F409293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 191 | 656 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10008453|Ga0265330_100084534 |
| Length | 291 |
| Sequence | MKSSARRSMRFAGWHGISSAGVLPRQQYRGRAGTPGAPLSNDPMNKGMNQPVVGATPAGAQDRESAAAAVREMFTSIAPRYDLLNHVLSFNIDRWARRFEAILKRPDARVLDLCCGTGDMTFALRRRAGSEAAKILGADFSHAMLRRAAAKTKCTGLHWIEADTLRLPFPDGHFDLVTSAFGFRNLADYDAGLHEIARVLRLGGECGILDFGEPGGLIGRCYRLYFRKVLPAIGTLLSGVRGPYAYLPASVERFPAPDEMLGRMRHARFREVSWTPYTFGVAGLYRGVKSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 126 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 127 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 143 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.49 |
| Rhizosphere | 92.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265330_10008453 | 3300031235 | Bacteria | 4954 |
| 2 | rootH2_10008502 | 3300003320 | Bacteria | 9507 |
| 3 | rootL2_10096042 | 3300003322 | Bacteria | 1822 |
| 4 | Ga0070658_10507910 | 3300005327 | Viruses | 1042 |
| 5 | Ga0070683_100133328 | 3300005329 | Bacteria | 2351 |
| 6 | Ga0070683_100210377 | 3300005329 | Unclassified | 1848 |
| 7 | Ga0070690_100154301 | 3300005330 | Bacteria | 1569 |
| 8 | Ga0068869_100012038 | 3300005334 | Bacteria | 5699 |
| 9 | Ga0070680_100483041 | 3300005336 | Bacteria | 1059 |
| 10 | Ga0070682_100062221 | 3300005337 | Bacteria | 2364 |
| 11 | Ga0068868_100126332 | 3300005338 | Unclassified | 2090 |
| 12 | Ga0070669_100165309 | 3300005353 | Unclassified | 1722 |
| 13 | Ga0070669_100302943 | 3300005353 | Bacteria | 1286 |
| 14 | Ga0070659_100035241 | 3300005366 | Bacteria | 3896 |
| 15 | Ga0070709_10098032 | 3300005434 | Unclassified | 1947 |
| 16 | Ga0070709_10110804 | 3300005434 | Bacteria | 1845 |
| 17 | Ga0070709_10177671 | 3300005434 | Unclassified | 1493 |
| 18 | Ga0070709_10317015 | 3300005434 | Unclassified | 1143 |
| 19 | Ga0070714_100473769 | 3300005435 | Bacteria | 1192 |
| 20 | Ga0070713_100133530 | 3300005436 | Bacteria | 2191 |
| 21 | Ga0070710_10035148 | 3300005437 | Unclassified | 2731 |
| 22 | Ga0070710_10050340 | 3300005437 | Bacteria | 2335 |
| 23 | Ga0070711_100059564 | 3300005439 | Unclassified | 2652 |
| 24 | Ga0070711_100369496 | 3300005439 | Bacteria | 1157 |
| 25 | Ga0070694_100390265 | 3300005444 | Bacteria | 1088 |
| 26 | Ga0070708_100003488 | 3300005445 | Bacteria | 12311 |
| 27 | Ga0070708_100152007 | 3300005445 | Unclassified | 2153 |
| 28 | Ga0070681_10026962 | 3300005458 | Bacteria | 5777 |
| 29 | Ga0070681_10316840 | 3300005458 | Bacteria | 1469 |
| 30 | Ga0068867_100135173 | 3300005459 | Unclassified | 1921 |
| 31 | Ga0070685_10074413 | 3300005466 | Unclassified | 2021 |
| 32 | Ga0070706_100133349 | 3300005467 | Unclassified | 2318 |
| 33 | Ga0070706_100285163 | 3300005467 | Bacteria | 1541 |
| 34 | Ga0070706_100492787 | 3300005467 | Unclassified | 1140 |
| 35 | Ga0070707_100041410 | 3300005468 | Bacteria | 4409 |
| 36 | Ga0070707_100171676 | 3300005468 | Bacteria | 2113 |
| 37 | Ga0070707_100434743 | 3300005468 | Bacteria | 1273 |
| 38 | Ga0070699_100008978 | 3300005518 | Bacteria | 8658 |
| 39 | Ga0070679_100188164 | 3300005530 | Bacteria | 2034 |
| 40 | Ga0070679_100550199 | 3300005530 | Unclassified | 1098 |
| 41 | Ga0070697_100000345 | 3300005536 | Bacteria | 36544 |
| 42 | Ga0070693_100123714 | 3300005547 | Bacteria | 1607 |
| 43 | Ga0070693_100137931 | 3300005547 | Bacteria | 1532 |
| 44 | Ga0070693_100402271 | 3300005547 | Bacteria | 950 |
| 45 | Ga0070665_100163786 | 3300005548 | Bacteria | 2226 |
| 46 | Ga0070704_100094749 | 3300005549 | Bacteria | 2234 |
| 47 | Ga0068855_100046115 | 3300005563 | Bacteria | 5153 |
| 48 | Ga0068855_100704774 | 3300005563 | Unclassified | 1080 |
| 49 | Ga0070664_100420224 | 3300005564 | Bacteria | 1224 |
| 50 | Ga0068854_100274526 | 3300005578 | Bacteria | 1355 |
| 51 | Ga0068856_100005971 | 3300005614 | Bacteria | 11986 |
| 52 | Ga0068859_100025551 | 3300005617 | Bacteria | 5923 |
| 53 | Ga0068864_100020681 | 3300005618 | Bacteria | 5508 |
| 54 | Ga0068861_100228622 | 3300005719 | Unclassified | 1576 |
| 55 | Ga0068851_10154478 | 3300005834 | Bacteria | 1256 |
| 56 | Ga0068863_100038879 | 3300005841 | Unclassified | 4527 |
| 57 | Ga0068863_100131399 | 3300005841 | Bacteria | 2391 |
| 58 | Ga0068863_100696341 | 3300005841 | Bacteria | 1010 |
| 59 | Ga0068858_100014582 | 3300005842 | Bacteria | 7405 |
| 60 | Ga0068858_100520041 | 3300005842 | Bacteria | 1151 |
| 61 | Ga0068860_100044783 | 3300005843 | Unclassified | 4217 |
| 62 | Ga0068860_100269944 | 3300005843 | Unclassified | 1660 |
| 63 | Ga0068862_100228180 | 3300005844 | Unclassified | 1688 |
| 64 | Ga0070717_10002066 | 3300006028 | Bacteria | 14052 |
| 65 | Ga0070717_10021908 | 3300006028 | Bacteria | 5042 |
| 66 | Ga0070717_10054464 | 3300006028 | Bacteria | 3298 |
| 67 | Ga0070717_10088225 | 3300006028 | Bacteria | 2614 |
| 68 | Ga0070717_10156834 | 3300006028 | Bacteria | 1972 |
| 69 | Ga0070717_10167863 | 3300006028 | Unclassified | 1907 |
| 70 | Ga0070717_10209177 | 3300006028 | Bacteria | 1711 |
| 71 | Ga0070717_10486831 | 3300006028 | Unclassified | 1114 |
| 72 | Ga0070715_10002962 | 3300006163 | Bacteria | 5313 |
| 73 | Ga0070716_100000963 | 3300006173 | Bacteria | 12483 |
| 74 | Ga0070716_100138718 | 3300006173 | Bacteria | 1547 |
| 75 | Ga0070716_100174348 | 3300006173 | Bacteria | 1406 |
| 76 | Ga0070716_100184021 | 3300006173 | Bacteria | 1374 |
| 77 | Ga0070712_100001489 | 3300006175 | Bacteria | 14297 |
| 78 | Ga0070712_100032630 | 3300006175 | Bacteria | 3517 |
| 79 | Ga0070712_100043032 | 3300006175 | Bacteria | 3107 |
| 80 | Ga0070712_100183309 | 3300006175 | Unclassified | 1633 |
| 81 | Ga0097621_100148497 | 3300006237 | Bacteria | 2009 |
| 82 | Ga0097621_100245746 | 3300006237 | Unclassified | 1566 |
| 83 | Ga0097621_100462956 | 3300006237 | Unclassified | 1144 |
| 84 | Ga0068871_100281732 | 3300006358 | Bacteria | 1454 |
| 85 | Ga0075434_100312304 | 3300006871 | Unclassified | 1592 |
| 86 | Ga0075434_100451150 | 3300006871 | Unclassified | 1307 |
| 87 | Ga0097620_100025552 | 3300006931 | Bacteria | 5923 |
| 88 | Ga0099795_10003888 | 3300007788 | Bacteria | 3768 |
| 89 | Ga0099795_10150904 | 3300007788 | Unclassified | 952 |
| 90 | Ga0105240_10005223 | 3300009093 | Bacteria | 19427 |
| 91 | Ga0105240_10029627 | 3300009093 | Bacteria | 7126 |
| 92 | Ga0105240_10579868 | 3300009093 | Bacteria | 1237 |
| 93 | Ga0105245_10307707 | 3300009098 | Bacteria | 1557 |
| 94 | Ga0105245_10972523 | 3300009098 | Unclassified | 892 |
| 95 | Ga0105241_10072223 | 3300009174 | Bacteria | 2681 |
| 96 | Ga0105241_10520376 | 3300009174 | Unclassified | 1064 |
| 97 | Ga0105242_10000502 | 3300009176 | Bacteria | 30880 |
| 98 | Ga0105242_10320169 | 3300009176 | Unclassified | 1422 |
| 99 | Ga0105248_10003827 | 3300009177 | Bacteria | 16681 |
| 100 | Ga0105248_10014332 | 3300009177 | Bacteria | 8725 |
| 101 | Ga0105248_10099775 | 3300009177 | Bacteria | 3272 |
| 102 | Ga0105237_10313986 | 3300009545 | Unclassified | 1571 |
| 103 | Ga0105238_10114872 | 3300009551 | Unclassified | 2671 |
| 104 | Ga0099796_10011858 | 3300010159 | Unclassified | 2445 |
| 105 | Ga0099796_10024308 | 3300010159 | Bacteria | 1901 |
| 106 | Ga0105239_10031937 | 3300010375 | Bacteria | 5786 |
| 107 | Ga0105239_10075524 | 3300010375 | Bacteria | 3706 |
| 108 | Ga0105239_10144666 | 3300010375 | Unclassified | 2651 |
| 109 | Ga0105239_10386303 | 3300010375 | Bacteria | 1583 |
| 110 | Ga0105246_10590286 | 3300011119 | Bacteria | 958 |
| 111 | Ga0157374_10018844 | 3300013296 | Bacteria | 6100 |
| 112 | Ga0157374_10028773 | 3300013296 | Bacteria | 5023 |
| 113 | Ga0157374_10196826 | 3300013296 | Bacteria | 1972 |
| 114 | Ga0157374_10212349 | 3300013296 | Bacteria | 1897 |
| 115 | Ga0157378_10010895 | 3300013297 | Bacteria | 7952 |
| 116 | Ga0157378_10018974 | 3300013297 | Bacteria | 6044 |
| 117 | Ga0157378_10058486 | 3300013297 | Bacteria | 3438 |
| 118 | Ga0157378_10079010 | 3300013297 | Unclassified | 2969 |
| 119 | Ga0157378_10277926 | 3300013297 | Unclassified | 1613 |
| 120 | Ga0163162_10229116 | 3300013306 | Unclassified | 1988 |
| 121 | Ga0157372_10028458 | 3300013307 | Bacteria | 6099 |
| 122 | Ga0157372_10105722 | 3300013307 | Bacteria | 3220 |
| 123 | Ga0157372_10254269 | 3300013307 | Bacteria | 2040 |
| 124 | Ga0157372_10327707 | 3300013307 | Unclassified | 1783 |
| 125 | Ga0157375_10098583 | 3300013308 | Unclassified | 2999 |
| 126 | Ga0157375_10348305 | 3300013308 | Bacteria | 1647 |
| 127 | Ga0157375_10694338 | 3300013308 | Bacteria | 1171 |
| 128 | Ga0163163_10002549 | 3300014325 | Bacteria | 15435 |
| 129 | Ga0163163_10165892 | 3300014325 | Bacteria | 2254 |
| 130 | Ga0163163_10322956 | 3300014325 | Bacteria | 1597 |
| 131 | Ga0182008_10059914 | 3300014497 | Bacteria | 1877 |
| 132 | Ga0157379_10106827 | 3300014968 | Bacteria | 2513 |
| 133 | Ga0157376_10175817 | 3300014969 | Bacteria | 1953 |
| 134 | Ga0157376_10396676 | 3300014969 | Bacteria | 1333 |
| 135 | Ga0182007_10008656 | 3300015262 | Bacteria | 4164 |
| 136 | Ga0182007_10029361 | 3300015262 | Bacteria | 1883 |
| 137 | Ga0182005_1018388 | 3300015265 | Bacteria | 1931 |
| 138 | Ga0163161_10049245 | 3300017792 | Bacteria | 3044 |
| 139 | Ga0213872_10003182 | 3300021361 | Bacteria | 9205 |
| 140 | Ga0213872_10003690 | 3300021361 | Bacteria | 8382 |
| 141 | Ga0213872_10055102 | 3300021361 | Bacteria | 1802 |
| 142 | Ga0213871_10000469 | 3300021441 | Bacteria | 5479 |
| 143 | Ga0207692_10002644 | 3300025898 | Bacteria | 6892 |
| 144 | Ga0207699_10046227 | 3300025906 | Bacteria | 2545 |
| 145 | Ga0207699_10148254 | 3300025906 | Unclassified | 1549 |
| 146 | Ga0207699_10321993 | 3300025906 | Bacteria | 1085 |
| 147 | Ga0207684_10379454 | 3300025910 | Unclassified | 1216 |
| 148 | Ga0207654_10047941 | 3300025911 | Bacteria | 2443 |
| 149 | Ga0207654_10085006 | 3300025911 | Bacteria | 1914 |
| 150 | Ga0207654_10392736 | 3300025911 | Unclassified | 963 |
| 151 | Ga0207707_10056523 | 3300025912 | Bacteria | 3414 |
| 152 | Ga0207707_10362205 | 3300025912 | Unclassified | 1248 |
| 153 | Ga0207707_10620177 | 3300025912 | Bacteria | 914 |
| 154 | Ga0207695_10020145 | 3300025913 | Bacteria | 7649 |
| 155 | Ga0207695_10079555 | 3300025913 | Bacteria | 3322 |
| 156 | Ga0207671_10218843 | 3300025914 | Unclassified | 1491 |
| 157 | Ga0207693_10009791 | 3300025915 | Bacteria | 7801 |
| 158 | Ga0207693_10054407 | 3300025915 | Bacteria | 3139 |
| 159 | Ga0207693_10056885 | 3300025915 | Bacteria | 3066 |
| 160 | Ga0207693_10138206 | 3300025915 | Bacteria | 1916 |
| 161 | Ga0207693_10535415 | 3300025915 | Unclassified | 914 |
| 162 | Ga0207663_10307704 | 3300025916 | Unclassified | 1186 |
| 163 | Ga0207662_10084569 | 3300025918 | Bacteria | 1941 |
| 164 | Ga0207649_10015693 | 3300025920 | Bacteria | 4256 |
| 165 | Ga0207646_10016435 | 3300025922 | Bacteria | 6943 |
| 166 | Ga0207646_10036812 | 3300025922 | Bacteria | 4416 |
| 167 | Ga0207681_10150172 | 3300025923 | Unclassified | 1745 |
| 168 | Ga0207681_10298894 | 3300025923 | Bacteria | 1273 |
| 169 | Ga0207700_10022051 | 3300025928 | Unclassified | 4362 |
| 170 | Ga0207700_10112145 | 3300025928 | Unclassified | 2196 |
| 171 | Ga0207700_10127366 | 3300025928 | Bacteria | 2073 |
| 172 | Ga0207700_10208206 | 3300025928 | Bacteria | 1652 |
| 173 | Ga0207664_10026317 | 3300025929 | Unclassified | 4395 |
| 174 | Ga0207664_10041502 | 3300025929 | Unclassified | 3584 |
| 175 | Ga0207664_10168558 | 3300025929 | Unclassified | 1872 |
| 176 | Ga0207664_10288874 | 3300025929 | Bacteria | 1441 |
| 177 | Ga0207686_10000169 | 3300025934 | Bacteria | 49795 |
| 178 | Ga0207686_10340669 | 3300025934 | Unclassified | 1126 |
| 179 | Ga0207709_10150997 | 3300025935 | Bacteria | 1609 |
| 180 | Ga0207704_10378480 | 3300025938 | Bacteria | 1110 |
| 181 | Ga0207665_10001295 | 3300025939 | Bacteria | 16905 |
| 182 | Ga0207665_10019673 | 3300025939 | Bacteria | 4440 |
| 183 | Ga0207665_10097552 | 3300025939 | Bacteria | 2046 |
| 184 | Ga0207665_10160392 | 3300025939 | Bacteria | 1617 |
| 185 | Ga0207665_10169259 | 3300025939 | Bacteria | 1577 |
| 186 | Ga0207665_10278370 | 3300025939 | Bacteria | 1244 |
| 187 | Ga0207711_10005939 | 3300025941 | Bacteria | 10321 |
| 188 | Ga0207689_10000185 | 3300025942 | Bacteria | 54094 |
| 189 | Ga0207661_10136017 | 3300025944 | Bacteria | 2110 |
| 190 | Ga0207679_10591213 | 3300025945 | Unclassified | 999 |
| 191 | Ga0207667_10052784 | 3300025949 | Bacteria | 4279 |
| 192 | Ga0207651_10246189 | 3300025960 | Bacteria | 1460 |
| 193 | Ga0207640_10156269 | 3300025981 | Bacteria | 1682 |
| 194 | Ga0207703_10018445 | 3300026035 | Bacteria | 5449 |
| 195 | Ga0207703_10025452 | 3300026035 | Unclassified | 4654 |
| 196 | Ga0207639_10001850 | 3300026041 | Bacteria | 14229 |
| 197 | Ga0207678_10226724 | 3300026067 | Viruses | 1600 |
| 198 | Ga0207702_10266480 | 3300026078 | Bacteria | 1614 |
| 199 | Ga0207641_10049472 | 3300026088 | Unclassified | 3552 |
| 200 | Ga0207641_10331014 | 3300026088 | Bacteria | 1447 |
| 201 | Ga0207648_10014438 | 3300026089 | Bacteria | 7300 |
| 202 | Ga0207676_10224969 | 3300026095 | Unclassified | 1674 |
| 203 | Ga0207676_10434465 | 3300026095 | Unclassified | 1234 |
| 204 | Ga0207676_10699396 | 3300026095 | Unclassified | 982 |
| 205 | Ga0207675_100141178 | 3300026118 | Unclassified | 2288 |
| 206 | Ga0207683_10207359 | 3300026121 | Bacteria | 1783 |
| 207 | Ga0207698_10062206 | 3300026142 | Bacteria | 2914 |
| 208 | Ga0209179_1007635 | 3300027512 | Bacteria | 1792 |
| 209 | Ga0268265_10032089 | 3300028380 | Bacteria | 3801 |
| 210 | Ga0265338_10048868 | 3300028800 | Unclassified | 3842 |
| 211 | Ga0265338_10099602 | 3300028800 | Unclassified | 2373 |
| 212 | Ga0265762_1026414 | 3300030760 | Bacteria | 1086 |
| 213 | Ga0265760_10012281 | 3300031090 | Bacteria | 2447 |
| 214 | Ga0265330_10000262 | 3300031235 | Bacteria | 38790 |
| 215 | Ga0265325_10000211 | 3300031241 | Bacteria | 41520 |
| 216 | Ga0265325_10019047 | 3300031241 | Unclassified | 3800 |
| 217 | Ga0265339_10012153 | 3300031249 | Bacteria | 5268 |
| 218 | Ga0265339_10041777 | 3300031249 | Bacteria | 2543 |
| 219 | Ga0265331_10058743 | 3300031250 | Bacteria | 1820 |
| 220 | Ga0265327_10186805 | 3300031251 | Unclassified | 945 |
| 221 | Ga0265316_10000355 | 3300031344 | Bacteria | 51585 |
| 222 | Ga0265316_10001005 | 3300031344 | Bacteria | 30618 |
| 223 | Ga0265316_10009803 | 3300031344 | Bacteria | 8794 |
| 224 | Ga0265316_10022412 | 3300031344 | Bacteria | 5325 |
| 225 | Ga0265316_10334240 | 3300031344 | Unclassified | 1099 |
| 226 | Ga0265313_10031719 | 3300031595 | Unclassified | 2705 |
| 227 | Ga0265313_10049912 | 3300031595 | Bacteria | 2011 |
| 228 | Ga0265314_10001994 | 3300031711 | Bacteria | 21660 |
| 229 | Ga0265314_10019189 | 3300031711 | Bacteria | 5302 |
| 230 | Ga0265342_10002750 | 3300031712 | Bacteria | 14948 |
| 231 | Ga0265342_10044633 | 3300031712 | Unclassified | 2671 |
| 232 | Ga0316576_10022838 | 3300031727 | Bacteria | 4350 |
| 233 | Ga0316578_10001935 | 3300031728 | Bacteria | 8765 |
| 234 | Ga0316578_10035728 | 3300031728 | Bacteria | 2858 |
| 235 | Ga0316577_10000778 | 3300031733 | Bacteria | 13721 |
| 236 | Ga0316577_10155479 | 3300031733 | Unclassified | 1289 |
| 237 | Ga0307413_10168103 | 3300031824 | Bacteria | 1549 |
| 238 | Ga0307416_100126536 | 3300032002 | Bacteria | 2290 |
| 239 | Ga0373936_0092191 | 3300035113 | Bacteria | 1271 |
| 240 | Ga0373955_0077169 | 3300035172 | Unclassified | 1875 |
| 241 | Ga0373931_0118531 | 3300035691 | Bacteria | 1510 |
| 242 | Ga0373935_0396218 | 3300035692 | Bacteria | 991 |
| 243 | Ga0373927_0014597 | 3300035695 | Bacteria | 5196 |
| 244 | Ga0373933_0498405 | 3300035724 | Bacteria | 798 |
| 245 | Ga0373937_0636207 | 3300036401 | Bacteria | 1012 |
| 246 | Ga0316584_0020226 | 3300036712 | Unclassified | 4823 |
| 247 | Ga0373925_0001229 | 3300037068 | Bacteria | 22656 |
| 248 | Ga0373925_0273079 | 3300037068 | Unclassified | 1360 |
| 249 | Ga0395899_0108497 | 3300037312 | Bacteria | 1998 |
| 250 | Ga0395900_0071296 | 3300037418 | Unclassified | 3572 |
| 251 | Ga0395905_0021742 | 3300037471 | Bacteria | 6069 |
| 252 | Ga0395905_0139940 | 3300037471 | Unclassified | 2277 |
| 253 | Ga0395905_0310620 | 3300037471 | Bacteria | 1465 |
| 254 | Ga0395905_0586476 | 3300037471 | Unclassified | 1016 |
| 255 | Ga0316581_0040395 | 3300037588 | Unclassified | 1420 |
| 256 | Ga0436360_0010438 | 3300039438 | Bacteria | 2866 |
| 257 | Ga0436360_0182885 | 3300039438 | Unclassified | 802 |
| 258 | Ga0436360_0443944 | 3300039438 | Bacteria | 23488 |
| 259 | Ga0436361_0174640 | 3300039447 | Bacteria | 1217 |
| 260 | Ga0436361_0545182 | 3300039447 | Bacteria | 13931 |
| 261 | Ga0436361_0789908 | 3300039447 | Bacteria | 1040 |
| 262 | Ga0436361_0968326 | 3300039447 | Bacteria | 17636 |
| 263 | Ga0436363_1259193 | 3300039450 | Bacteria | 3256 |
| 264 | Ga0436362_0568685 | 3300039453 | Bacteria | 1380 |
| 265 | Ga0466963_0092829 | 3300044694 | Unclassified | 2057 |
| 266 | Ga0466963_0192454 | 3300044694 | Bacteria | 1425 |
| 267 | Ga0466963_0240821 | 3300044694 | Bacteria | 1269 |
| 268 | Ga0453684_1010474 | 3300044712 | Unclassified | 884 |
| 269 | Ga0451576_0318034 | 3300045051 | Bacteria | 1629 |
| 270 | Ga0451576_0468463 | 3300045051 | Bacteria | 1323 |
| 271 | Ga0466958_0185784 | 3300045836 | Bacteria | 1320 |
| 272 | Ga0466967_0001949 | 3300045976 | Bacteria | 12493 |
| 273 | Ga0466967_0089067 | 3300045976 | Bacteria | 2802 |
| 274 | Ga0495603_0176687 | 3300046455 | Unclassified | 1236 |
| 275 | Ga0495629_0026408 | 3300046459 | Bacteria | 4125 |
| 276 | Ga0495651_0080844 | 3300046462 | Bacteria | 2454 |
| 277 | Ga0495580_0001858 | 3300046472 | Bacteria | 18574 |
| 278 | Ga0495580_0005568 | 3300046472 | Bacteria | 10385 |
| 279 | Ga0495580_0042229 | 3300046472 | Bacteria | 3249 |
| 280 | Ga0495580_0075810 | 3300046472 | Unclassified | 2346 |
| 281 | Ga0495580_0136827 | 3300046472 | Bacteria | 1699 |
| 282 | Ga0495580_0520824 | 3300046472 | Bacteria | 792 |
| 283 | Ga0495582_0090697 | 3300046473 | Bacteria | 1704 |
| 284 | Ga0495664_0102920 | 3300046477 | Unclassified | 1721 |
| 285 | Ga0495618_0157164 | 3300046514 | Bacteria | 1451 |
| 286 | Ga0495630_0310133 | 3300046517 | Unclassified | 1206 |
| 287 | Ga0495665_0027463 | 3300046531 | Bacteria | 3055 |
| 288 | Ga0495587_0120547 | 3300046536 | Bacteria | 1503 |
| 289 | Ga0495634_0299428 | 3300046642 | Bacteria | 973 |
| 290 | Ga0495669_0008798 | 3300046684 | Unclassified | 4253 |
| 291 | Ga0495613_0073727 | 3300046689 | Bacteria | 2487 |
| 292 | Ga0495613_0162436 | 3300046689 | Bacteria | 1588 |
| 293 | Ga0495649_0071027 | 3300046694 | Bacteria | 1866 |
| 294 | Ga0495581_0011208 | 3300047315 | Bacteria | 5183 |
| 295 | Ga0495604_0111225 | 3300047317 | Unclassified | 1997 |
| 296 | Ga0495674_0201935 | 3300047319 | Unclassified | 1649 |
| 297 | Ga0495674_0516622 | 3300047319 | Bacteria | 954 |
| 298 | Ga0495680_0193303 | 3300047322 | Bacteria | 1463 |
| 299 | Ga0495687_030653 | 3300047443 | Bacteria | 2475 |
| 300 | Ga0495675_0028939 | 3300047444 | Bacteria | 3532 |
| 301 | Ga0495677_0065827 | 3300047445 | Bacteria | 1347 |
| 302 | Ga0495684_0196259 | 3300047471 | Bacteria | 1490 |
| 303 | Ga0495602_0521256 | 3300048088 | Bacteria | 828 |
| 304 | Ga0496100_0026390 | 3300048903 | Bacteria | 3561 |
| 305 | Ga0496101_0120243 | 3300048904 | Bacteria | 1985 |
| 306 | Ga0496102_0079530 | 3300048905 | Unclassified | 3019 |
| 307 | Ga0496102_0098797 | 3300048905 | Bacteria | 2709 |
| 308 | Ga0496104_0002768 | 3300048907 | Bacteria | 15101 |
| 309 | Ga0496105_0533704 | 3300048908 | Unclassified | 918 |
| 310 | Ga0496106_0423321 | 3300048909 | Bacteria | 1070 |
| 311 | Ga0496107_0465761 | 3300048910 | Bacteria | 938 |
| 312 | Ga0496108_0072991 | 3300048911 | Unclassified | 2898 |
| 313 | Ga0496111_0047979 | 3300048914 | Bacteria | 3076 |
| 314 | Ga0496112_0028834 | 3300048915 | Bacteria | 5362 |
| 315 | Ga0496112_0037499 | 3300048915 | Unclassified | 4730 |
| 316 | Ga0496112_0075013 | 3300048915 | Bacteria | 3345 |
| 317 | Ga0496112_0108165 | 3300048915 | Bacteria | 2751 |
| 318 | Ga0496112_0252042 | 3300048915 | Bacteria | 1716 |
| 319 | Ga0496114_0231820 | 3300048917 | Bacteria | 1622 |
| 320 | Ga0496115_0048082 | 3300048918 | Bacteria | 3412 |
| 321 | Ga0496115_0057085 | 3300048918 | Bacteria | 3139 |
| 322 | Ga0496126_0001522 | 3300048929 | Bacteria | 35736 |
| 323 | Ga0496126_0225527 | 3300048929 | Bacteria | 1572 |
| 324 | Ga0501077_0191089 | 3300049593 | Unclassified | 1301 |
| 325 | Ga0501083_0121285 | 3300049744 | Bacteria | 1715 |
| 326 | Ga0495601_0004386 | 3300053077 | Bacteria | 8152 |
| 327 | Ga0495601_0347339 | 3300053077 | Bacteria | 965 |
| 328 | Ga0501084_0022623 | 3300054114 | Bacteria | 5246 |
| 329 | Ga0265330_10008453 | |||
| 330 | rootH2_10008502 | |||
| 331 | rootL2_10096042 | |||
| 332 | Ga0070658_10507910 | |||
| 333 | Ga0070683_100133328 | |||
| 334 | Ga0070683_100210377 | |||
| 335 | Ga0070690_100154301 | |||
| 336 | Ga0068869_100012038 | |||
| 337 | Ga0070680_100483041 | |||
| 338 | Ga0070682_100062221 | |||
| 339 | Ga0068868_100126332 | |||
| 340 | Ga0070669_100165309 | |||
| 341 | Ga0070669_100302943 | |||
| 342 | Ga0070659_100035241 | |||
| 343 | Ga0070709_10098032 | |||
| 344 | Ga0070709_10110804 | |||
| 345 | Ga0070709_10177671 | |||
| 346 | Ga0070709_10317015 | |||
| 347 | Ga0070714_100473769 | |||
| 348 | Ga0070713_100133530 | |||
| 349 | Ga0070710_10035148 | |||
| 350 | Ga0070710_10050340 | |||
| 351 | Ga0070711_100059564 | |||
| 352 | Ga0070711_100369496 | |||
| 353 | Ga0070694_100390265 | |||
| 354 | Ga0070708_100003488 | |||
| 355 | Ga0070708_100152007 | |||
| 356 | Ga0070681_10026962 | |||
| 357 | Ga0070681_10316840 | |||
| 358 | Ga0068867_100135173 | |||
| 359 | Ga0070685_10074413 | |||
| 360 | Ga0070706_100133349 | |||
| 361 | Ga0070706_100285163 | |||
| 362 | Ga0070706_100492787 | |||
| 363 | Ga0070707_100041410 | |||
| 364 | Ga0070707_100171676 | |||
| 365 | Ga0070707_100434743 | |||
| 366 | Ga0070699_100008978 | |||
| 367 | Ga0070679_100188164 | |||
| 368 | Ga0070679_100550199 | |||
| 369 | Ga0070697_100000345 | |||
| 370 | Ga0070693_100123714 | |||
| 371 | Ga0070693_100137931 | |||
| 372 | Ga0070693_100402271 | |||
| 373 | Ga0070665_100163786 | |||
| 374 | Ga0070704_100094749 | |||
| 375 | Ga0068855_100046115 | |||
| 376 | Ga0068855_100704774 | |||
| 377 | Ga0070664_100420224 | |||
| 378 | Ga0068854_100274526 | |||
| 379 | Ga0068856_100005971 | |||
| 380 | Ga0068859_100025551 | |||
| 381 | Ga0068864_100020681 | |||
| 382 | Ga0068861_100228622 | |||
| 383 | Ga0068851_10154478 | |||
| 384 | Ga0068863_100038879 | |||
| 385 | Ga0068863_100131399 | |||
| 386 | Ga0068863_100696341 | |||
| 387 | Ga0068858_100014582 | |||
| 388 | Ga0068858_100520041 | |||
| 389 | Ga0068860_100044783 | |||
| 390 | Ga0068860_100269944 | |||
| 391 | Ga0068862_100228180 | |||
| 392 | Ga0070717_10002066 | |||
| 393 | Ga0070717_10021908 | |||
| 394 | Ga0070717_10054464 | |||
| 395 | Ga0070717_10088225 | |||
| 396 | Ga0070717_10156834 | |||
| 397 | Ga0070717_10167863 | |||
| 398 | Ga0070717_10209177 | |||
| 399 | Ga0070717_10486831 | |||
| 400 | Ga0070715_10002962 | |||
| 401 | Ga0070716_100000963 | |||
| 402 | Ga0070716_100138718 | |||
| 403 | Ga0070716_100174348 | |||
| 404 | Ga0070716_100184021 | |||
| 405 | Ga0070712_100001489 | |||
| 406 | Ga0070712_100032630 | |||
| 407 | Ga0070712_100043032 | |||
| 408 | Ga0070712_100183309 | |||
| 409 | Ga0097621_100148497 | |||
| 410 | Ga0097621_100245746 | |||
| 411 | Ga0097621_100462956 | |||
| 412 | Ga0068871_100281732 | |||
| 413 | Ga0075434_100312304 | |||
| 414 | Ga0075434_100451150 | |||
| 415 | Ga0097620_100025552 | |||
| 416 | Ga0099795_10003888 | |||
| 417 | Ga0099795_10150904 | |||
| 418 | Ga0105240_10005223 | |||
| 419 | Ga0105240_10029627 | |||
| 420 | Ga0105240_10579868 | |||
| 421 | Ga0105245_10307707 | |||
| 422 | Ga0105245_10972523 | |||
| 423 | Ga0105241_10072223 | |||
| 424 | Ga0105241_10520376 | |||
| 425 | Ga0105242_10000502 | |||
| 426 | Ga0105242_10320169 | |||
| 427 | Ga0105248_10003827 | |||
| 428 | Ga0105248_10014332 | |||
| 429 | Ga0105248_10099775 | |||
| 430 | Ga0105237_10313986 | |||
| 431 | Ga0105238_10114872 | |||
| 432 | Ga0099796_10011858 | |||
| 433 | Ga0099796_10024308 | |||
| 434 | Ga0105239_10031937 | |||
| 435 | Ga0105239_10075524 | |||
| 436 | Ga0105239_10144666 | |||
| 437 | Ga0105239_10386303 | |||
| 438 | Ga0105246_10590286 | |||
| 439 | Ga0157374_10018844 | |||
| 440 | Ga0157374_10028773 | |||
| 441 | Ga0157374_10196826 | |||
| 442 | Ga0157374_10212349 | |||
| 443 | Ga0157378_10010895 | |||
| 444 | Ga0157378_10018974 | |||
| 445 | Ga0157378_10058486 | |||
| 446 | Ga0157378_10079010 | |||
| 447 | Ga0157378_10277926 | |||
| 448 | Ga0163162_10229116 | |||
| 449 | Ga0157372_10028458 | |||
| 450 | Ga0157372_10105722 | |||
| 451 | Ga0157372_10254269 | |||
| 452 | Ga0157372_10327707 | |||
| 453 | Ga0157375_10098583 | |||
| 454 | Ga0157375_10348305 | |||
| 455 | Ga0157375_10694338 | |||
| 456 | Ga0163163_10002549 | |||
| 457 | Ga0163163_10165892 | |||
| 458 | Ga0163163_10322956 | |||
| 459 | Ga0182008_10059914 | |||
| 460 | Ga0157379_10106827 | |||
| 461 | Ga0157376_10175817 | |||
| 462 | Ga0157376_10396676 | |||
| 463 | Ga0182007_10008656 | |||
| 464 | Ga0182007_10029361 | |||
| 465 | Ga0182005_1018388 | |||
| 466 | Ga0163161_10049245 | |||
| 467 | Ga0213872_10003182 | |||
| 468 | Ga0213872_10003690 | |||
| 469 | Ga0213872_10055102 | |||
| 470 | Ga0213871_10000469 | |||
| 471 | Ga0207692_10002644 | |||
| 472 | Ga0207699_10046227 | |||
| 473 | Ga0207699_10148254 | |||
| 474 | Ga0207699_10321993 | |||
| 475 | Ga0207684_10379454 | |||
| 476 | Ga0207654_10047941 | |||
| 477 | Ga0207654_10085006 | |||
| 478 | Ga0207654_10392736 | |||
| 479 | Ga0207707_10056523 | |||
| 480 | Ga0207707_10362205 | |||
| 481 | Ga0207707_10620177 | |||
| 482 | Ga0207695_10020145 | |||
| 483 | Ga0207695_10079555 | |||
| 484 | Ga0207671_10218843 | |||
| 485 | Ga0207693_10009791 | |||
| 486 | Ga0207693_10054407 | |||
| 487 | Ga0207693_10056885 | |||
| 488 | Ga0207693_10138206 | |||
| 489 | Ga0207693_10535415 | |||
| 490 | Ga0207663_10307704 | |||
| 491 | Ga0207662_10084569 | |||
| 492 | Ga0207649_10015693 | |||
| 493 | Ga0207646_10016435 | |||
| 494 | Ga0207646_10036812 | |||
| 495 | Ga0207681_10150172 | |||
| 496 | Ga0207681_10298894 | |||
| 497 | Ga0207700_10022051 | |||
| 498 | Ga0207700_10112145 | |||
| 499 | Ga0207700_10127366 | |||
| 500 | Ga0207700_10208206 | |||
| 501 | Ga0207664_10026317 | |||
| 502 | Ga0207664_10041502 | |||
| 503 | Ga0207664_10168558 | |||
| 504 | Ga0207664_10288874 | |||
| 505 | Ga0207686_10000169 | |||
| 506 | Ga0207686_10340669 | |||
| 507 | Ga0207709_10150997 | |||
| 508 | Ga0207704_10378480 | |||
| 509 | Ga0207665_10001295 | |||
| 510 | Ga0207665_10019673 | |||
| 511 | Ga0207665_10097552 | |||
| 512 | Ga0207665_10160392 | |||
| 513 | Ga0207665_10169259 | |||
| 514 | Ga0207665_10278370 | |||
| 515 | Ga0207711_10005939 | |||
| 516 | Ga0207689_10000185 | |||
| 517 | Ga0207661_10136017 | |||
| 518 | Ga0207679_10591213 | |||
| 519 | Ga0207667_10052784 | |||
| 520 | Ga0207651_10246189 | |||
| 521 | Ga0207640_10156269 | |||
| 522 | Ga0207703_10018445 | |||
| 523 | Ga0207703_10025452 | |||
| 524 | Ga0207639_10001850 | |||
| 525 | Ga0207678_10226724 | |||
| 526 | Ga0207702_10266480 | |||
| 527 | Ga0207641_10049472 | |||
| 528 | Ga0207641_10331014 | |||
| 529 | Ga0207648_10014438 | |||
| 530 | Ga0207676_10224969 | |||
| 531 | Ga0207676_10434465 | |||
| 532 | Ga0207676_10699396 | |||
| 533 | Ga0207675_100141178 | |||
| 534 | Ga0207683_10207359 | |||
| 535 | Ga0207698_10062206 | |||
| 536 | Ga0209179_1007635 | |||
| 537 | Ga0268265_10032089 | |||
| 538 | Ga0265338_10048868 | |||
| 539 | Ga0265338_10099602 | |||
| 540 | Ga0265762_1026414 | |||
| 541 | Ga0265760_10012281 | |||
| 542 | Ga0265330_10000262 | |||
| 543 | Ga0265325_10000211 | |||
| 544 | Ga0265325_10019047 | |||
| 545 | Ga0265339_10012153 | |||
| 546 | Ga0265339_10041777 | |||
| 547 | Ga0265331_10058743 | |||
| 548 | Ga0265327_10186805 | |||
| 549 | Ga0265316_10000355 | |||
| 550 | Ga0265316_10001005 | |||
| 551 | Ga0265316_10009803 | |||
| 552 | Ga0265316_10022412 | |||
| 553 | Ga0265316_10334240 | |||
| 554 | Ga0265313_10031719 | |||
| 555 | Ga0265313_10049912 | |||
| 556 | Ga0265314_10001994 | |||
| 557 | Ga0265314_10019189 | |||
| 558 | Ga0265342_10002750 | |||
| 559 | Ga0265342_10044633 | |||
| 560 | Ga0316576_10022838 | |||
| 561 | Ga0316578_10001935 | |||
| 562 | Ga0316578_10035728 | |||
| 563 | Ga0316577_10000778 | |||
| 564 | Ga0316577_10155479 | |||
| 565 | Ga0307413_10168103 | |||
| 566 | Ga0307416_100126536 | |||
| 567 | Ga0373936_0092191 | |||
| 568 | Ga0373955_0077169 | |||
| 569 | Ga0373931_0118531 | |||
| 570 | Ga0373935_0396218 | |||
| 571 | Ga0373927_0014597 | |||
| 572 | Ga0373933_0498405 | |||
| 573 | Ga0373937_0636207 | |||
| 574 | Ga0316584_0020226 | |||
| 575 | Ga0373925_0001229 | |||
| 576 | Ga0373925_0273079 | |||
| 577 | Ga0395899_0108497 | |||
| 578 | Ga0395900_0071296 | |||
| 579 | Ga0395905_0021742 | |||
| 580 | Ga0395905_0139940 | |||
| 581 | Ga0395905_0310620 | |||
| 582 | Ga0395905_0586476 | |||
| 583 | Ga0316581_0040395 | |||
| 584 | Ga0436360_0010438 | |||
| 585 | Ga0436360_0182885 | |||
| 586 | Ga0436360_0443944 | |||
| 587 | Ga0436361_0174640 | |||
| 588 | Ga0436361_0545182 | |||
| 589 | Ga0436361_0789908 | |||
| 590 | Ga0436361_0968326 | |||
| 591 | Ga0436363_1259193 | |||
| 592 | Ga0436362_0568685 | |||
| 593 | Ga0466963_0092829 | |||
| 594 | Ga0466963_0192454 | |||
| 595 | Ga0466963_0240821 | |||
| 596 | Ga0453684_1010474 | |||
| 597 | Ga0451576_0318034 | |||
| 598 | Ga0451576_0468463 | |||
| 599 | Ga0466958_0185784 | |||
| 600 | Ga0466967_0001949 | |||
| 601 | Ga0466967_0089067 | |||
| 602 | Ga0495603_0176687 | |||
| 603 | Ga0495629_0026408 | |||
| 604 | Ga0495651_0080844 | |||
| 605 | Ga0495580_0001858 | |||
| 606 | Ga0495580_0005568 | |||
| 607 | Ga0495580_0042229 | |||
| 608 | Ga0495580_0075810 | |||
| 609 | Ga0495580_0136827 | |||
| 610 | Ga0495580_0520824 | |||
| 611 | Ga0495582_0090697 | |||
| 612 | Ga0495664_0102920 | |||
| 613 | Ga0495618_0157164 | |||
| 614 | Ga0495630_0310133 | |||
| 615 | Ga0495665_0027463 | |||
| 616 | Ga0495587_0120547 | |||
| 617 | Ga0495634_0299428 | |||
| 618 | Ga0495669_0008798 | |||
| 619 | Ga0495613_0073727 | |||
| 620 | Ga0495613_0162436 | |||
| 621 | Ga0495649_0071027 | |||
| 622 | Ga0495581_0011208 | |||
| 623 | Ga0495604_0111225 | |||
| 624 | Ga0495674_0201935 | |||
| 625 | Ga0495674_0516622 | |||
| 626 | Ga0495680_0193303 | |||
| 627 | Ga0495687_030653 | |||
| 628 | Ga0495675_0028939 | |||
| 629 | Ga0495677_0065827 | |||
| 630 | Ga0495684_0196259 | |||
| 631 | Ga0495602_0521256 | |||
| 632 | Ga0496100_0026390 | |||
| 633 | Ga0496101_0120243 | |||
| 634 | Ga0496102_0079530 | |||
| 635 | Ga0496102_0098797 | |||
| 636 | Ga0496104_0002768 | |||
| 637 | Ga0496105_0533704 | |||
| 638 | Ga0496106_0423321 | |||
| 639 | Ga0496107_0465761 | |||
| 640 | Ga0496108_0072991 | |||
| 641 | Ga0496111_0047979 | |||
| 642 | Ga0496112_0028834 | |||
| 643 | Ga0496112_0037499 | |||
| 644 | Ga0496112_0075013 | |||
| 645 | Ga0496112_0108165 | |||
| 646 | Ga0496112_0252042 | |||
| 647 | Ga0496114_0231820 | |||
| 648 | Ga0496115_0048082 | |||
| 649 | Ga0496115_0057085 | |||
| 650 | Ga0496126_0001522 | |||
| 651 | Ga0496126_0225527 | |||
| 652 | Ga0501077_0191089 | |||
| 653 | Ga0501083_0121285 | |||
| 654 | Ga0495601_0004386 | |||
| 655 | Ga0495601_0347339 | |||
| 656 | Ga0501084_0022623 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9103 | 33 | 256 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8659 | 33 | 256 |
| 3ege-assembly1.cif.gz_A | crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution | 0.7915 | 55 | 243 |
| 1dus-assembly1.cif.gz_A | mj0882-a hypothetical protein from m. jannaschii | 0.7897 | 67 | 255 |
| 2yxe-assembly1.cif.gz_B | crystal structure of l-isoaspartyl protein carboxyl methyltranferase | 0.7797 | 67 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYG5_1_193_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9294 | 64 | 255 | 3.40.50.150 |
| af_Q59ZE2_70_306_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9252 | 33 | 254 | 3.40.50.150 |
| af_O96145_64_353_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9153 | 33 | 254 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9146 | 34 | 255 | 3.40.50.150 |
| af_Q3ED65_41_261_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9035 | 33 | 254 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5KGP3-F1-model_v4 | Methyltransferase | 0.9682 | 133 | 256 |
GO:0008168
GO:0032259 |
| AF-A0A2V5KGP3-F1-model_v4 | Methyltransferase | 0.9532 | 133 | 256 |
GO:0008168
GO:0032259 |
| AF-A0A6N9F291-F1-model_v4 | deleted | 0.9416 | 123 | 254 |
|
| AF-A0A7X1TTZ2-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.938 | 23 | 254 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-K2F0Z7-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.938 | 17 | 255 |
GO:0009234
GO:0032259 GO:0043770 |