F409169

General Info

Members Datasets Scaffolds Average Seq Length
328 151 656 235

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10010520|Ga0081455_100105209
Length 267
Sequence MAHKKGVGSSRNGRDSQAQRLGLKKFGGEHVLGGNILARQRGTKWKPGTNVGLGRDHTIFALIDGKVEFKRRADDRVSAMLRVAKLTGAAGEEQLIRVRNLSAGGLAAIVTHAPEVGARVGVDLSSQSIPSTVVWTRGDVIGLKFDQNVDIGELLAGRKPRHGFRTRPPRLQVTCKASVRIGKLYYTVDVHDISLGGMKVEPIEEYCVGKKVAVVVESFKPVSGEVRWYSERRAGIVFDQPLDFDELAEWVGKRLELASLKASYQKN

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.54
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10010520 3300005937 Bacteria 9377
2 JGI24735J21928_10020087 3300002067 Bacteria 2048
3 Ga0070658_10016089 3300005327 Bacteria 5983
4 Ga0070658_10032724 3300005327 Bacteria 4181
5 Ga0070658_10125696 3300005327 Bacteria 2134
6 Ga0070658_10188832 3300005327 Bacteria 1736
7 Ga0070690_100199007 3300005330 Bacteria 1393
8 Ga0070670_100006142 3300005331 Bacteria 10155
9 Ga0070670_100140792 3300005331 Bacteria 2086
10 Ga0070670_100166813 3300005331 Bacteria 1909
11 Ga0070670_100434635 3300005331 Bacteria 1162
12 Ga0070670_100471897 3300005331 Bacteria 1113
13 Ga0070677_10119050 3300005333 Bacteria 1190
14 Ga0070666_10050123 3300005335 Bacteria 2808
15 Ga0070680_100125064 3300005336 Bacteria 2148
16 Ga0068868_100389121 3300005338 Bacteria 1201
17 Ga0070660_100271415 3300005339 Bacteria 1386
18 Ga0070661_100058234 3300005344 Bacteria 2831
19 Ga0070661_100090700 3300005344 Bacteria 2263
20 Ga0070692_10143770 3300005345 Bacteria 1352
21 Ga0070675_100165305 3300005354 Bacteria 1905
22 Ga0070675_100383390 3300005354 Bacteria 1252
23 Ga0070671_100077041 3300005355 Bacteria 2786
24 Ga0070673_100263458 3300005364 Bacteria 1506
25 Ga0070673_100574791 3300005364 Bacteria 1026
26 Ga0070673_100694749 3300005364 Bacteria 934
27 Ga0070659_100007410 3300005366 Bacteria 7968
28 Ga0070659_100153538 3300005366 Bacteria 1879
29 Ga0070667_100231171 3300005367 Bacteria 1649
30 Ga0070714_100009738 3300005435 Bacteria 7571
31 Ga0070714_100155075 3300005435 Bacteria 2067
32 Ga0070714_100207502 3300005435 Bacteria 1795
33 Ga0070714_100258609 3300005435 Bacteria 1611
34 Ga0070714_100427942 3300005435 Bacteria 1255
35 Ga0070663_100005191 3300005455 Bacteria 7713
36 Ga0070662_100005128 3300005457 Bacteria 8353
37 Ga0070662_100148975 3300005457 Bacteria 1820
38 Ga0070662_100597721 3300005457 Bacteria 928
39 Ga0070681_10741557 3300005458 Bacteria 899
40 Ga0068867_100094198 3300005459 Bacteria 2277
41 Ga0070679_100118290 3300005530 Bacteria 2634
42 Ga0070679_100210640 3300005530 Bacteria 1907
43 Ga0068853_100016759 3300005539 Bacteria 6036
44 Ga0068853_100023524 3300005539 Bacteria 5159
45 Ga0068853_100487357 3300005539 Bacteria 1163
46 Ga0070693_100253939 3300005547 Bacteria 1166
47 Ga0070665_100015013 3300005548 Bacteria 7773
48 Ga0070665_100015126 3300005548 Bacteria 7745
49 Ga0070665_100472759 3300005548 Bacteria 1264
50 Ga0068855_100099732 3300005563 Bacteria 3345
51 Ga0068855_100314985 3300005563 Bacteria 1730
52 Ga0068855_100513000 3300005563 Bacteria 1301
53 Ga0070664_100006486 3300005564 Bacteria 9431
54 Ga0070664_100031466 3300005564 Bacteria 4434
55 Ga0070664_100069831 3300005564 Bacteria 3007
56 Ga0068857_100134342 3300005577 Bacteria 2233
57 Ga0068854_100030702 3300005578 Bacteria 3729
58 Ga0068854_100043251 3300005578 Bacteria 3192
59 Ga0068854_100060737 3300005578 Bacteria 2736
60 Ga0068854_100333583 3300005578 Bacteria 1236
61 Ga0068856_100195516 3300005614 Bacteria 2036
62 Ga0068856_100200496 3300005614 Bacteria 2010
63 Ga0068856_100436603 3300005614 Bacteria 1329
64 Ga0068852_100016531 3300005616 Bacteria 5758
65 Ga0068852_100118059 3300005616 Bacteria 2423
66 Ga0068859_100110667 3300005617 Bacteria 2808
67 Ga0068851_10033213 3300005834 Bacteria 2571
68 Ga0068858_100140360 3300005842 Bacteria 2268
69 Ga0068860_100289726 3300005843 Bacteria 1602
70 Ga0081540_1119335 3300005983 Bacteria 1098
71 Ga0081539_10025824 3300005985 Bacteria 3767
72 Ga0070717_10127862 3300006028 Bacteria 2183
73 Ga0070716_100264338 3300006173 Bacteria 1179
74 Ga0097620_100110671 3300006931 Bacteria 2808
75 Ga0075435_100470057 3300007076 Bacteria 1085
76 Ga0105248_10022148 3300009177 Bacteria 7043
77 Ga0105248_10142031 3300009177 Bacteria 2709
78 Ga0105248_10169689 3300009177 Bacteria 2459
79 Ga0105237_10015648 3300009545 Bacteria 7885
80 Ga0105249_10782894 3300009553 Bacteria 1017
81 Ga0105246_10211362 3300011119 Bacteria 1514
82 Ga0157373_10016764 3300013100 Bacteria 5340
83 Ga0157373_10199362 3300013100 Bacteria 1411
84 Ga0157371_10063718 3300013102 Bacteria 2613
85 Ga0157371_10155817 3300013102 Bacteria 1630
86 Ga0157371_10216629 3300013102 Bacteria 1375
87 Ga0157370_10445548 3300013104 Bacteria 1191
88 Ga0157369_10105327 3300013105 Bacteria 3003
89 Ga0157369_10617152 3300013105 Bacteria 1119
90 Ga0157374_10221666 3300013296 Bacteria 1856
91 Ga0157374_10269742 3300013296 Bacteria 1678
92 Ga0157374_10393104 3300013296 Bacteria 1382
93 Ga0157372_10078892 3300013307 Bacteria 3721
94 Ga0157372_10257185 3300013307 Bacteria 2027
95 Ga0163163_10017276 3300014325 Bacteria 6726
96 Ga0157379_10227571 3300014968 Bacteria 1690
97 Ga0206354_10669789 3300020081 Bacteria 1616
98 Ga0207656_10034906 3300025321 Bacteria 2102
99 Ga0207656_10047253 3300025321 Bacteria 1849
100 Ga0207682_10103392 3300025893 Bacteria 1247
101 Ga0207688_10113779 3300025901 Bacteria 1573
102 Ga0207680_10109733 3300025903 Bacteria 1787
103 Ga0207680_10225775 3300025903 Bacteria 1285
104 Ga0207647_10084694 3300025904 Bacteria 1897
105 Ga0207645_10017940 3300025907 Bacteria 4667
106 Ga0207645_10029614 3300025907 Bacteria 3529
107 Ga0207705_10023115 3300025909 Bacteria 4434
108 Ga0207705_10033411 3300025909 Bacteria 3674
109 Ga0207705_10049517 3300025909 Bacteria 3023
110 Ga0207705_10098595 3300025909 Bacteria 2147
111 Ga0207705_10099093 3300025909 Bacteria 2142
112 Ga0207705_10130039 3300025909 Bacteria 1873
113 Ga0207654_10278390 3300025911 Bacteria 1131
114 Ga0207693_10134864 3300025915 Bacteria 1941
115 Ga0207660_10000776 3300025917 Bacteria 21236
116 Ga0207660_10139235 3300025917 Bacteria 1854
117 Ga0207657_10043664 3300025919 Bacteria 3946
118 Ga0207657_10091621 3300025919 Bacteria 2534
119 Ga0207649_10078010 3300025920 Bacteria 2136
120 Ga0207649_10081914 3300025920 Bacteria 2091
121 Ga0207649_10134725 3300025920 Bacteria 1683
122 Ga0207649_10218973 3300025920 Bacteria 1355
123 Ga0207649_10331363 3300025920 Bacteria 1121
124 Ga0207652_10151054 3300025921 Bacteria 2080
125 Ga0207652_10291389 3300025921 Bacteria 1473
126 Ga0207652_10367884 3300025921 Bacteria 1298
127 Ga0207681_10306809 3300025923 Bacteria 1258
128 Ga0207650_10259588 3300025925 Bacteria 1409
129 Ga0207650_10276528 3300025925 Bacteria 1366
130 Ga0207659_10387583 3300025926 Bacteria 1166
131 Ga0207700_10184074 3300025928 Bacteria 1751
132 Ga0207664_10304722 3300025929 Bacteria 1402
133 Ga0207644_10035979 3300025931 Bacteria 3473
134 Ga0207644_10439540 3300025931 Bacteria 1070
135 Ga0207644_10812872 3300025931 Bacteria 782
136 Ga0207690_10015998 3300025932 Bacteria 4559
137 Ga0207706_10015797 3300025933 Bacteria 6825
138 Ga0207706_10105146 3300025933 Bacteria 2484
139 Ga0207706_10129683 3300025933 Bacteria 2218
140 Ga0207706_10165940 3300025933 Bacteria 1941
141 Ga0207665_10299781 3300025939 Bacteria 1201
142 Ga0207691_10253030 3300025940 Bacteria 1520
143 Ga0207711_10036153 3300025941 Bacteria 4190
144 Ga0207711_10121282 3300025941 Bacteria 2334
145 Ga0207689_10308692 3300025942 Bacteria 1312
146 Ga0207661_10542749 3300025944 Bacteria 1065
147 Ga0207679_10003062 3300025945 Bacteria 10354
148 Ga0207679_10028544 3300025945 Bacteria 3873
149 Ga0207679_10126810 3300025945 Bacteria 2041
150 Ga0207679_10638389 3300025945 Bacteria 962
151 Ga0207679_10663242 3300025945 Bacteria 944
152 Ga0207679_10674999 3300025945 Bacteria 936
153 Ga0207667_10047099 3300025949 Bacteria 4564
154 Ga0207667_10294475 3300025949 Bacteria 1658
155 Ga0207667_10322781 3300025949 Bacteria 1577
156 Ga0207667_10398056 3300025949 Bacteria 1402
157 Ga0207651_10677337 3300025960 Bacteria 907
158 Ga0207668_10112547 3300025972 Bacteria 2045
159 Ga0207640_10024426 3300025981 Bacteria 3646
160 Ga0207640_10038755 3300025981 Bacteria 3010
161 Ga0207640_10122524 3300025981 Bacteria 1866
162 Ga0207640_10206750 3300025981 Bacteria 1492
163 Ga0207640_10441134 3300025981 Bacteria 1070
164 Ga0207658_10029892 3300025986 Bacteria 3853
165 Ga0207658_10319400 3300025986 Bacteria 1344
166 Ga0207677_10048298 3300026023 Bacteria 2865
167 Ga0207677_10296211 3300026023 Bacteria 1334
168 Ga0207703_10060594 3300026035 Bacteria 3095
169 Ga0207703_10223163 3300026035 Bacteria 1686
170 Ga0207639_10026566 3300026041 Bacteria 4207
171 Ga0207678_10041871 3300026067 Bacteria 3970
172 Ga0207678_10059188 3300026067 Bacteria 3296
173 Ga0207702_10009198 3300026078 Bacteria 8307
174 Ga0207702_10242640 3300026078 Bacteria 1689
175 Ga0207702_10382859 3300026078 Bacteria 1353
176 Ga0207702_10568552 3300026078 Bacteria 1110
177 Ga0207641_10030718 3300026088 Bacteria 4451
178 Ga0207641_10066704 3300026088 Bacteria 3080
179 Ga0207648_10133544 3300026089 Bacteria 2185
180 Ga0207676_10045707 3300026095 Bacteria 3384
181 Ga0207674_10002592 3300026116 Bacteria 22773
182 Ga0207674_10004997 3300026116 Bacteria 15853
183 Ga0207698_10011048 3300026142 Bacteria 5838
184 Ga0207698_10203682 3300026142 Bacteria 1774
185 Ga0268266_10299609 3300028379 Bacteria 1499
186 Ga0268265_10309706 3300028380 Bacteria 1425
187 Ga0307408_100030897 3300031548 Bacteria 3724
188 Ga0307405_10033158 3300031731 Bacteria 3060
189 Ga0307413_10033784 3300031824 Bacteria 2916
190 Ga0307413_10339434 3300031824 Bacteria 1155
191 Ga0307413_10398790 3300031824 Bacteria 1077
192 Ga0307410_10018167 3300031852 Bacteria 4243
193 Ga0307410_10041600 3300031852 Bacteria 3032
194 Ga0307410_10179806 3300031852 Bacteria 1601
195 Ga0307406_10030604 3300031901 Bacteria 3270
196 Ga0307407_10037270 3300031903 Bacteria 2686
197 Ga0307409_100071169 3300031995 Bacteria 2764
198 Ga0307409_100134017 3300031995 Bacteria 2122
199 Ga0307409_100165512 3300031995 Bacteria 1940
200 Ga0307409_100210500 3300031995 Bacteria 1747
201 Ga0307416_100102227 3300032002 Bacteria 2498
202 Ga0307416_100573431 3300032002 Bacteria 1205
203 Ga0307414_10075158 3300032004 Bacteria 2451
204 Ga0307414_10281203 3300032004 Bacteria 1398
205 Ga0307414_10472617 3300032004 Bacteria 1104
206 Ga0307411_10010234 3300032005 Bacteria 4986
207 Ga0307411_10052629 3300032005 Bacteria 2663
208 Ga0307411_10243987 3300032005 Bacteria 1408
209 Ga0307411_10280301 3300032005 Bacteria 1326
210 Ga0307411_10399802 3300032005 Bacteria 1135
211 Ga0307415_100077530 3300032126 Bacteria 2360
212 Ga0307415_100083120 3300032126 Bacteria 2293
213 Ga0373941_0095712 3300035115 Bacteria 1026
214 Ga0395899_0000251 3300037312 Bacteria 71228
215 Ga0395899_0002822 3300037312 Bacteria 13996
216 Ga0395899_0008554 3300037312 Bacteria 7885
217 Ga0395899_0183184 3300037312 Bacteria 1469
218 Ga0395899_0291864 3300037312 Bacteria 1106
219 Ga0395899_0360804 3300037312 Bacteria 970
220 Ga0395900_0000084 3300037418 Bacteria 172593
221 Ga0395900_0008482 3300037418 Bacteria 10567
222 Ga0395900_0018720 3300037418 Bacteria 7062
223 Ga0395900_0025891 3300037418 Bacteria 6005
224 Ga0395900_0106238 3300037418 Bacteria 2884
225 Ga0395900_0223462 3300037418 Bacteria 1897
226 Ga0395900_0251777 3300037418 Bacteria 1767
227 Ga0395900_0336660 3300037418 Bacteria 1485
228 Ga0395900_0345783 3300037418 Bacteria 1461
229 Ga0395898_0000021 3300037466 Bacteria 393971
230 Ga0395898_0149356 3300037466 Bacteria 2236
231 Ga0395898_0221477 3300037466 Bacteria 1805
232 Ga0395898_0667865 3300037466 Bacteria 981
233 Ga0395905_0000006 3300037471 Bacteria 549428
234 Ga0395905_0000191 3300037471 Bacteria 97191
235 Ga0395905_0000762 3300037471 Bacteria 42402
236 Ga0395905_0006505 3300037471 Bacteria 11750
237 Ga0395905_0008186 3300037471 Bacteria 10324
238 Ga0395905_0023357 3300037471 Bacteria 5844
239 Ga0395905_0038639 3300037471 Bacteria 4478
240 Ga0395905_0042457 3300037471 Bacteria 4268
241 Ga0395905_0063600 3300037471 Bacteria 3452
242 Ga0395905_0066065 3300037471 Bacteria 3387
243 Ga0395905_0066789 3300037471 Bacteria 3368
244 Ga0395905_0118518 3300037471 Bacteria 2488
245 Ga0395905_0120997 3300037471 Bacteria 2460
246 Ga0395905_0138748 3300037471 Bacteria 2287
247 Ga0395905_0140883 3300037471 Bacteria 2268
248 Ga0395905_0223146 3300037471 Bacteria 1763
249 Ga0395905_0263333 3300037471 Bacteria 1609
250 Ga0395901_0000268 3300038443 Bacteria 64837
251 Ga0395901_0000914 3300038443 Bacteria 32244
252 Ga0395901_0005656 3300038443 Bacteria 12648
253 Ga0395901_0074895 3300038443 Bacteria 3531
254 Ga0395901_0128768 3300038443 Bacteria 2660
255 Ga0395901_0221936 3300038443 Bacteria 1975
256 Ga0395901_0259645 3300038443 Bacteria 1808
257 Ga0395901_0376575 3300038443 Bacteria 1461
258 Ga0466972_0029294 3300044658 Bacteria 2710
259 Ga0466966_0017969 3300044684 Bacteria 4669
260 Ga0466966_0151825 3300044684 Bacteria 1412
261 Ga0466961_0013095 3300044693 Bacteria 5307
262 Ga0466961_0031206 3300044693 Bacteria 3425
263 Ga0466961_0219680 3300044693 Bacteria 1171
264 Ga0466963_0015708 3300044694 Bacteria 4696
265 Ga0466963_0043823 3300044694 Bacteria 2943
266 Ga0466963_0068467 3300044694 Bacteria 2384
267 Ga0466964_0160246 3300044706 Bacteria 1051
268 Ga0466964_0257508 3300044706 Bacteria 863
269 Ga0466971_0068830 3300044719 Bacteria 1605
270 Ga0466971_0076142 3300044719 Bacteria 1526
271 Ga0466970_0056631 3300044765 Bacteria 2095
272 Ga0466970_0097985 3300044765 Bacteria 1595
273 Ga0466970_0175047 3300044765 Bacteria 1190
274 Ga0466970_0330979 3300044765 Bacteria 862
275 Ga0466957_0155894 3300044842 Bacteria 1480
276 Ga0466957_0181634 3300044842 Bacteria 1374
277 Ga0466957_0409168 3300044842 Bacteria 929
278 Ga0466960_0035855 3300044901 Bacteria 2320
279 Ga0466959_0028570 3300045049 Bacteria 4135
280 Ga0466959_0092918 3300045049 Bacteria 2165
281 Ga0466959_0157083 3300045049 Bacteria 1600
282 Ga0466958_0302153 3300045836 Bacteria 1027
283 Ga0466967_0044592 3300045976 Bacteria 3847
284 Ga0466967_0141925 3300045976 Bacteria 2238
285 Ga0466967_0147094 3300045976 Bacteria 2198
286 Ga0466967_0191824 3300045976 Bacteria 1931
287 Ga0466967_0279775 3300045976 Bacteria 1601
288 Ga0466967_0563803 3300045976 Bacteria 1122
289 Ga0495668_0046271 3300046616 Bacteria 2417
290 Ga0495669_0005058 3300046684 Bacteria 5482
291 Ga0495669_0007043 3300046684 Bacteria 4708
292 Ga0495669_0011675 3300046684 Bacteria 3732
293 Ga0495669_0052530 3300046684 Bacteria 1831
294 Ga0495669_0091902 3300046684 Bacteria 1402
295 Ga0495677_0037440 3300047445 Bacteria 1772
296 Ga0496100_0201812 3300048903 Bacteria 1450
297 Ga0496101_0259952 3300048904 Bacteria 1354
298 Ga0496101_0715048 3300048904 Bacteria 791
299 Ga0496102_0023196 3300048905 Bacteria 5508
300 Ga0496102_0151833 3300048905 Bacteria 2177
301 Ga0496103_0097042 3300048906 Bacteria 1863
302 Ga0496104_0134531 3300048907 Bacteria 2375
303 Ga0496104_0206167 3300048907 Bacteria 1878
304 Ga0496106_0153943 3300048909 Bacteria 1814
305 Ga0496106_0304753 3300048909 Bacteria 1278
306 Ga0496107_0078527 3300048910 Bacteria 2405
307 Ga0496107_0120645 3300048910 Bacteria 1931
308 Ga0496107_0138974 3300048910 Bacteria 1795
309 Ga0496108_0000793 3300048911 Bacteria 24615
310 Ga0496108_0006451 3300048911 Bacteria 9508
311 Ga0496109_0008705 3300048912 Bacteria 8640
312 Ga0496110_0006595 3300048913 Bacteria 9221
313 Ga0496110_0034885 3300048913 Bacteria 4361
314 Ga0496110_0214449 3300048913 Bacteria 1750
315 Ga0496111_0111641 3300048914 Bacteria 2013
316 Ga0496111_0454001 3300048914 Bacteria 945
317 Ga0496112_0004593 3300048915 Bacteria 11743
318 Ga0496112_0005215 3300048915 Bacteria 11183
319 Ga0496112_0210936 3300048915 Bacteria 1899
320 Ga0496113_0000713 3300048916 Bacteria 16987
321 Ga0496113_0003362 3300048916 Bacteria 9558
322 Ga0496114_0826027 3300048917 Bacteria 806
323 Ga0496115_0000954 3300048918 Bacteria 20988
324 Ga0501068_0127010 3300049584 Bacteria 1593
325 nmdc:mga06r32_820186_c1 3300050510 Bacteria 890
326 nmdc:mga0n895_388829_c1 3300050512 Bacteria 1411
327 Ga0495655_0064173 3300053083 Bacteria 1010
328 Ga0466962_0011223 3300061719 Bacteria 4314
329 Ga0081455_10010520
330 JGI24735J21928_10020087
331 Ga0070658_10016089
332 Ga0070658_10032724
333 Ga0070658_10125696
334 Ga0070658_10188832
335 Ga0070690_100199007
336 Ga0070670_100006142
337 Ga0070670_100140792
338 Ga0070670_100166813
339 Ga0070670_100434635
340 Ga0070670_100471897
341 Ga0070677_10119050
342 Ga0070666_10050123
343 Ga0070680_100125064
344 Ga0068868_100389121
345 Ga0070660_100271415
346 Ga0070661_100058234
347 Ga0070661_100090700
348 Ga0070692_10143770
349 Ga0070675_100165305
350 Ga0070675_100383390
351 Ga0070671_100077041
352 Ga0070673_100263458
353 Ga0070673_100574791
354 Ga0070673_100694749
355 Ga0070659_100007410
356 Ga0070659_100153538
357 Ga0070667_100231171
358 Ga0070714_100009738
359 Ga0070714_100155075
360 Ga0070714_100207502
361 Ga0070714_100258609
362 Ga0070714_100427942
363 Ga0070663_100005191
364 Ga0070662_100005128
365 Ga0070662_100148975
366 Ga0070662_100597721
367 Ga0070681_10741557
368 Ga0068867_100094198
369 Ga0070679_100118290
370 Ga0070679_100210640
371 Ga0068853_100016759
372 Ga0068853_100023524
373 Ga0068853_100487357
374 Ga0070693_100253939
375 Ga0070665_100015013
376 Ga0070665_100015126
377 Ga0070665_100472759
378 Ga0068855_100099732
379 Ga0068855_100314985
380 Ga0068855_100513000
381 Ga0070664_100006486
382 Ga0070664_100031466
383 Ga0070664_100069831
384 Ga0068857_100134342
385 Ga0068854_100030702
386 Ga0068854_100043251
387 Ga0068854_100060737
388 Ga0068854_100333583
389 Ga0068856_100195516
390 Ga0068856_100200496
391 Ga0068856_100436603
392 Ga0068852_100016531
393 Ga0068852_100118059
394 Ga0068859_100110667
395 Ga0068851_10033213
396 Ga0068858_100140360
397 Ga0068860_100289726
398 Ga0081540_1119335
399 Ga0081539_10025824
400 Ga0070717_10127862
401 Ga0070716_100264338
402 Ga0097620_100110671
403 Ga0075435_100470057
404 Ga0105248_10022148
405 Ga0105248_10142031
406 Ga0105248_10169689
407 Ga0105237_10015648
408 Ga0105249_10782894
409 Ga0105246_10211362
410 Ga0157373_10016764
411 Ga0157373_10199362
412 Ga0157371_10063718
413 Ga0157371_10155817
414 Ga0157371_10216629
415 Ga0157370_10445548
416 Ga0157369_10105327
417 Ga0157369_10617152
418 Ga0157374_10221666
419 Ga0157374_10269742
420 Ga0157374_10393104
421 Ga0157372_10078892
422 Ga0157372_10257185
423 Ga0163163_10017276
424 Ga0157379_10227571
425 Ga0206354_10669789
426 Ga0207656_10034906
427 Ga0207656_10047253
428 Ga0207682_10103392
429 Ga0207688_10113779
430 Ga0207680_10109733
431 Ga0207680_10225775
432 Ga0207647_10084694
433 Ga0207645_10017940
434 Ga0207645_10029614
435 Ga0207705_10023115
436 Ga0207705_10033411
437 Ga0207705_10049517
438 Ga0207705_10098595
439 Ga0207705_10099093
440 Ga0207705_10130039
441 Ga0207654_10278390
442 Ga0207693_10134864
443 Ga0207660_10000776
444 Ga0207660_10139235
445 Ga0207657_10043664
446 Ga0207657_10091621
447 Ga0207649_10078010
448 Ga0207649_10081914
449 Ga0207649_10134725
450 Ga0207649_10218973
451 Ga0207649_10331363
452 Ga0207652_10151054
453 Ga0207652_10291389
454 Ga0207652_10367884
455 Ga0207681_10306809
456 Ga0207650_10259588
457 Ga0207650_10276528
458 Ga0207659_10387583
459 Ga0207700_10184074
460 Ga0207664_10304722
461 Ga0207644_10035979
462 Ga0207644_10439540
463 Ga0207644_10812872
464 Ga0207690_10015998
465 Ga0207706_10015797
466 Ga0207706_10105146
467 Ga0207706_10129683
468 Ga0207706_10165940
469 Ga0207665_10299781
470 Ga0207691_10253030
471 Ga0207711_10036153
472 Ga0207711_10121282
473 Ga0207689_10308692
474 Ga0207661_10542749
475 Ga0207679_10003062
476 Ga0207679_10028544
477 Ga0207679_10126810
478 Ga0207679_10638389
479 Ga0207679_10663242
480 Ga0207679_10674999
481 Ga0207667_10047099
482 Ga0207667_10294475
483 Ga0207667_10322781
484 Ga0207667_10398056
485 Ga0207651_10677337
486 Ga0207668_10112547
487 Ga0207640_10024426
488 Ga0207640_10038755
489 Ga0207640_10122524
490 Ga0207640_10206750
491 Ga0207640_10441134
492 Ga0207658_10029892
493 Ga0207658_10319400
494 Ga0207677_10048298
495 Ga0207677_10296211
496 Ga0207703_10060594
497 Ga0207703_10223163
498 Ga0207639_10026566
499 Ga0207678_10041871
500 Ga0207678_10059188
501 Ga0207702_10009198
502 Ga0207702_10242640
503 Ga0207702_10382859
504 Ga0207702_10568552
505 Ga0207641_10030718
506 Ga0207641_10066704
507 Ga0207648_10133544
508 Ga0207676_10045707
509 Ga0207674_10002592
510 Ga0207674_10004997
511 Ga0207698_10011048
512 Ga0207698_10203682
513 Ga0268266_10299609
514 Ga0268265_10309706
515 Ga0307408_100030897
516 Ga0307405_10033158
517 Ga0307413_10033784
518 Ga0307413_10339434
519 Ga0307413_10398790
520 Ga0307410_10018167
521 Ga0307410_10041600
522 Ga0307410_10179806
523 Ga0307406_10030604
524 Ga0307407_10037270
525 Ga0307409_100071169
526 Ga0307409_100134017
527 Ga0307409_100165512
528 Ga0307409_100210500
529 Ga0307416_100102227
530 Ga0307416_100573431
531 Ga0307414_10075158
532 Ga0307414_10281203
533 Ga0307414_10472617
534 Ga0307411_10010234
535 Ga0307411_10052629
536 Ga0307411_10243987
537 Ga0307411_10280301
538 Ga0307411_10399802
539 Ga0307415_100077530
540 Ga0307415_100083120
541 Ga0373941_0095712
542 Ga0395899_0000251
543 Ga0395899_0002822
544 Ga0395899_0008554
545 Ga0395899_0183184
546 Ga0395899_0291864
547 Ga0395899_0360804
548 Ga0395900_0000084
549 Ga0395900_0008482
550 Ga0395900_0018720
551 Ga0395900_0025891
552 Ga0395900_0106238
553 Ga0395900_0223462
554 Ga0395900_0251777
555 Ga0395900_0336660
556 Ga0395900_0345783
557 Ga0395898_0000021
558 Ga0395898_0149356
559 Ga0395898_0221477
560 Ga0395898_0667865
561 Ga0395905_0000006
562 Ga0395905_0000191
563 Ga0395905_0000762
564 Ga0395905_0006505
565 Ga0395905_0008186
566 Ga0395905_0023357
567 Ga0395905_0038639
568 Ga0395905_0042457
569 Ga0395905_0063600
570 Ga0395905_0066065
571 Ga0395905_0066789
572 Ga0395905_0118518
573 Ga0395905_0120997
574 Ga0395905_0138748
575 Ga0395905_0140883
576 Ga0395905_0223146
577 Ga0395905_0263333
578 Ga0395901_0000268
579 Ga0395901_0000914
580 Ga0395901_0005656
581 Ga0395901_0074895
582 Ga0395901_0128768
583 Ga0395901_0221936
584 Ga0395901_0259645
585 Ga0395901_0376575
586 Ga0466972_0029294
587 Ga0466966_0017969
588 Ga0466966_0151825
589 Ga0466961_0013095
590 Ga0466961_0031206
591 Ga0466961_0219680
592 Ga0466963_0015708
593 Ga0466963_0043823
594 Ga0466963_0068467
595 Ga0466964_0160246
596 Ga0466964_0257508
597 Ga0466971_0068830
598 Ga0466971_0076142
599 Ga0466970_0056631
600 Ga0466970_0097985
601 Ga0466970_0175047
602 Ga0466970_0330979
603 Ga0466957_0155894
604 Ga0466957_0181634
605 Ga0466957_0409168
606 Ga0466960_0035855
607 Ga0466959_0028570
608 Ga0466959_0092918
609 Ga0466959_0157083
610 Ga0466958_0302153
611 Ga0466967_0044592
612 Ga0466967_0141925
613 Ga0466967_0147094
614 Ga0466967_0191824
615 Ga0466967_0279775
616 Ga0466967_0563803
617 Ga0495668_0046271
618 Ga0495669_0005058
619 Ga0495669_0007043
620 Ga0495669_0011675
621 Ga0495669_0052530
622 Ga0495669_0091902
623 Ga0495677_0037440
624 Ga0496100_0201812
625 Ga0496101_0259952
626 Ga0496101_0715048
627 Ga0496102_0023196
628 Ga0496102_0151833
629 Ga0496103_0097042
630 Ga0496104_0134531
631 Ga0496104_0206167
632 Ga0496106_0153943
633 Ga0496106_0304753
634 Ga0496107_0078527
635 Ga0496107_0120645
636 Ga0496107_0138974
637 Ga0496108_0000793
638 Ga0496108_0006451
639 Ga0496109_0008705
640 Ga0496110_0006595
641 Ga0496110_0034885
642 Ga0496110_0214449
643 Ga0496111_0111641
644 Ga0496111_0454001
645 Ga0496112_0004593
646 Ga0496112_0005215
647 Ga0496112_0210936
648 Ga0496113_0000713
649 Ga0496113_0003362
650 Ga0496114_0826027
651 Ga0496115_0000954
652 Ga0501068_0127010
653 nmdc:mga06r32_820186_c1
654 nmdc:mga0n895_388829_c1
655 Ga0495655_0064173
656 Ga0466962_0011223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.94

PF07238

PilZ

PilZ domain

161

252

0.91

PF07238

PilZ

PilZ domain

70

156

0.83

Map