F409041

General Info

Members Datasets Scaffolds Average Seq Length
328 231 656 305

Family's Representative Sequence

Representative Sequence 3300001976|JGI24752J21851_1001593|JGI24752J21851_10015932
Length 350
Sequence MIPWAMSRSPGDGSMVRLWCDLHRRDGAEWRRESGMEXRRPLPHLSGRPVVTDGGLETDLIFHHGVDLPDFAAFPLVDGERGRELLLDYYRDYIGIAVRVGADVQLETPTWRASGDWGDRLGFSAAELXRANRDSVALLDRLRDEVGLESMLVSGCLGPRGDGYSAGDVVDPDSAAAYHTPQIEAFAEAGVDLVTVLTLTGTGEAVGIVRAARAAGLPVAVSFTVEQDGRXPDGTPLSEAITTVDAEAAPDYFMVNCAHPSHIAQALTTAGDWCSRVVGLRANASARSHEELDTATDLDEGDPVELARAQDALRPRLPNLALVGGCCGTDARHVAAMWGDRVLPSAGSSA

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2643221641 Nocardioides sp. Root122 Isolate Unclassified
231 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.3
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 9.45
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001593 3300001976 Bacteria 3053
2 Ga0070683_100016218 3300005329 Bacteria 6564
3 Ga0070670_100015095 3300005331 Bacteria 6629
4 Ga0068869_100216287 3300005334 Bacteria 1517
5 Ga0068869_100338204 3300005334 Bacteria 1224
6 Ga0070680_100021618 3300005336 Bacteria 5116
7 Ga0070682_100008341 3300005337 Bacteria 5841
8 Ga0068868_100006870 3300005338 Bacteria 8081
9 Ga0068868_100228504 3300005338 Bacteria 1560
10 Ga0070660_100006585 3300005339 Bacteria 8060
11 Ga0070689_100073346 3300005340 Bacteria 2677
12 Ga0070661_100016748 3300005344 Bacteria 5188
13 Ga0070675_100015600 3300005354 Bacteria 6011
14 Ga0070671_100002868 3300005355 Bacteria 13415
15 Ga0070659_100012885 3300005366 Bacteria 6214
16 Ga0070659_100080348 3300005366 Bacteria 2603
17 Ga0070667_100035773 3300005367 Bacteria 4161
18 Ga0070709_10000457 3300005434 Bacteria 24352
19 Ga0070714_100004878 3300005435 Bacteria 10183
20 Ga0070714_100013620 3300005435 Bacteria 6520
21 Ga0070713_100004730 3300005436 Bacteria 9203
22 Ga0070713_100047824 3300005436 Bacteria 3518
23 Ga0070713_100166281 3300005436 Bacteria 1972
24 Ga0070710_10000366 3300005437 Bacteria 21196
25 Ga0070711_100007664 3300005439 Bacteria 6574
26 Ga0070663_100080940 3300005455 Bacteria 2386
27 Ga0070678_100007226 3300005456 Bacteria 6572
28 Ga0070678_100260511 3300005456 Bacteria 1458
29 Ga0070706_100276293 3300005467 Bacteria 1568
30 Ga0070679_100050907 3300005530 Bacteria 4126
31 Ga0070684_100050807 3300005535 Bacteria 3602
32 Ga0070684_100070773 3300005535 Bacteria 3070
33 Ga0070697_100103726 3300005536 Bacteria 2364
34 Ga0068853_100049999 3300005539 Bacteria 3595
35 Ga0070672_100073910 3300005543 Bacteria 2718
36 Ga0070686_100107289 3300005544 Bacteria 1896
37 Ga0070693_100012533 3300005547 Bacteria 4292
38 Ga0070693_100292820 3300005547 Bacteria 1094
39 Ga0068855_100447151 3300005563 Bacteria 1411
40 Ga0070664_100028029 3300005564 Bacteria 4684
41 Ga0068857_100199946 3300005577 Bacteria 1822
42 Ga0070702_100040790 3300005615 Bacteria 2599
43 Ga0068852_100021978 3300005616 Bacteria 5106
44 Ga0068852_100148198 3300005616 Bacteria 2179
45 Ga0068852_100253131 3300005616 Bacteria 1688
46 Ga0068864_100082955 3300005618 Bacteria 2814
47 Ga0068861_100327429 3300005719 Bacteria 1336
48 Ga0068851_10011953 3300005834 Bacteria 4082
49 Ga0068870_10000205 3300005840 Bacteria 21167
50 Ga0068863_100000995 3300005841 Bacteria 28447
51 Ga0068860_100000334 3300005843 Bacteria 63958
52 Ga0068860_100059973 3300005843 Bacteria 3616
53 Ga0081538_10008396 3300005981 Bacteria 8776
54 Ga0070717_10045847 3300006028 Bacteria 3575
55 Ga0070717_10138386 3300006028 Bacteria 2098
56 Ga0070717_10301966 3300006028 Bacteria 1423
57 Ga0075365_10027011 3300006038 Bacteria 3648
58 Ga0075365_10052123 3300006038 Bacteria 2705
59 Ga0075365_10167600 3300006038 Bacteria 1533
60 Ga0075365_10175516 3300006038 Bacteria 1497
61 Ga0075368_10001120 3300006042 Bacteria 8444
62 Ga0075363_100044072 3300006048 Bacteria 2362
63 Ga0075363_100052672 3300006048 Bacteria 2173
64 Ga0075364_10024654 3300006051 Bacteria 3821
65 Ga0075364_10107984 3300006051 Bacteria 1856
66 Ga0075364_10210594 3300006051 Bacteria 1318
67 Ga0070716_100002591 3300006173 Bacteria 8356
68 Ga0070712_100018913 3300006175 Bacteria 4483
69 Ga0097621_100208742 3300006237 Bacteria 1698
70 Ga0075370_10004600 3300006353 Bacteria 6729
71 Ga0068871_100011457 3300006358 Bacteria 6504
72 Ga0075428_100008608 3300006844 Bacteria 11317
73 Ga0075430_100010425 3300006846 Bacteria 7866
74 Ga0075431_100016723 3300006847 Bacteria 7449
75 Ga0075431_100099644 3300006847 Bacteria 2998
76 Ga0075431_100525395 3300006847 Bacteria 1172
77 Ga0075434_100005389 3300006871 Bacteria 11639
78 Ga0075429_100026047 3300006880 Bacteria 5076
79 Ga0068865_100022844 3300006881 Bacteria 4087
80 Ga0075436_100040676 3300006914 Bacteria 3207
81 Ga0075435_100001141 3300007076 Bacteria 16946
82 Ga0075435_100005972 3300007076 Bacteria 8568
83 Ga0111539_10029063 3300009094 Bacteria 6740
84 Ga0111539_10118250 3300009094 Bacteria 3106
85 Ga0105245_10000417 3300009098 Bacteria 39694
86 Ga0105245_10003179 3300009098 Bacteria 14679
87 Ga0105247_10006886 3300009101 Bacteria 7001
88 Ga0114129_10003019 3300009147 Bacteria 23602
89 Ga0114129_10244271 3300009147 Bacteria 2412
90 Ga0105243_10125728 3300009148 Bacteria 2168
91 Ga0105243_10144621 3300009148 Bacteria 2033
92 Ga0105241_10001623 3300009174 Bacteria 17142
93 Ga0105237_10142464 3300009545 Bacteria 2391
94 Ga0105238_10281939 3300009551 Bacteria 1643
95 Ga0105249_10066256 3300009553 Bacteria 3324
96 Ga0105239_10016944 3300010375 Bacteria 8054
97 Ga0105239_10025071 3300010375 Bacteria 6569
98 Ga0105246_10001919 3300011119 Bacteria 12524
99 Ga0105246_10015718 3300011119 Bacteria 4783
100 Ga0105246_10175483 3300011119 Bacteria 1645
101 Ga0157373_10031019 3300013100 Bacteria 3847
102 Ga0157371_10008458 3300013102 Bacteria 8193
103 Ga0157370_10013275 3300013104 Bacteria 8490
104 Ga0157370_10479341 3300013104 Bacteria 1143
105 Ga0157369_10011880 3300013105 Bacteria 9891
106 Ga0157374_10002672 3300013296 Bacteria 14999
107 Ga0157372_10001027 3300013307 Bacteria 30507
108 Ga0157372_10332125 3300013307 Bacteria 1770
109 Ga0157375_10122331 3300013308 Bacteria 2714
110 Ga0157375_10169920 3300013308 Bacteria 2327
111 Ga0157375_10226271 3300013308 Bacteria 2029
112 Ga0157375_10521478 3300013308 Bacteria 1351
113 Ga0157375_10846775 3300013308 Bacteria 1061
114 Ga0163163_10037529 3300014325 Bacteria 4714
115 Ga0163163_10056856 3300014325 Bacteria 3867
116 Ga0157380_10026084 3300014326 Bacteria 4436
117 Ga0157377_10005074 3300014745 Bacteria 6150
118 Ga0157379_10007454 3300014968 Bacteria 9473
119 Ga0157376_10285111 3300014969 Bacteria 1557
120 Ga0163161_10091757 3300017792 Bacteria 2248
121 Ga0206356_10323055 3300020070 Bacteria 3087
122 Ga0207656_10086786 3300025321 Bacteria 1415
123 Ga0207692_10009900 3300025898 Bacteria 3996
124 Ga0207699_10000396 3300025906 Bacteria 22569
125 Ga0207643_10000027 3300025908 Bacteria 99423
126 Ga0207705_10062330 3300025909 Bacteria 2693
127 Ga0207684_10382822 3300025910 Bacteria 1210
128 Ga0207693_10007064 3300025915 Bacteria 9267
129 Ga0207663_10010288 3300025916 Bacteria 4973
130 Ga0207660_10114010 3300025917 Bacteria 2038
131 Ga0207694_10204003 3300025924 Bacteria 1609
132 Ga0207650_10004098 3300025925 Bacteria 9951
133 Ga0207687_10026864 3300025927 Bacteria 3857
134 Ga0207700_10002375 3300025928 Bacteria 10823
135 Ga0207700_10068899 3300025928 Bacteria 2713
136 Ga0207700_10128420 3300025928 Bacteria 2066
137 Ga0207664_10003089 3300025929 Bacteria 11060
138 Ga0207644_10024108 3300025931 Bacteria 4174
139 Ga0207686_10089779 3300025934 Bacteria 2026
140 Ga0207686_10169051 3300025934 Bacteria 1540
141 Ga0207704_10389383 3300025938 Bacteria 1096
142 Ga0207665_10000853 3300025939 Bacteria 20605
143 Ga0207711_10213188 3300025941 Bacteria 1764
144 Ga0207689_10002095 3300025942 Bacteria 18817
145 Ga0207689_10091890 3300025942 Bacteria 2493
146 Ga0207661_10007865 3300025944 Bacteria 7598
147 Ga0207661_10139621 3300025944 Bacteria 2084
148 Ga0207661_10270308 3300025944 Bacteria 1517
149 Ga0207679_10002336 3300025945 Bacteria 11666
150 Ga0207640_10028595 3300025981 Bacteria 3410
151 Ga0207658_10078905 3300025986 Bacteria 2517
152 Ga0207677_10220151 3300026023 Bacteria 1522
153 Ga0207677_10220327 3300026023 Bacteria 1521
154 Ga0207703_10060140 3300026035 Bacteria 3106
155 Ga0207639_10182926 3300026041 Bacteria 1784
156 Ga0207678_10013718 3300026067 Bacteria 7119
157 Ga0207708_10016033 3300026075 Bacteria 5628
158 Ga0207702_10000954 3300026078 Bacteria 29749
159 Ga0207702_10424907 3300026078 Bacteria 1286
160 Ga0207641_10030257 3300026088 Bacteria 4484
161 Ga0207676_10226575 3300026095 Bacteria 1668
162 Ga0207676_10553919 3300026095 Bacteria 1099
163 Ga0207674_10007788 3300026116 Bacteria 12460
164 Ga0207675_100221297 3300026118 Bacteria 1824
165 Ga0207683_10000579 3300026121 Bacteria 33913
166 Ga0207698_10168955 3300026142 Bacteria 1923
167 Ga0209813_10005295 3300027866 Bacteria 3122
168 Ga0268264_10014754 3300028381 Bacteria 6418
169 Ga0268264_10294485 3300028381 Bacteria 1525
170 Ga0307513_10087163 3300031456 Bacteria 3197
171 Ga0307509_10017138 3300031507 Bacteria 8348
172 Ga0307406_10047181 3300031901 Bacteria 2714
173 Ga0307409_100122962 3300031995 Bacteria 2202
174 Ga0307507_10058107 3300033179 Bacteria 3635
175 Ga0373934_0006333 3300035086 Bacteria 4387
176 Ga0373934_0024214 3300035086 Bacteria 2347
177 Ga0373936_0037979 3300035113 Bacteria 1924
178 Ga0373945_0133745 3300035116 Bacteria 995
179 Ga0373954_0115531 3300035118 Bacteria 1300
180 Ga0373956_0041907 3300035119 Bacteria 2034
181 Ga0373957_0007004 3300035120 Bacteria 3584
182 Ga0373946_0162275 3300035171 Bacteria 1050
183 Ga0373955_0046471 3300035172 Bacteria 2347
184 Ga0373924_0022813 3300035410 Bacteria 2449
185 Ga0373935_0004410 3300035692 Bacteria 8263
186 Ga0373933_0008309 3300035724 Bacteria 5667
187 Ga0373947_0010502 3300035725 Bacteria 5312
188 Ga0373937_0049077 3300036401 Bacteria 3866
189 Ga0373925_0097376 3300037068 Bacteria 2256
190 Ga0373925_0249919 3300037068 Bacteria 1422
191 Ga0466963_0010698 3300044694 Bacteria 5567
192 Ga0466970_0014704 3300044765 Bacteria 4020
193 Ga0451576_0378322 3300045051 Bacteria 1484
194 Ga0466967_0055191 3300045976 Bacteria 3499
195 Ga0466967_0147049 3300045976 Bacteria 2199
196 Ga0495592_0051349 3300046454 Bacteria 3062
197 Ga0495592_0069401 3300046454 Bacteria 2570
198 Ga0495592_0098836 3300046454 Bacteria 2083
199 Ga0495629_0174799 3300046459 Bacteria 1489
200 Ga0495641_0032571 3300046461 Bacteria 2479
201 Ga0495651_0041728 3300046462 Bacteria 3563
202 Ga0495651_0199650 3300046462 Bacteria 1400
203 Ga0495651_0238211 3300046462 Bacteria 1249
204 Ga0495653_0005604 3300046463 Bacteria 10244
205 Ga0495653_0067581 3300046463 Bacteria 2683
206 Ga0495582_0228341 3300046473 Bacteria 1066
207 Ga0495639_0030517 3300046475 Bacteria 2396
208 Ga0495662_0002130 3300046476 Bacteria 9925
209 Ga0495664_0062746 3300046477 Bacteria 2213
210 Ga0495608_0023061 3300046511 Bacteria 4267
211 Ga0495608_0170680 3300046511 Bacteria 1380
212 Ga0495618_0038884 3300046514 Bacteria 2990
213 Ga0495652_0281183 3300046529 Bacteria 1218
214 Ga0495586_0026645 3300046535 Bacteria 3093
215 Ga0495587_0066919 3300046536 Bacteria 2094
216 Ga0495645_0267392 3300046543 Bacteria 1129
217 Ga0495667_0044771 3300046559 Bacteria 2930
218 Ga0495667_0158096 3300046559 Bacteria 1458
219 Ga0495657_0090694 3300046675 Bacteria 1961
220 Ga0495623_0005601 3300046679 Bacteria 8199
221 Ga0495623_0184319 3300046679 Bacteria 1210
222 Ga0495646_0045552 3300046680 Bacteria 2678
223 Ga0495658_0017947 3300046683 Bacteria 3669
224 Ga0495613_0265545 3300046689 Bacteria 1194
225 Ga0495624_0025372 3300046690 Bacteria 3892
226 Ga0495600_0024652 3300046809 Bacteria 3872
227 Ga0495600_0084097 3300046809 Bacteria 2077
228 Ga0495581_0033949 3300047315 Bacteria 2952
229 Ga0495604_0074918 3300047317 Bacteria 2549
230 Ga0495604_0077101 3300047317 Bacteria 2506
231 Ga0495604_0099884 3300047317 Bacteria 2135
232 Ga0495674_0046329 3300047319 Bacteria 3859
233 Ga0495680_0022280 3300047322 Bacteria 5283
234 Ga0495680_0074017 3300047322 Bacteria 2587
235 Ga0495675_0021809 3300047444 Bacteria 4080
236 Ga0495684_0028361 3300047471 Bacteria 4298
237 Ga0495593_0004490 3300047673 Bacteria 8288
238 Ga0495593_0092466 3300047673 Bacteria 1557
239 Ga0495602_0061775 3300048088 Bacteria 3255
240 Ga0495602_0126389 3300048088 Bacteria 2047
241 Ga0495614_0081588 3300048089 Bacteria 1401
242 Ga0496100_0060989 3300048903 Bacteria 2484
243 Ga0496101_0072478 3300048904 Bacteria 2528
244 Ga0496101_0120869 3300048904 Bacteria 1980
245 Ga0496101_0124167 3300048904 Bacteria 1955
246 Ga0496102_0027121 3300048905 Bacteria 5115
247 Ga0496102_0046484 3300048905 Bacteria 3943
248 Ga0496102_0100776 3300048905 Bacteria 2683
249 Ga0496102_0157945 3300048905 Bacteria 2132
250 Ga0496104_0001624 3300048907 Bacteria 19409
251 Ga0496105_0010789 3300048908 Bacteria 7195
252 Ga0496105_0109644 3300048908 Bacteria 2279
253 Ga0496106_0004722 3300048909 Bacteria 10088
254 Ga0496106_0184950 3300048909 Bacteria 1655
255 Ga0496108_0004002 3300048911 Bacteria 11821
256 Ga0496108_0008265 3300048911 Bacteria 8442
257 Ga0496108_0038220 3300048911 Bacteria 3999
258 Ga0496108_0081214 3300048911 Bacteria 2747
259 Ga0496109_0023621 3300048912 Bacteria 5458
260 Ga0496109_0073569 3300048912 Bacteria 3140
261 Ga0496109_0081060 3300048912 Bacteria 2990
262 Ga0496109_0149778 3300048912 Bacteria 2184
263 Ga0496110_0009349 3300048913 Bacteria 7931
264 Ga0496110_0020660 3300048913 Bacteria 5562
265 Ga0496111_0022669 3300048914 Bacteria 4399
266 Ga0496111_0099537 3300048914 Bacteria 2135
267 Ga0496114_0014922 3300048917 Bacteria 6244
268 Ga0496114_0087311 3300048917 Bacteria 2644
269 Ga0496114_0133362 3300048917 Bacteria 2147
270 Ga0496114_0173046 3300048917 Bacteria 1882
271 Ga0496115_0010969 3300048918 Bacteria 6786
272 Ga0496115_0390399 3300048918 Bacteria 1130
273 Ga0496119_0078369 3300048922 Bacteria 1911
274 Ga0496121_0007525 3300048924 Bacteria 13137
275 Ga0496126_0000006 3300048929 Bacteria 798804
276 Ga0496126_0375357 3300048929 Bacteria 1159
277 Ga0501031_0089235 3300049568 Bacteria 2010
278 Ga0501036_0088766 3300049572 Bacteria 2612
279 Ga0501036_0445530 3300049572 Bacteria 1079
280 Ga0501038_0005343 3300049574 Bacteria 11928
281 Ga0501038_0136080 3300049574 Bacteria 2013
282 Ga0501039_0004906 3300049575 Bacteria 10134
283 Ga0501040_0028584 3300049576 Bacteria 3760
284 Ga0501040_0035011 3300049576 Bacteria 3403
285 Ga0501041_0234882 3300049577 Bacteria 1151
286 Ga0501042_0046695 3300049578 Bacteria 3087
287 Ga0501043_0030544 3300049579 Bacteria 4235
288 Ga0501048_0012227 3300049582 Bacteria 6390
289 Ga0501067_0070577 3300049583 Bacteria 1934
290 Ga0501070_0216162 3300049586 Bacteria 1573
291 Ga0501071_0023985 3300049587 Bacteria 4264
292 Ga0501071_0048918 3300049587 Bacteria 3042
293 Ga0501072_0008498 3300049588 Bacteria 7791
294 Ga0501072_0170233 3300049588 Bacteria 1738
295 Ga0501076_0058564 3300049592 Bacteria 3062
296 Ga0501077_0009624 3300049593 Bacteria 6009
297 Ga0501079_0162176 3300049741 Bacteria 1743
298 Ga0501035_0089714 3300049822 Bacteria 2707
299 Ga0501045_0075382 3300049824 Bacteria 2485
300 nmdc:mga00v17_101121_c1 3300050491 Bacteria 1820
301 nmdc:mga00v17_110842_c1 3300050491 Bacteria 1741
302 nmdc:mga00v17_23946_c1 3300050491 Bacteria 3537
303 nmdc:mga0yw44_117431_c1 3300050492 Bacteria 1711
304 nmdc:mga0yw44_270700_c1 3300050492 Bacteria 1134
305 nmdc:mga04h51_5141_c1 3300050495 Bacteria 3317
306 nmdc:mga07m45_24903_c1 3300050496 Bacteria 3280
307 nmdc:mga05p37_200942_c1 3300050507 Bacteria 2414
308 nmdc:mga05p37_2429_c1 3300050507 Bacteria 21673
309 nmdc:mga09592_116452_c1 3300050508 Bacteria 2293
310 nmdc:mga09592_33643_c1 3300050508 Bacteria 4281
311 nmdc:mga0qj67_14681_c1 3300050509 Bacteria 5922
312 nmdc:mga06r32_308385_c1 3300050510 Bacteria 1568
313 nmdc:mga06r32_7876_c1 3300050510 Bacteria 9575
314 nmdc:mga06r32_84719_c1 3300050510 Bacteria 3090
315 nmdc:mga08y16_88753_c1 3300050511 Bacteria 3222
316 nmdc:mga0n895_197373_c1 3300050512 Bacteria 2044
317 nmdc:mga0rr50_28057_c1 3300050513 Bacteria 3952
318 nmdc:mga0a205_200500_c1 3300050515 Bacteria 1886
319 Ga0495601_0064991 3300053077 Bacteria 2321
320 Ga0495612_0050637 3300053078 Bacteria 1706
321 Ga0495595_0005096 3300053084 Bacteria 5309
322 Ga0495619_0081536 3300053085 Bacteria 2178
323 Ga0501084_0220706 3300054114 Bacteria 1600
324 Ga0501082_0202858 3300060353 Bacteria 1725
325 Ga0501082_0247002 3300060353 Bacteria 1553
326 Ga0530510_0124744 3300061734 Bacteria 1892
327 2644227978 2643221641 Bacteria 4490190
328 2740165482 2739367898 Bacteria 4367674
329 JGI24752J21851_1001593
330 Ga0070683_100016218
331 Ga0070670_100015095
332 Ga0068869_100216287
333 Ga0068869_100338204
334 Ga0070680_100021618
335 Ga0070682_100008341
336 Ga0068868_100006870
337 Ga0068868_100228504
338 Ga0070660_100006585
339 Ga0070689_100073346
340 Ga0070661_100016748
341 Ga0070675_100015600
342 Ga0070671_100002868
343 Ga0070659_100012885
344 Ga0070659_100080348
345 Ga0070667_100035773
346 Ga0070709_10000457
347 Ga0070714_100004878
348 Ga0070714_100013620
349 Ga0070713_100004730
350 Ga0070713_100047824
351 Ga0070713_100166281
352 Ga0070710_10000366
353 Ga0070711_100007664
354 Ga0070663_100080940
355 Ga0070678_100007226
356 Ga0070678_100260511
357 Ga0070706_100276293
358 Ga0070679_100050907
359 Ga0070684_100050807
360 Ga0070684_100070773
361 Ga0070697_100103726
362 Ga0068853_100049999
363 Ga0070672_100073910
364 Ga0070686_100107289
365 Ga0070693_100012533
366 Ga0070693_100292820
367 Ga0068855_100447151
368 Ga0070664_100028029
369 Ga0068857_100199946
370 Ga0070702_100040790
371 Ga0068852_100021978
372 Ga0068852_100148198
373 Ga0068852_100253131
374 Ga0068864_100082955
375 Ga0068861_100327429
376 Ga0068851_10011953
377 Ga0068870_10000205
378 Ga0068863_100000995
379 Ga0068860_100000334
380 Ga0068860_100059973
381 Ga0081538_10008396
382 Ga0070717_10045847
383 Ga0070717_10138386
384 Ga0070717_10301966
385 Ga0075365_10027011
386 Ga0075365_10052123
387 Ga0075365_10167600
388 Ga0075365_10175516
389 Ga0075368_10001120
390 Ga0075363_100044072
391 Ga0075363_100052672
392 Ga0075364_10024654
393 Ga0075364_10107984
394 Ga0075364_10210594
395 Ga0070716_100002591
396 Ga0070712_100018913
397 Ga0097621_100208742
398 Ga0075370_10004600
399 Ga0068871_100011457
400 Ga0075428_100008608
401 Ga0075430_100010425
402 Ga0075431_100016723
403 Ga0075431_100099644
404 Ga0075431_100525395
405 Ga0075434_100005389
406 Ga0075429_100026047
407 Ga0068865_100022844
408 Ga0075436_100040676
409 Ga0075435_100001141
410 Ga0075435_100005972
411 Ga0111539_10029063
412 Ga0111539_10118250
413 Ga0105245_10000417
414 Ga0105245_10003179
415 Ga0105247_10006886
416 Ga0114129_10003019
417 Ga0114129_10244271
418 Ga0105243_10125728
419 Ga0105243_10144621
420 Ga0105241_10001623
421 Ga0105237_10142464
422 Ga0105238_10281939
423 Ga0105249_10066256
424 Ga0105239_10016944
425 Ga0105239_10025071
426 Ga0105246_10001919
427 Ga0105246_10015718
428 Ga0105246_10175483
429 Ga0157373_10031019
430 Ga0157371_10008458
431 Ga0157370_10013275
432 Ga0157370_10479341
433 Ga0157369_10011880
434 Ga0157374_10002672
435 Ga0157372_10001027
436 Ga0157372_10332125
437 Ga0157375_10122331
438 Ga0157375_10169920
439 Ga0157375_10226271
440 Ga0157375_10521478
441 Ga0157375_10846775
442 Ga0163163_10037529
443 Ga0163163_10056856
444 Ga0157380_10026084
445 Ga0157377_10005074
446 Ga0157379_10007454
447 Ga0157376_10285111
448 Ga0163161_10091757
449 Ga0206356_10323055
450 Ga0207656_10086786
451 Ga0207692_10009900
452 Ga0207699_10000396
453 Ga0207643_10000027
454 Ga0207705_10062330
455 Ga0207684_10382822
456 Ga0207693_10007064
457 Ga0207663_10010288
458 Ga0207660_10114010
459 Ga0207694_10204003
460 Ga0207650_10004098
461 Ga0207687_10026864
462 Ga0207700_10002375
463 Ga0207700_10068899
464 Ga0207700_10128420
465 Ga0207664_10003089
466 Ga0207644_10024108
467 Ga0207686_10089779
468 Ga0207686_10169051
469 Ga0207704_10389383
470 Ga0207665_10000853
471 Ga0207711_10213188
472 Ga0207689_10002095
473 Ga0207689_10091890
474 Ga0207661_10007865
475 Ga0207661_10139621
476 Ga0207661_10270308
477 Ga0207679_10002336
478 Ga0207640_10028595
479 Ga0207658_10078905
480 Ga0207677_10220151
481 Ga0207677_10220327
482 Ga0207703_10060140
483 Ga0207639_10182926
484 Ga0207678_10013718
485 Ga0207708_10016033
486 Ga0207702_10000954
487 Ga0207702_10424907
488 Ga0207641_10030257
489 Ga0207676_10226575
490 Ga0207676_10553919
491 Ga0207674_10007788
492 Ga0207675_100221297
493 Ga0207683_10000579
494 Ga0207698_10168955
495 Ga0209813_10005295
496 Ga0268264_10014754
497 Ga0268264_10294485
498 Ga0307513_10087163
499 Ga0307509_10017138
500 Ga0307406_10047181
501 Ga0307409_100122962
502 Ga0307507_10058107
503 Ga0373934_0006333
504 Ga0373934_0024214
505 Ga0373936_0037979
506 Ga0373945_0133745
507 Ga0373954_0115531
508 Ga0373956_0041907
509 Ga0373957_0007004
510 Ga0373946_0162275
511 Ga0373955_0046471
512 Ga0373924_0022813
513 Ga0373935_0004410
514 Ga0373933_0008309
515 Ga0373947_0010502
516 Ga0373937_0049077
517 Ga0373925_0097376
518 Ga0373925_0249919
519 Ga0466963_0010698
520 Ga0466970_0014704
521 Ga0451576_0378322
522 Ga0466967_0055191
523 Ga0466967_0147049
524 Ga0495592_0051349
525 Ga0495592_0069401
526 Ga0495592_0098836
527 Ga0495629_0174799
528 Ga0495641_0032571
529 Ga0495651_0041728
530 Ga0495651_0199650
531 Ga0495651_0238211
532 Ga0495653_0005604
533 Ga0495653_0067581
534 Ga0495582_0228341
535 Ga0495639_0030517
536 Ga0495662_0002130
537 Ga0495664_0062746
538 Ga0495608_0023061
539 Ga0495608_0170680
540 Ga0495618_0038884
541 Ga0495652_0281183
542 Ga0495586_0026645
543 Ga0495587_0066919
544 Ga0495645_0267392
545 Ga0495667_0044771
546 Ga0495667_0158096
547 Ga0495657_0090694
548 Ga0495623_0005601
549 Ga0495623_0184319
550 Ga0495646_0045552
551 Ga0495658_0017947
552 Ga0495613_0265545
553 Ga0495624_0025372
554 Ga0495600_0024652
555 Ga0495600_0084097
556 Ga0495581_0033949
557 Ga0495604_0074918
558 Ga0495604_0077101
559 Ga0495604_0099884
560 Ga0495674_0046329
561 Ga0495680_0022280
562 Ga0495680_0074017
563 Ga0495675_0021809
564 Ga0495684_0028361
565 Ga0495593_0004490
566 Ga0495593_0092466
567 Ga0495602_0061775
568 Ga0495602_0126389
569 Ga0495614_0081588
570 Ga0496100_0060989
571 Ga0496101_0072478
572 Ga0496101_0120869
573 Ga0496101_0124167
574 Ga0496102_0027121
575 Ga0496102_0046484
576 Ga0496102_0100776
577 Ga0496102_0157945
578 Ga0496104_0001624
579 Ga0496105_0010789
580 Ga0496105_0109644
581 Ga0496106_0004722
582 Ga0496106_0184950
583 Ga0496108_0004002
584 Ga0496108_0008265
585 Ga0496108_0038220
586 Ga0496108_0081214
587 Ga0496109_0023621
588 Ga0496109_0073569
589 Ga0496109_0081060
590 Ga0496109_0149778
591 Ga0496110_0009349
592 Ga0496110_0020660
593 Ga0496111_0022669
594 Ga0496111_0099537
595 Ga0496114_0014922
596 Ga0496114_0087311
597 Ga0496114_0133362
598 Ga0496114_0173046
599 Ga0496115_0010969
600 Ga0496115_0390399
601 Ga0496119_0078369
602 Ga0496121_0007525
603 Ga0496126_0000006
604 Ga0496126_0375357
605 Ga0501031_0089235
606 Ga0501036_0088766
607 Ga0501036_0445530
608 Ga0501038_0005343
609 Ga0501038_0136080
610 Ga0501039_0004906
611 Ga0501040_0028584
612 Ga0501040_0035011
613 Ga0501041_0234882
614 Ga0501042_0046695
615 Ga0501043_0030544
616 Ga0501048_0012227
617 Ga0501067_0070577
618 Ga0501070_0216162
619 Ga0501071_0023985
620 Ga0501071_0048918
621 Ga0501072_0008498
622 Ga0501072_0170233
623 Ga0501076_0058564
624 Ga0501077_0009624
625 Ga0501079_0162176
626 Ga0501035_0089714
627 Ga0501045_0075382
628 nmdc:mga00v17_101121_c1
629 nmdc:mga00v17_110842_c1
630 nmdc:mga00v17_23946_c1
631 nmdc:mga0yw44_117431_c1
632 nmdc:mga0yw44_270700_c1
633 nmdc:mga04h51_5141_c1
634 nmdc:mga07m45_24903_c1
635 nmdc:mga05p37_200942_c1
636 nmdc:mga05p37_2429_c1
637 nmdc:mga09592_116452_c1
638 nmdc:mga09592_33643_c1
639 nmdc:mga0qj67_14681_c1
640 nmdc:mga06r32_308385_c1
641 nmdc:mga06r32_7876_c1
642 nmdc:mga06r32_84719_c1
643 nmdc:mga08y16_88753_c1
644 nmdc:mga0n895_197373_c1
645 nmdc:mga0rr50_28057_c1
646 nmdc:mga0a205_200500_c1
647 Ga0495601_0064991
648 Ga0495612_0050637
649 Ga0495595_0005096
650 Ga0495619_0081536
651 Ga0501084_0220706
652 Ga0501082_0202858
653 Ga0501082_0247002
654 Ga0530510_0124744
655 2644227978
656 2740165482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02574

S-methyl_trans

Homocysteine S-methyltransferase

50

339

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q8j-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) 0.8314 44 341
1q7q-assembly1.cif.gz_A cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) 0.8279 44 332
3bol-assembly1.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ 0.8264 44 341
1q8a-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+:l-hcy complex, se-met) 0.813 44 341
1q85-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) 0.8106 44 341
ID Description Score Start End Superfamily
1q85B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8225 44 341 3.20.20.330
af_O53185_2_293_3.20.20.330 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8067 47 334 3.20.20.330
af_F1QF71_1_302_3.20.20.330 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8034 46 335 3.20.20.330
5dmlA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.803 48 336 3.20.20.330
4m3pA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.7871 45 334 3.20.20.330
ID Description Score Start End GO Terms
AF-A0A3S0ZPK7-F1-model_v4 deleted 0.9827 47 336
AF-R7YPN2-F1-model_v4 Hcy-binding domain-containing protein 0.9709 41 334 GO:0008168
GO:0032259
GO:0046872
AF-A0A4R4WVU8-F1-model_v4 Homocysteine S-methyltransferase 0.9708 39 342 GO:0008168
GO:0032259
GO:0046872
AF-A0A496Q0X3-F1-model_v4 Homocysteine S-methyltransferase 0.9704 40 252 GO:0008168
GO:0032259
AF-A0A815KMP1-F1-model_v4 Hcy-binding domain-containing protein 0.9701 96 337 GO:0008168
GO:0032259
GO:0046872

Map