Ga0265338_10048868 3300028800 Unclassified 3842
211 Ga0265338_10099602 3300028800 Unclassified 2373
212 Ga0265762_1026414 3300030760 Bacteria 1086
213 Ga0265760_10012281 3300031090 Bacteria 2447
214 Ga0265330_10000262 3300031235 Bacteria 38790
215 Ga0265325_10000211 3300031241 Bacteria 41520
216 Ga0265325_10019047 3300031241 Unclassified 3800
217 Ga0265339_10012153 3300031249 Bacteria 5268
218 Ga0265339_10041777 3300031249 Bacteria 2543
219 Ga0265331_10058743 3300031250 Bacteria 1820
220 Ga0265327_10186805 3300031251 Unclassified 945
221 Ga0265316_10000355 3300031344 Bacteria 51585
222 Ga0265316_10001005 3300031344 Bacteria 30618
223 Ga0265316_10009803 3300031344 Bacteria 8794
224 Ga0265316_10022412 3300031344 Bacteria 5325
225 Ga0265316_10334240 3300031344 Unclassified 1099
226 Ga0265313_10031719 3300031595 Unclassified 2705
227 Ga0265313_10049912 3300031595 Bacteria 2011
228 Ga0265314_10001994 3300031711 Bacteria 21660
229 Ga0265314_10019189 3300031711 Bacteria 5302
230 Ga0265342_10002750 3300031712 Bacteria 14948
231 Ga0265342_10044633 3300031712 Unclassified 2671
232 Ga0316576_10022838 3300031727 Bacteria 4350
233 Ga0316578_10001935 3300031728 Bacteria 8765
234 Ga0316578_10035728 3300031728 Bacteria 2858
235 Ga0316577_10000778 3300031733 Bacteria 13721
236 Ga0316577_10155479 3300031733 Unclassified 1289
237 Ga0307413_10168103 3300031824 Bacteria 1549
238 Ga0307416_100126536 3300032002 Bacteria 2290
239 Ga0373936_0092191 3300035113 Bacteria 1271
240 Ga0373955_0077169 3300035172 Unclassified 1875
241 Ga0373931_0118531 3300035691 Bacteria 1510
242 Ga0373935_0396218 3300035692 Bacteria 991
243 Ga0373927_0014597 3300035695 Bacteria 5196
244 Ga0373933_0498405 3300035724 Bacteria 798
245 Ga0373937_0636207 3300036401 Bacteria 1012
246 Ga0316584_0020226 3300036712 Unclassified 4823
247 Ga0373925_0001229 3300037068 Bacteria 22656
248 Ga0373925_0273079 3300037068 Unclassified 1360
249 Ga0395899_0108497 3300037312 Bacteria 1998
250 Ga0395900_0071296 3300037418 Unclassified 3572
251 Ga0395905_0021742 3300037471 Bacteria 6069
252 Ga0395905_0139940 3300037471 Unclassified 2277
253 Ga0395905_0310620 3300037471 Bacteria 1465
254 Ga0395905_0586476 3300037471 Unclassified 1016
255 Ga0316581_0040395 3300037588 Unclassified 1420
256 Ga0436360_0010438 3300039438 Bacteria 2866
257 Ga0436360_0182885 3300039438 Unclassified 802
258 Ga0436360_0443944 3300039438 Bacteria 23488
259 Ga0436361_0174640 3300039447 Bacteria 1217
260 Ga0436361_0545182 3300039447 Bacteria 13931
261 Ga0436361_0789908 3300039447 Bacteria 1040
262 Ga0436361_0968326 3300039447 Bacteria 17636
263 Ga0436363_1259193 3300039450 Bacteria 3256
264 Ga0436362_0568685 3300039453 Bacteria 1380
265 Ga0466963_0092829 3300044694 Unclassified 2057
266 Ga0466963_0192454 3300044694 Bacteria 1425
267 Ga0466963_0240821 3300044694 Bacteria 1269
268 Ga0453684_1010474 3300044712 Unclassified 884
269 Ga0451576_0318034 3300045051 Bacteria 1629
270 Ga0451576_0468463 3300045051 Bacteria 1323
271 Ga0466958_0185784 3300045836 Bacteria 1320
272 Ga0466967_0001949 3300045976 Bacteria 12493
273 Ga0466967_0089067 3300045976 Bacteria 2802
274 Ga0495603_0176687 3300046455 Unclassified 1236
275 Ga0495629_0026408 3300046459 Bacteria 4125
276 Ga0495651_0080844 3300046462 Bacteria 2454
277 Ga0495580_0001858 3300046472 Bacteria 18574
278 Ga0495580_0005568 3300046472 Bacteria 10385
279 Ga0495580_0042229 3300046472 Bacteria 3249
280 Ga0495580_0075810 3300046472 Unclassified 2346
281 Ga0495580_0136827 3300046472 Bacteria 1699
282 Ga0495580_0520824 3300046472 Bacteria 792
283 Ga0495582_0090697 3300046473 Bacteria 1704
284 Ga0495664_0102920 3300046477 Unclassified 1721
285 Ga0495618_0157164 3300046514 Bacteria 1451
286 Ga0495630_0310133 3300046517 Unclassified 1206
287 Ga0495665_0027463 3300046531 Bacteria 3055
288 Ga0495587_0120547 3300046536 Bacteria 1503
289 Ga0495634_0299428 3300046642 Bacteria 973
290 Ga0495669_0008798 3300046684 Unclassified 4253
291 Ga0495613_0073727 3300046689 Bacteria 2487
292 Ga0495613_0162436 3300046689 Bacteria 1588
293 Ga0495649_0071027 3300046694 Bacteria 1866
294 Ga0495581_0011208 3300047315 Bacteria 5183
295 Ga0495604_0111225 3300047317 Unclassified 1997
296 Ga0495674_0201935 3300047319 Unclassified 1649
297 Ga0495674_0516622 3300047319 Bacteria 954
298 Ga0495680_0193303 3300047322 Bacteria 1463
299 Ga0495687_030653 3300047443 Bacteria 2475
300 Ga0495675_0028939 3300047444 Bacteria 3532
301 Ga0495677_0065827 3300047445 Bacteria 1347
302 Ga0495684_0196259 3300047471 Bacteria 1490
303 Ga0495602_0521256 3300048088 Bacteria 828
304 Ga0496100_0026390 3300048903 Bacteria 3561
305 Ga0496101_0120243 3300048904 Bacteria 1985
306 Ga0496102_0079530 3300048905 Unclassified 3019
307 Ga0496102_0098797 3300048905 Bacteria 2709
308 Ga0496104_0002768 3300048907 Bacteria 15101
309 Ga0496105_0533704 3300048908 Unclassified 918
310 Ga0496106_0423321 3300048909 Bacteria 1070
311 Ga0496107_0465761 3300048910 Bacteria 938
312 Ga0496108_0072991 3300048911 Unclassified 2898
313 Ga0496111_0047979 3300048914 Bacteria 3076
314 Ga0496112_0028834 3300048915 Bacteria 5362
315 Ga0496112_0037499 3300048915 Unclassified 4730
316 Ga0496112_0075013 3300048915 Bacteria 3345
317 Ga0496112_0108165 3300048915 Bacteria 2751
318 Ga0496112_0252042 3300048915 Bacteria 1716
319 Ga0496114_0231820 3300048917 Bacteria 1622
320 Ga0496115_0048082 3300048918 Bacteria 3412
321 Ga0496115_0057085 3300048918 Bacteria 3139
322 Ga0496126_0001522 3300048929 Bacteria 35736
323 Ga0496126_0225527 3300048929 Bacteria 1572
324 Ga0501077_0191089 3300049593 Unclassified 1301
325 Ga0501083_0121285 3300049744 Bacteria 1715
326 Ga0495601_0004386 3300053077 Bacteria 8152
327 Ga0495601_0347339 3300053077 Bacteria 965
328 Ga0501084_0022623 3300054114 Bacteria 5246
329 Ga0265330_10008453
330 rootH2_10008502
331 rootL2_10096042
332 Ga0070658_10507910
333 Ga0070683_100133328
334 Ga0070683_100210377
335 Ga0070690_100154301
336 Ga0068869_100012038
337 Ga0070680_100483041
338 Ga0070682_100062221
339 Ga0068868_100126332
340 Ga0070669_100165309
341 Ga0070669_100302943
342 Ga0070659_100035241
343 Ga0070709_10098032
344 Ga0070709_10110804
345 Ga0070709_10177671
346 Ga0070709_10317015
347 Ga0070714_100473769
348 Ga0070713_100133530
349 Ga0070710_10035148
350 Ga0070710_10050340
351 Ga0070711_100059564
352 Ga0070711_100369496
353 Ga0070694_100390265
354 Ga0070708_100003488
355 Ga0070708_100152007
356 Ga0070681_10026962
357 Ga0070681_10316840
358 Ga0068867_100135173
359 Ga0070685_10074413
360 Ga0070706_100133349
361 Ga0070706_100285163
362 Ga0070706_100492787
363 Ga0070707_100041410
364 Ga0070707_100171676
365 Ga0070707_100434743
366 Ga0070699_100008978
367 Ga0070679_100188164
368 Ga0070679_100550199
369 Ga0070697_100000345
370 Ga0070693_100123714
371 Ga0070693_100137931
372 Ga0070693_100402271
373 Ga0070665_100163786
374 Ga0070704_100094749
375 Ga0068855_100046115
376 Ga0068855_100704774
377 Ga0070664_100420224
378 Ga0068854_100274526
379 Ga0068856_100005971
380 Ga0068859_100025551
381 Ga0068864_100020681
382 Ga0068861_100228622
383 Ga0068851_10154478
384 Ga0068863_100038879
385 Ga0068863_100131399
386 Ga0068863_100696341
387 Ga0068858_100014582
388 Ga0068858_100520041
389 Ga0068860_100044783
390 Ga0068860_100269944
391 Ga0068862_100228180
392 Ga0070717_10002066
393 Ga0070717_10021908
394 Ga0070717_10054464
395 Ga0070717_10088225
396 Ga0070717_10156834
397 Ga0070717_10167863
398 Ga0070717_10209177
399 Ga0070717_10486831
400 Ga0070715_10002962
401 Ga0070716_100000963
402 Ga0070716_100138718
403 Ga0070716_100174348
404 Ga0070716_100184021
405 Ga0070712_100001489
406 Ga0070712_100032630
407 Ga0070712_100043032
408 Ga0070712_100183309
409 Ga0097621_100148497
410 Ga0097621_100245746
411 Ga0097621_100462956
412 Ga0068871_100281732
413 Ga0075434_100312304
414 Ga0075434_100451150
415 Ga0097620_100025552
416 Ga0099795_10003888
417 Ga0099795_10150904
418 Ga0105240_10005223
419 Ga0105240_10029627
420 Ga0105240_10579868
421 Ga0105245_10307707
422 Ga0105245_10972523
423 Ga0105241_10072223
424 Ga0105241_10520376
425 Ga0105242_10000502
426 Ga0105242_10320169
427 Ga0105248_10003827
428 Ga0105248_10014332
429 Ga0105248_10099775
430 Ga0105237_10313986
431 Ga0105238_10114872
432 Ga0099796_10011858
433 Ga0099796_10024308
434 Ga0105239_10031937
435 Ga0105239_10075524
436 Ga0105239_10144666
437 Ga0105239_10386303
438 Ga0105246_10590286
439 Ga0157374_10018844
440 Ga0157374_10028773
441 Ga0157374_10196826
442 Ga0157374_10212349
443 Ga0157378_10010895
444 Ga0157378_10018974
445 Ga0157378_10058486
446 Ga0157378_10079010
447 Ga0157378_10277926
448 Ga0163162_10229116
449 Ga0157372_10028458
450 Ga0157372_10105722
451 Ga0157372_10254269
452 Ga0157372_10327707
453 Ga0157375_10098583
454 Ga0157375_10348305
455 Ga0157375_10694338
456 Ga0163163_10002549
457 Ga0163163_10165892
458 Ga0163163_10322956
459 Ga0182008_10059914
460 Ga0157379_10106827
461 Ga0157376_10175817
462 Ga0157376_10396676
463 Ga0182007_10008656
464 Ga0182007_10029361
465 Ga0182005_1018388
466 Ga0163161_10049245
467 Ga0213872_10003182
468 Ga0213872_10003690
469 Ga0213872_10055102
470 Ga0213871_10000469
471 Ga0207692_10002644
472 Ga0207699_10046227
473 Ga0207699_10148254
474 Ga0207699_10321993
475 Ga0207684_10379454
476 Ga0207654_10047941
477 Ga0207654_10085006
478 Ga0207654_10392736
479 Ga0207707_10056523
480 Ga0207707_10362205
481 Ga0207707_10620177
482 Ga0207695_10020145
483 Ga0207695_10079555
484 Ga0207671_10218843
485 Ga0207693_10009791
486 Ga0207693_10054407
487 Ga0207693_10056885
488 Ga0207693_10138206
489 Ga0207693_10535415
490 Ga0207663_10307704
491 Ga0207662_10084569
492 Ga0207649_10015693
493 Ga0207646_10016435
494 Ga0207646_10036812
495 Ga0207681_10150172
496 Ga0207681_10298894
497 Ga0207700_10022051
498 Ga0207700_10112145
499 Ga0207700_10127366
500 Ga0207700_10208206
501 Ga0207664_10026317
502 Ga0207664_10041502
503 Ga0207664_10168558
504 Ga0207664_10288874
505 Ga0207686_10000169
506 Ga0207686_10340669
507 Ga0207709_10150997
508 Ga0207704_10378480
509 Ga0207665_10001295
510 Ga0207665_10019673
511 Ga0207665_10097552
512 Ga0207665_10160392
513 Ga0207665_10169259
514 Ga0207665_10278370
515 Ga0207711_10005939
516 Ga0207689_10000185
517 Ga0207661_10136017
518 Ga0207679_10591213
519 Ga0207667_10052784
520 Ga0207651_10246189
521 Ga0207640_10156269
522 Ga0207703_10018445
523 Ga0207703_10025452
524 Ga0207639_10001850
525 Ga0207678_10226724
526 Ga0207702_10266480
527 Ga0207641_10049472
528 Ga0207641_10331014
529 Ga0207648_10014438
530 Ga0207676_10224969
531 Ga0207676_10434465
532 Ga0207676_10699396
533 Ga0207675_100141178
534 Ga0207683_10207359
535 Ga0207698_10062206
536 Ga0209179_1007635
537 Ga0268265_10032089
538 Ga0265338_10048868
539 Ga0265338_10099602
540 Ga0265762_1026414
541 Ga0265760_10012281
542 Ga0265330_10000262
543 Ga0265325_10000211
544 Ga0265325_10019047
545 Ga0265339_10012153
546 Ga0265339_10041777
547 Ga0265331_10058743
548 Ga0265327_10186805
549 Ga0265316_10000355
550 Ga0265316_10001005
551 Ga0265316_10009803
552 Ga0265316_10022412
553 Ga0265316_10334240
554 Ga0265313_10031719
555 Ga0265313_10049912
556 Ga0265314_10001994
557 Ga0265314_10019189
558 Ga0265342_10002750
559 Ga0265342_10044633
560 Ga0316576_10022838
561 Ga0316578_10001935
562 Ga0316578_10035728
563 Ga0316577_10000778
564 Ga0316577_10155479
565 Ga0307413_10168103
566 Ga0307416_100126536
567 Ga0373936_0092191
568 Ga0373955_0077169
569 Ga0373931_0118531
570 Ga0373935_0396218
571 Ga0373927_0014597
572 Ga0373933_0498405
573 Ga0373937_0636207
574 Ga0316584_0020226
575 Ga0373925_0001229
576 Ga0373925_0273079
577 Ga0395899_0108497
578 Ga0395900_0071296
579 Ga0395905_0021742
580 Ga0395905_0139940
581 Ga0395905_0310620
582 Ga0395905_0586476
583 Ga0316581_0040395
584 Ga0436360_0010438
585 Ga0436360_0182885
586 Ga0436360_0443944
587 Ga0436361_0174640
588 Ga0436361_0545182
589 Ga0436361_0789908
590 Ga0436361_0968326
591 Ga0436363_1259193
592 Ga0436362_0568685
593 Ga0466963_0092829
594 Ga0466963_0192454
595 Ga0466963_0240821
596 Ga0453684_1010474
597 Ga0451576_0318034
598 Ga0451576_0468463
599 Ga0466958_0185784
600 Ga0466967_0001949
601 Ga0466967_0089067
602 Ga0495603_0176687
603 Ga0495629_0026408
604 Ga0495651_0080844
605 Ga0495580_0001858
606 Ga0495580_0005568
607 Ga0495580_0042229
608 Ga0495580_0075810
609 Ga0495580_0136827
610 Ga0495580_0520824
611 Ga0495582_0090697
612 Ga0495664_0102920
613 Ga0495618_0157164
614 Ga0495630_0310133
615 Ga0495665_0027463
616 Ga0495587_0120547
617 Ga0495634_0299428
618 Ga0495669_0008798
619 Ga0495613_0073727
620 Ga0495613_0162436
621 Ga0495649_0071027
622 Ga0495581_0011208
623 Ga0495604_0111225
624 Ga0495674_0201935
625 Ga0495674_0516622
626 Ga0495680_0193303
627 Ga0495687_030653
628 Ga0495675_0028939
629 Ga0495677_0065827
630 Ga0495684_0196259
631 Ga0495602_0521256
632 Ga0496100_0026390
633 Ga0496101_0120243
634 Ga0496102_0079530
635 Ga0496102_0098797
636 Ga0496104_0002768
637 Ga0496105_0533704
638 Ga0496106_0423321
639 Ga0496107_0465761
640 Ga0496108_0072991
641 Ga0496111_0047979
642 Ga0496112_0028834
643 Ga0496112_0037499
644 Ga0496112_0075013
645 Ga0496112_0108165
646 Ga0496112_0252042
647 Ga0496114_0231820
648 Ga0496115_0048082
649 Ga0496115_0057085
650 Ga0496126_0001522
651 Ga0496126_0225527
652 Ga0501077_0191089
653 Ga0501083_0121285
654 Ga0495601_0004386
655 Ga0495601_0347339
656 Ga0501084_0022623

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

111

208

0.96

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

61

289

0.93

PF13649

Methyltransf_25

Methyltransferase domain

110

204

0.92

PF13847

Methyltransf_31

Methyltransferase domain

104

222

0.92

PF08242

Methyltransf_12

Methyltransferase domain

111

206

0.89

PF13489

Methyltransf_23

Methyltransferase domain

85

238

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9103 33 256
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8659 33 256
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.7915 55 243
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.7897 67 255
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.7797 67 176
ID Description Score Start End Superfamily
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9294 64 255 3.40.50.150
af_Q59ZE2_70_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9252 33 254 3.40.50.150
af_O96145_64_353_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9153 33 254 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9146 34 255 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9035 33 254 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V5KGP3-F1-model_v4 Methyltransferase 0.9682 133 256 GO:0008168
GO:0032259
AF-A0A2V5KGP3-F1-model_v4 Methyltransferase 0.9532 133 256 GO:0008168
GO:0032259
AF-A0A6N9F291-F1-model_v4 deleted 0.9416 123 254
AF-A0A7X1TTZ2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.938 23 254 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-K2F0Z7-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.938 17 255 GO:0009234
GO:0032259
GO:0043770

Map