F409285

General Info

Members Datasets Scaffolds Average Seq Length
328 179 656 236

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10135593|Ga0207683_101355933
Length 254
Sequence VDQLLVALDVESAAKATALADALRGVAGGFKIGSRLFTSEGPAIVRALVDKGDRVFLDLKFHDIPNTVAQAVAAATSLGVWMVNVHAAGGTKMMQAARDAAQXXXARGGTRAPIVIAVTVLTSMTPDALAETGYATSGDAPLLEQVVRLARLAESAGLDGVVASPQETATLRARCGPGFAIVTPGIRGGGAVAGSRDDQERTMSAGEALATGASYIVVGRPIIAAADPRADWNADGVLDLFDFLAYTNAFNAGC

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 3.96
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10135593 3300026121 Bacteria 2216
2 JGI24748J21848_1000011 3300002074 Bacteria 157004
3 JGI24034J26672_10000023 3300002239 Bacteria 115999
4 Ga0065712_10090984 3300005290 Bacteria 2396
5 Ga0065715_10020523 3300005293 Bacteria 2736
6 Ga0070676_10134099 3300005328 Bacteria 1569
7 Ga0070683_100000107 3300005329 Bacteria 54632
8 Ga0070670_100005373 3300005331 Bacteria 10815
9 Ga0070666_10058786 3300005335 Bacteria 2600
10 Ga0068868_100053484 3300005338 Bacteria 3181
11 Ga0068868_100515822 3300005338 Bacteria 1049
12 Ga0070661_100487488 3300005344 Bacteria 985
13 Ga0070669_100001306 3300005353 Bacteria 17985
14 Ga0070669_100144930 3300005353 Bacteria 1834
15 Ga0070675_100064283 3300005354 Bacteria 3034
16 Ga0070671_100142446 3300005355 Bacteria 2023
17 Ga0070671_100293245 3300005355 Bacteria 1384
18 Ga0070674_100106132 3300005356 Bacteria 2055
19 Ga0070674_100223651 3300005356 Bacteria 1465
20 Ga0070673_100512369 3300005364 Bacteria 1086
21 Ga0070673_100974498 3300005364 Bacteria 789
22 Ga0070659_100126768 3300005366 Bacteria 2071
23 Ga0070667_100450362 3300005367 Archaea 1176
24 Ga0070667_100852172 3300005367 Unclassified 847
25 Ga0070714_100539741 3300005435 Bacteria 1115
26 Ga0070713_100315926 3300005436 Bacteria 1441
27 Ga0070713_100461601 3300005436 Bacteria 1194
28 Ga0070711_100416862 3300005439 Bacteria 1093
29 Ga0070700_100024849 3300005441 Bacteria 3522
30 Ga0070694_100008651 3300005444 Bacteria 6234
31 Ga0070694_100495002 3300005444 Bacteria 972
32 Ga0070663_100129041 3300005455 Bacteria 1918
33 Ga0070678_100044450 3300005456 Bacteria 3172
34 Ga0070678_100163107 3300005456 Bacteria 1808
35 Ga0070678_100399315 3300005456 Bacteria 1194
36 Ga0070662_100207268 3300005457 Bacteria 1558
37 Ga0068867_100302408 3300005459 Bacteria 1319
38 Ga0070707_100089181 3300005468 Bacteria 2984
39 Ga0070707_100145817 3300005468 Bacteria 2304
40 Ga0070684_100003726 3300005535 Bacteria 11502
41 Ga0070697_100216678 3300005536 Bacteria 1631
42 Ga0070697_100287700 3300005536 Bacteria 1411
43 Ga0070672_100260566 3300005543 Bacteria 1462
44 Ga0070695_100109836 3300005545 Bacteria 1870
45 Ga0070693_100148242 3300005547 Bacteria 1483
46 Ga0070665_100375751 3300005548 Bacteria 1428
47 Ga0070704_100013575 3300005549 Bacteria 5060
48 Ga0070664_100000303 3300005564 Bacteria 35797
49 Ga0070664_100040212 3300005564 Bacteria 3942
50 Ga0070664_100172766 3300005564 Bacteria 1917
51 Ga0068857_100050510 3300005577 Bacteria 3689
52 Ga0070702_100352266 3300005615 Bacteria 1037
53 Ga0068859_100478760 3300005617 Bacteria 1340
54 Ga0068864_100701033 3300005618 Bacteria 989
55 Ga0068861_100009342 3300005719 Bacteria 6768
56 Ga0068851_10197162 3300005834 Bacteria 1122
57 Ga0068858_100000253 3300005842 Bacteria 57137
58 Ga0068860_100348549 3300005843 Bacteria 1457
59 Ga0068862_100202361 3300005844 Bacteria 1791
60 Ga0068862_100269278 3300005844 Bacteria 1557
61 Ga0070716_100068785 3300006173 Bacteria 2073
62 Ga0075367_10239708 3300006178 Bacteria 1136
63 Ga0075366_10184048 3300006195 Bacteria 1269
64 Ga0097621_100344980 3300006237 Bacteria 1323
65 Ga0075428_100003028 3300006844 Bacteria 18347
66 Ga0075428_100004084 3300006844 Bacteria 16056
67 Ga0075428_100031671 3300006844 Bacteria 5842
68 Ga0075428_100046668 3300006844 Bacteria 4757
69 Ga0075428_100322065 3300006844 Bacteria 1661
70 Ga0075430_100002870 3300006846 Bacteria 14415
71 Ga0075430_100082770 3300006846 Bacteria 2689
72 Ga0075430_100159259 3300006846 Bacteria 1879
73 Ga0075431_100002384 3300006847 Bacteria 18060
74 Ga0075431_100003639 3300006847 Bacteria 14938
75 Ga0075433_10050670 3300006852 Bacteria 3615
76 Ga0075433_10052953 3300006852 Bacteria 3537
77 Ga0075433_10060533 3300006852 Bacteria 3316
78 Ga0075433_10095955 3300006852 Bacteria 2624
79 Ga0075433_10128725 3300006852 Bacteria 2249
80 Ga0075433_10637354 3300006852 Bacteria 935
81 Ga0075434_100000141 3300006871 Bacteria 43904
82 Ga0075434_100104584 3300006871 Bacteria 2841
83 Ga0075434_100130632 3300006871 Bacteria 2530
84 Ga0075434_100152936 3300006871 Bacteria 2327
85 Ga0075434_100187618 3300006871 Bacteria 2088
86 Ga0075434_100539074 3300006871 Bacteria 1187
87 Ga0075429_100003756 3300006880 Bacteria 12949
88 Ga0075429_100030899 3300006880 Bacteria 4655
89 Ga0075429_100082469 3300006880 Bacteria 2803
90 Ga0075429_100158476 3300006880 Bacteria 1982
91 Ga0068865_100059055 3300006881 Bacteria 2681
92 Ga0068865_100303261 3300006881 Bacteria 1279
93 Ga0068865_100347172 3300006881 Bacteria 1201
94 Ga0075436_100085682 3300006914 Bacteria 2188
95 Ga0097620_100478774 3300006931 Bacteria 1340
96 Ga0075435_100007189 3300007076 Bacteria 7918
97 Ga0075435_100016940 3300007076 Bacteria 5503
98 Ga0075435_100444389 3300007076 Bacteria 1118
99 Ga0111539_10000201 3300009094 Bacteria 70327
100 Ga0111539_10008346 3300009094 Bacteria 13182
101 Ga0111539_10014677 3300009094 Bacteria 9774
102 Ga0111539_10067791 3300009094 Bacteria 4213
103 Ga0111539_10078655 3300009094 Bacteria 3879
104 Ga0111539_10306268 3300009094 Bacteria 1849
105 Ga0111539_10352473 3300009094 Bacteria 1713
106 Ga0111539_10909591 3300009094 Bacteria 1023
107 Ga0105247_10000003 3300009101 Bacteria 694517
108 Ga0105247_10513641 3300009101 Bacteria 875
109 Ga0114129_10001134 3300009147 Bacteria 35181
110 Ga0114129_10005436 3300009147 Bacteria 18002
111 Ga0114129_10005798 3300009147 Bacteria 17483
112 Ga0114129_10013449 3300009147 Bacteria 11662
113 Ga0114129_10021328 3300009147 Bacteria 9198
114 Ga0114129_10109297 3300009147 Bacteria 3817
115 Ga0114129_10130883 3300009147 Bacteria 3446
116 Ga0114129_10241088 3300009147 Bacteria 2430
117 Ga0114129_10260055 3300009147 Bacteria 2327
118 Ga0114129_10291078 3300009147 Bacteria 2179
119 Ga0114129_10342019 3300009147 Bacteria 1984
120 Ga0105248_10009984 3300009177 Bacteria 10452
121 Ga0105248_10704671 3300009177 Bacteria 1139
122 Ga0105249_10002028 3300009553 Bacteria 17573
123 Ga0105249_10043331 3300009553 Bacteria 4093
124 Ga0105239_10138645 3300010375 Bacteria 2709
125 Ga0157373_10326940 3300013100 Bacteria 1091
126 Ga0157378_10006127 3300013297 Bacteria 10532
127 Ga0163162_10022678 3300013306 Bacteria 6189
128 Ga0157375_10039247 3300013308 Bacteria 4556
129 Ga0163163_10006798 3300014325 Bacteria 10034
130 Ga0157377_10145041 3300014745 Unclassified 1462
131 Ga0157379_10568291 3300014968 Bacteria 1056
132 Ga0157376_10072774 3300014969 Bacteria 2925
133 Ga0207672_1000238 3300025223 Bacteria 7693
134 Ga0207697_10001670 3300025315 Bacteria 11979
135 Ga0207697_10016282 3300025315 Bacteria 3063
136 Ga0207710_10000001 3300025900 Bacteria 1797433
137 Ga0207688_10015496 3300025901 Bacteria 4133
138 Ga0207688_10145937 3300025901 Bacteria 1395
139 Ga0207699_10147516 3300025906 Bacteria 1553
140 Ga0207707_10154177 3300025912 Bacteria 2009
141 Ga0207663_10367035 3300025916 Bacteria 1093
142 Ga0207649_10341774 3300025920 Bacteria 1105
143 Ga0207646_10062278 3300025922 Bacteria 3330
144 Ga0207646_10166967 3300025922 Bacteria 1987
145 Ga0207681_10011040 3300025923 Bacteria 5547
146 Ga0207650_10006573 3300025925 Bacteria 7931
147 Ga0207659_10078843 3300025926 Bacteria 2428
148 Ga0207687_10281130 3300025927 Bacteria 1334
149 Ga0207700_10281514 3300025928 Bacteria 1431
150 Ga0207644_10000356 3300025931 Bacteria 29717
151 Ga0207644_10159927 3300025931 Bacteria 1750
152 Ga0207690_10097917 3300025932 Bacteria 2088
153 Ga0207669_10023928 3300025937 Bacteria 3273
154 Ga0207669_10036416 3300025937 Bacteria 2812
155 Ga0207704_10086196 3300025938 Bacteria 2047
156 Ga0207704_10422173 3300025938 Bacteria 1057
157 Ga0207665_10094196 3300025939 Bacteria 2080
158 Ga0207691_10204819 3300025940 Bacteria 1716
159 Ga0207711_10035588 3300025941 Bacteria 4222
160 Ga0207689_10200407 3300025942 Bacteria 1647
161 Ga0207661_10036644 3300025944 Bacteria 3830
162 Ga0207679_10018691 3300025945 Bacteria 4648
163 Ga0207679_10043163 3300025945 Bacteria 3245
164 Ga0207679_10116381 3300025945 Bacteria 2119
165 Ga0207651_10066141 3300025960 Bacteria 2539
166 Ga0207712_10007941 3300025961 Bacteria 6705
167 Ga0207658_10411753 3300025986 Archaea 1190
168 Ga0207677_10073409 3300026023 Bacteria 2423
169 Ga0207703_10000055 3300026035 Bacteria 143420
170 Ga0207678_10037107 3300026067 Bacteria 4241
171 Ga0207678_10304759 3300026067 Bacteria 1369
172 Ga0207708_10029092 3300026075 Bacteria 4185
173 Ga0207648_10333958 3300026089 Bacteria 1364
174 Ga0207674_10063661 3300026116 Bacteria 3722
175 Ga0207675_100004377 3300026118 Bacteria 13653
176 Ga0207683_10175669 3300026121 Bacteria 1941
177 Ga0207683_10833753 3300026121 Bacteria 856
178 Ga0207428_10000445 3300027907 Bacteria 50527
179 Ga0207428_10014272 3300027907 Bacteria 6913
180 Ga0268266_10071895 3300028379 Bacteria 2999
181 Ga0268265_10345458 3300028380 Bacteria 1357
182 Ga0268265_10370596 3300028380 Bacteria 1314
183 Ga0268265_10535867 3300028380 Bacteria 1109
184 Ga0307408_100005351 3300031548 Bacteria 8600
185 Ga0307408_100075376 3300031548 Bacteria 2506
186 Ga0307408_100190878 3300031548 Unclassified 1650
187 Ga0307408_100466069 3300031548 Bacteria 1099
188 Ga0265314_10028581 3300031711 Bacteria 4156
189 Ga0307405_10073365 3300031731 Unclassified 2209
190 Ga0307405_10245646 3300031731 Bacteria 1328
191 Ga0307410_10050240 3300031852 Bacteria 2803
192 Ga0307406_10020375 3300031901 Bacteria 3904
193 Ga0307412_10034935 3300031911 Bacteria 3207
194 Ga0307412_10153141 3300031911 Bacteria 1704
195 Ga0307412_10211206 3300031911 Unclassified 1481
196 Ga0307409_100048422 3300031995 Unclassified 3234
197 Ga0307409_100063823 3300031995 Bacteria 2890
198 Ga0307409_100139384 3300031995 Bacteria 2087
199 Ga0307409_100752321 3300031995 Bacteria 978
200 Ga0307416_100048822 3300032002 Bacteria 3361
201 Ga0307416_100054172 3300032002 Bacteria 3223
202 Ga0307416_100056875 3300032002 Bacteria 3160
203 Ga0307416_100075638 3300032002 Bacteria 2819
204 Ga0307416_100093963 3300032002 Bacteria 2585
205 Ga0307416_100438189 3300032002 Bacteria 1356
206 Ga0307416_101547595 3300032002 Bacteria 769
207 Ga0307414_10417631 3300032004 Bacteria 1169
208 Ga0307411_10008636 3300032005 Bacteria 5295
209 Ga0307411_10029002 3300032005 Bacteria 3373
210 Ga0307415_100054871 3300032126 Bacteria 2723
211 Ga0307415_100256299 3300032126 Bacteria 1425
212 Ga0307415_100357324 3300032126 Bacteria 1232
213 Ga0373942_0080989 3300035207 Bacteria 964
214 Ga0316581_0070025 3300037588 Bacteria 1077
215 Ga0439461_0029406 3300041410 Bacteria 1137
216 Ga0439431_0059037 3300041997 Bacteria 1006
217 Ga0439449_0043469 3300042007 Bacteria 1668
218 Ga0439446_0025542 3300042156 Bacteria 1688
219 Ga0439446_0090811 3300042156 Bacteria 956
220 Ga0439435_0007476 3300042436 Bacteria 2501
221 Ga0439460_0016272 3300042461 Bacteria 1979
222 Ga0439460_0023561 3300042461 Bacteria 1699
223 Ga0451577_0025541 3300042876 Bacteria 5358
224 Ga0453683_0033746 3300044673 Bacteria 3227
225 Ga0453684_0222253 3300044712 Bacteria 2187
226 Ga0453684_0733144 3300044712 Bacteria 1071
227 Ga0451576_0061495 3300045051 Bacteria 3915
228 Ga0451576_0092729 3300045051 Bacteria 3141
229 Ga0451576_0479245 3300045051 Bacteria 1307
230 Ga0466967_0653888 3300045976 Bacteria 1039
231 Ga0466967_0746213 3300045976 Bacteria 971
232 Ga0496101_0221699 3300048904 Bacteria 1468
233 Ga0496101_0487988 3300048904 Bacteria 973
234 Ga0496102_0038340 3300048905 Bacteria 4324
235 Ga0496103_0050064 3300048906 Bacteria 2584
236 Ga0496104_0000157 3300048907 Bacteria 61755
237 Ga0496105_0083307 3300048908 Bacteria 2641
238 Ga0496106_0055554 3300048909 Bacteria 2993
239 Ga0496108_0237053 3300048911 Bacteria 1587
240 Ga0496109_0003086 3300048912 Bacteria 13891
241 Ga0496109_0156885 3300048912 Bacteria 2132
242 Ga0496110_0026701 3300048913 Bacteria 4944
243 Ga0496111_0001901 3300048914 Bacteria 12362
244 Ga0496114_0778772 3300048917 Bacteria 835
245 Ga0501036_0261874 3300049572 Bacteria 1448
246 Ga0501039_0009099 3300049575 Bacteria 7570
247 Ga0501040_0014321 3300049576 Bacteria 5225
248 Ga0501040_0018630 3300049576 Bacteria 4610
249 Ga0501040_0069844 3300049576 Bacteria 2423
250 Ga0501041_0003641 3300049577 Bacteria 8863
251 Ga0501041_0185602 3300049577 Bacteria 1302
252 Ga0501042_0009518 3300049578 Bacteria 6479
253 Ga0501042_0113394 3300049578 Bacteria 1952
254 Ga0501042_0498275 3300049578 Bacteria 884
255 Ga0501043_0110819 3300049579 Bacteria 2155
256 Ga0501046_0007069 3300049580 Bacteria 9884
257 Ga0501048_0021881 3300049582 Bacteria 4680
258 Ga0501072_0074016 3300049588 Bacteria 2693
259 Ga0501072_0099989 3300049588 Bacteria 2305
260 Ga0501072_0247325 3300049588 Bacteria 1420
261 Ga0501074_0247803 3300049590 Bacteria 1267
262 Ga0501075_0004213 3300049591 Bacteria 9716
263 Ga0501075_0031243 3300049591 Bacteria 3952
264 Ga0501075_0349329 3300049591 Bacteria 1127
265 Ga0501076_0008733 3300049592 Bacteria 7443
266 Ga0501076_0138497 3300049592 Bacteria 1976
267 Ga0501076_0174168 3300049592 Bacteria 1754
268 Ga0501076_0198243 3300049592 Bacteria 1639
269 Ga0501077_0038366 3300049593 Bacteria 3050
270 Ga0501209_093640 3300049656 Unclassified 876
271 Ga0501079_0006744 3300049741 Bacteria 8638
272 Ga0501079_0053877 3300049741 Bacteria 3103
273 Ga0501079_0408694 3300049741 Bacteria 1065
274 Ga0501080_0026442 3300049742 Bacteria 5392
275 Ga0501081_0004237 3300049743 Bacteria 9187
276 Ga0501081_0040718 3300049743 Bacteria 3181
277 Ga0501081_0075701 3300049743 Bacteria 2350
278 Ga0501083_0211276 3300049744 Bacteria 1265
279 Ga0501035_0175285 3300049822 Bacteria 1850
280 Ga0501035_0227382 3300049822 Bacteria 1591
281 Ga0501045_0004386 3300049824 Bacteria 9726
282 Ga0501045_0133150 3300049824 Bacteria 1848
283 Ga0501045_0485289 3300049824 Bacteria 918
284 nmdc:mga0k408_45569_c1 3300050493 Bacteria 2530
285 nmdc:mga06z11_256062_c1 3300050494 Bacteria 1032
286 nmdc:mga05p37_1089_c1 3300050507 Bacteria 8344
287 nmdc:mga05p37_12450_c1 3300050507 Bacteria 10159
288 nmdc:mga05p37_148147_c1 3300050507 Bacteria 2873
289 nmdc:mga05p37_15459_c1 3300050507 Bacteria 9172
290 nmdc:mga05p37_178444_c1 3300050507 Bacteria 2586
291 nmdc:mga05p37_23447_c1 3300050507 Bacteria 7092
292 nmdc:mga05p37_7208_c1 3300050507 Bacteria 13120
293 nmdc:mga09592_145960_c1 3300050508 Bacteria 2040
294 nmdc:mga09592_160787_c1 3300050508 Bacteria 1940
295 nmdc:mga09592_78432_c1 3300050508 Bacteria 2811
296 nmdc:mga09592_8402_c1 3300050508 Bacteria 8391
297 nmdc:mga09592_89224_c1 3300050508 Bacteria 2633
298 nmdc:mga0qj67_311813_c1 3300050509 Bacteria 1274
299 nmdc:mga0qj67_514958_c1 3300050509 Bacteria 961
300 nmdc:mga0qj67_74909_c1 3300050509 Bacteria 2705
301 nmdc:mga0qj67_7491_c1 3300050509 Bacteria 8059
302 nmdc:mga06r32_10636_c1 3300050510 Bacteria 8298
303 nmdc:mga06r32_5813_c1 3300050510 Bacteria 11110
304 nmdc:mga06r32_6591_c1 3300050510 Bacteria 10430
305 nmdc:mga06r32_88499_c1 3300050510 Bacteria 3023
306 nmdc:mga08y16_1203_c1 3300050511 Bacteria 25560
307 nmdc:mga08y16_258588_c1 3300050511 Bacteria 1798
308 nmdc:mga08y16_40404_c1 3300050511 Bacteria 4890
309 nmdc:mga08y16_8557_c1 3300050511 Bacteria 10720
310 nmdc:mga08y16_96785_c1 3300050511 Bacteria 3073
311 nmdc:mga0n895_131852_c1 3300050512 Bacteria 2524
312 nmdc:mga0n895_72640_c1 3300050512 Bacteria 3413
313 nmdc:mga0n895_79712_c1 3300050512 Bacteria 3261
314 nmdc:mga0n895_977_c1 3300050512 Bacteria 20700
315 nmdc:mga0rr50_203334_c1 3300050513 Bacteria 1628
316 nmdc:mga0rr50_68340_c1 3300050513 Bacteria 2702
317 nmdc:mga08x19_395137_c1 3300050514 Bacteria 969
318 nmdc:mga0a205_138831_c1 3300050515 Bacteria 2331
319 nmdc:mga0a205_194180_c1 3300050515 Bacteria 1921
320 nmdc:mga0a205_202052_c1 3300050515 Unclassified 1878
321 nmdc:mga0a205_292464_c1 3300050515 Bacteria 1503
322 Ga0501084_0096386 3300054114 Bacteria 2484
323 Ga0501082_0014585 3300060353 Bacteria 6767
324 Ga0501082_0400398 3300060353 Bacteria 1198
325 Ga0501082_0517370 3300060353 Bacteria 1043
326 Ga0530510_0011019 3300061734 Bacteria 6342
327 Ga0530510_0269968 3300061734 Bacteria 1269
328 Ga0530510_0427262 3300061734 Bacteria 1000
329 Ga0207683_10135593
330 JGI24748J21848_1000011
331 JGI24034J26672_10000023
332 Ga0065712_10090984
333 Ga0065715_10020523
334 Ga0070676_10134099
335 Ga0070683_100000107
336 Ga0070670_100005373
337 Ga0070666_10058786
338 Ga0068868_100053484
339 Ga0068868_100515822
340 Ga0070661_100487488
341 Ga0070669_100001306
342 Ga0070669_100144930
343 Ga0070675_100064283
344 Ga0070671_100142446
345 Ga0070671_100293245
346 Ga0070674_100106132
347 Ga0070674_100223651
348 Ga0070673_100512369
349 Ga0070673_100974498
350 Ga0070659_100126768
351 Ga0070667_100450362
352 Ga0070667_100852172
353 Ga0070714_100539741
354 Ga0070713_100315926
355 Ga0070713_100461601
356 Ga0070711_100416862
357 Ga0070700_100024849
358 Ga0070694_100008651
359 Ga0070694_100495002
360 Ga0070663_100129041
361 Ga0070678_100044450
362 Ga0070678_100163107
363 Ga0070678_100399315
364 Ga0070662_100207268
365 Ga0068867_100302408
366 Ga0070707_100089181
367 Ga0070707_100145817
368 Ga0070684_100003726
369 Ga0070697_100216678
370 Ga0070697_100287700
371 Ga0070672_100260566
372 Ga0070695_100109836
373 Ga0070693_100148242
374 Ga0070665_100375751
375 Ga0070704_100013575
376 Ga0070664_100000303
377 Ga0070664_100040212
378 Ga0070664_100172766
379 Ga0068857_100050510
380 Ga0070702_100352266
381 Ga0068859_100478760
382 Ga0068864_100701033
383 Ga0068861_100009342
384 Ga0068851_10197162
385 Ga0068858_100000253
386 Ga0068860_100348549
387 Ga0068862_100202361
388 Ga0068862_100269278
389 Ga0070716_100068785
390 Ga0075367_10239708
391 Ga0075366_10184048
392 Ga0097621_100344980
393 Ga0075428_100003028
394 Ga0075428_100004084
395 Ga0075428_100031671
396 Ga0075428_100046668
397 Ga0075428_100322065
398 Ga0075430_100002870
399 Ga0075430_100082770
400 Ga0075430_100159259
401 Ga0075431_100002384
402 Ga0075431_100003639
403 Ga0075433_10050670
404 Ga0075433_10052953
405 Ga0075433_10060533
406 Ga0075433_10095955
407 Ga0075433_10128725
408 Ga0075433_10637354
409 Ga0075434_100000141
410 Ga0075434_100104584
411 Ga0075434_100130632
412 Ga0075434_100152936
413 Ga0075434_100187618
414 Ga0075434_100539074
415 Ga0075429_100003756
416 Ga0075429_100030899
417 Ga0075429_100082469
418 Ga0075429_100158476
419 Ga0068865_100059055
420 Ga0068865_100303261
421 Ga0068865_100347172
422 Ga0075436_100085682
423 Ga0097620_100478774
424 Ga0075435_100007189
425 Ga0075435_100016940
426 Ga0075435_100444389
427 Ga0111539_10000201
428 Ga0111539_10008346
429 Ga0111539_10014677
430 Ga0111539_10067791
431 Ga0111539_10078655
432 Ga0111539_10306268
433 Ga0111539_10352473
434 Ga0111539_10909591
435 Ga0105247_10000003
436 Ga0105247_10513641
437 Ga0114129_10001134
438 Ga0114129_10005436
439 Ga0114129_10005798
440 Ga0114129_10013449
441 Ga0114129_10021328
442 Ga0114129_10109297
443 Ga0114129_10130883
444 Ga0114129_10241088
445 Ga0114129_10260055
446 Ga0114129_10291078
447 Ga0114129_10342019
448 Ga0105248_10009984
449 Ga0105248_10704671
450 Ga0105249_10002028
451 Ga0105249_10043331
452 Ga0105239_10138645
453 Ga0157373_10326940
454 Ga0157378_10006127
455 Ga0163162_10022678
456 Ga0157375_10039247
457 Ga0163163_10006798
458 Ga0157377_10145041
459 Ga0157379_10568291
460 Ga0157376_10072774
461 Ga0207672_1000238
462 Ga0207697_10001670
463 Ga0207697_10016282
464 Ga0207710_10000001
465 Ga0207688_10015496
466 Ga0207688_10145937
467 Ga0207699_10147516
468 Ga0207707_10154177
469 Ga0207663_10367035
470 Ga0207649_10341774
471 Ga0207646_10062278
472 Ga0207646_10166967
473 Ga0207681_10011040
474 Ga0207650_10006573
475 Ga0207659_10078843
476 Ga0207687_10281130
477 Ga0207700_10281514
478 Ga0207644_10000356
479 Ga0207644_10159927
480 Ga0207690_10097917
481 Ga0207669_10023928
482 Ga0207669_10036416
483 Ga0207704_10086196
484 Ga0207704_10422173
485 Ga0207665_10094196
486 Ga0207691_10204819
487 Ga0207711_10035588
488 Ga0207689_10200407
489 Ga0207661_10036644
490 Ga0207679_10018691
491 Ga0207679_10043163
492 Ga0207679_10116381
493 Ga0207651_10066141
494 Ga0207712_10007941
495 Ga0207658_10411753
496 Ga0207677_10073409
497 Ga0207703_10000055
498 Ga0207678_10037107
499 Ga0207678_10304759
500 Ga0207708_10029092
501 Ga0207648_10333958
502 Ga0207674_10063661
503 Ga0207675_100004377
504 Ga0207683_10175669
505 Ga0207683_10833753
506 Ga0207428_10000445
507 Ga0207428_10014272
508 Ga0268266_10071895
509 Ga0268265_10345458
510 Ga0268265_10370596
511 Ga0268265_10535867
512 Ga0307408_100005351
513 Ga0307408_100075376
514 Ga0307408_100190878
515 Ga0307408_100466069
516 Ga0265314_10028581
517 Ga0307405_10073365
518 Ga0307405_10245646
519 Ga0307410_10050240
520 Ga0307406_10020375
521 Ga0307412_10034935
522 Ga0307412_10153141
523 Ga0307412_10211206
524 Ga0307409_100048422
525 Ga0307409_100063823
526 Ga0307409_100139384
527 Ga0307409_100752321
528 Ga0307416_100048822
529 Ga0307416_100054172
530 Ga0307416_100056875
531 Ga0307416_100075638
532 Ga0307416_100093963
533 Ga0307416_100438189
534 Ga0307416_101547595
535 Ga0307414_10417631
536 Ga0307411_10008636
537 Ga0307411_10029002
538 Ga0307415_100054871
539 Ga0307415_100256299
540 Ga0307415_100357324
541 Ga0373942_0080989
542 Ga0316581_0070025
543 Ga0439461_0029406
544 Ga0439431_0059037
545 Ga0439449_0043469
546 Ga0439446_0025542
547 Ga0439446_0090811
548 Ga0439435_0007476
549 Ga0439460_0016272
550 Ga0439460_0023561
551 Ga0451577_0025541
552 Ga0453683_0033746
553 Ga0453684_0222253
554 Ga0453684_0733144
555 Ga0451576_0061495
556 Ga0451576_0092729
557 Ga0451576_0479245
558 Ga0466967_0653888
559 Ga0466967_0746213
560 Ga0496101_0221699
561 Ga0496101_0487988
562 Ga0496102_0038340
563 Ga0496103_0050064
564 Ga0496104_0000157
565 Ga0496105_0083307
566 Ga0496106_0055554
567 Ga0496108_0237053
568 Ga0496109_0003086
569 Ga0496109_0156885
570 Ga0496110_0026701
571 Ga0496111_0001901
572 Ga0496114_0778772
573 Ga0501036_0261874
574 Ga0501039_0009099
575 Ga0501040_0014321
576 Ga0501040_0018630
577 Ga0501040_0069844
578 Ga0501041_0003641
579 Ga0501041_0185602
580 Ga0501042_0009518
581 Ga0501042_0113394
582 Ga0501042_0498275
583 Ga0501043_0110819
584 Ga0501046_0007069
585 Ga0501048_0021881
586 Ga0501072_0074016
587 Ga0501072_0099989
588 Ga0501072_0247325
589 Ga0501074_0247803
590 Ga0501075_0004213
591 Ga0501075_0031243
592 Ga0501075_0349329
593 Ga0501076_0008733
594 Ga0501076_0138497
595 Ga0501076_0174168
596 Ga0501076_0198243
597 Ga0501077_0038366
598 Ga0501209_093640
599 Ga0501079_0006744
600 Ga0501079_0053877
601 Ga0501079_0408694
602 Ga0501080_0026442
603 Ga0501081_0004237
604 Ga0501081_0040718
605 Ga0501081_0075701
606 Ga0501083_0211276
607 Ga0501035_0175285
608 Ga0501035_0227382
609 Ga0501045_0004386
610 Ga0501045_0133150
611 Ga0501045_0485289
612 nmdc:mga0k408_45569_c1
613 nmdc:mga06z11_256062_c1
614 nmdc:mga05p37_1089_c1
615 nmdc:mga05p37_12450_c1
616 nmdc:mga05p37_148147_c1
617 nmdc:mga05p37_15459_c1
618 nmdc:mga05p37_178444_c1
619 nmdc:mga05p37_23447_c1
620 nmdc:mga05p37_7208_c1
621 nmdc:mga09592_145960_c1
622 nmdc:mga09592_160787_c1
623 nmdc:mga09592_78432_c1
624 nmdc:mga09592_8402_c1
625 nmdc:mga09592_89224_c1
626 nmdc:mga0qj67_311813_c1
627 nmdc:mga0qj67_514958_c1
628 nmdc:mga0qj67_74909_c1
629 nmdc:mga0qj67_7491_c1
630 nmdc:mga06r32_10636_c1
631 nmdc:mga06r32_5813_c1
632 nmdc:mga06r32_6591_c1
633 nmdc:mga06r32_88499_c1
634 nmdc:mga08y16_1203_c1
635 nmdc:mga08y16_258588_c1
636 nmdc:mga08y16_40404_c1
637 nmdc:mga08y16_8557_c1
638 nmdc:mga08y16_96785_c1
639 nmdc:mga0n895_131852_c1
640 nmdc:mga0n895_72640_c1
641 nmdc:mga0n895_79712_c1
642 nmdc:mga0n895_977_c1
643 nmdc:mga0rr50_203334_c1
644 nmdc:mga0rr50_68340_c1
645 nmdc:mga08x19_395137_c1
646 nmdc:mga0a205_138831_c1
647 nmdc:mga0a205_194180_c1
648 nmdc:mga0a205_202052_c1
649 nmdc:mga0a205_292464_c1
650 Ga0501084_0096386
651 Ga0501082_0014585
652 Ga0501082_0400398
653 Ga0501082_0517370
654 Ga0530510_0011019
655 Ga0530510_0269968
656 Ga0530510_0427262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

2

234

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cso-assembly5.cif.gz_J crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9332 9 185
3tr2-assembly1.cif.gz_A structure of a orotidine 5'-phosphate decarboxylase (pyrf) from coxiella burnetii 0.9192 7 225
3ru6-assembly2.cif.gz_C 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9115 7 232
8ek7-assembly1.cif.gz_A crystal structure of hepes and mg bound 2,3-diketo-5-methylthiopentyl-1-phosphate enolase-phosphatase from klebsiella aerogenes 0.9097 8 232
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9047 8 232
ID Description Score Start End Superfamily
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8996 7 232 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8985 8 232 3.20.20.70
2yyuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8901 7 232 3.20.20.70
3ldvB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8841 7 232 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8718 7 232 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A523RHW9-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.982 9 134 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7C4E6X9-F1-model_v4 Bifunctional uridylyltransferase/uridylyl-removing enzyme (UTase/UR) (Bifunctional [protein-PII] modification enzyme) (Bifunctional nitrogen sensor protein) [Includes: [Protein-PII] uridylyltransferase (PII uridylyltransferase) (UTase) (EC 2.7.7.59); [Protein-PII]-UMP uridylyl-removing enzyme (UR) (EC 3.1.4.-)] 0.9812 6 157 GO:0004590
GO:0006207
GO:0006808
GO:0008081
GO:0008773
GO:0044205
AF-A0A7C2W2J4-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.979 9 129 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7W1YTC1-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.9771 5 125 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7W2A0E0-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.977 5 172 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Map