F408838
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 169 | 327 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10029551|Ga0265338_100295514 |
| Length | 305 |
| Sequence | MLLQRAALSKPNKSSAAPRLRVSPFLLWTGLERRMDSLDVSIRKADEDRYFAALFAPADRRGGLFALYALNHELARIAETVREPMMGAIRLQWWRETIECARAGNPREHPVALALAELFKRHDLPQSLFDTMIDAREMDAAVHIFPDLPALENYADATSGNLMRLAGRLLGGADDNLAREVGIAYALTGILRAIPFHAARGKVYLPEDLLRAAGTSQADLIGTHSGKKLAPVIARVANAARAHFAKARAFRPPKQALSAFLPAATAPLYLKRVTPPNFDAFKDEVSVPLFRRQLAMLRANWRGRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 137 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 163 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 164 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 165 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 167 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.67 |
| Nodule | 0 |
| Rhizoplane | 0.31 |
| Rhizosphere | 94.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000425 | 3300003214 | Bacteria | 43589 |
| 2 | JGI25153J46596_10001493 | 3300003215 | Bacteria | 13955 |
| 3 | rootH2_10051869 | 3300003320 | Bacteria | 8526 |
| 4 | Ga0070658_10005088 | 3300005327 | Bacteria | 10697 |
| 5 | Ga0070658_10040543 | 3300005327 | Bacteria | 3757 |
| 6 | Ga0070658_10316312 | 3300005327 | Bacteria | 1332 |
| 7 | Ga0070683_100280983 | 3300005329 | Bacteria | 1583 |
| 8 | Ga0070690_100130982 | 3300005330 | Bacteria | 1694 |
| 9 | Ga0068869_100003098 | 3300005334 | Bacteria | 10135 |
| 10 | Ga0070666_10095697 | 3300005335 | Bacteria | 2044 |
| 11 | Ga0070680_100008480 | 3300005336 | Bacteria | 7870 |
| 12 | Ga0068868_100129718 | 3300005338 | Bacteria | 2062 |
| 13 | Ga0068868_100199032 | 3300005338 | Bacteria | 1669 |
| 14 | Ga0068868_100228678 | 3300005338 | Bacteria | 1560 |
| 15 | Ga0070661_100184497 | 3300005344 | Bacteria | 1589 |
| 16 | Ga0070675_100027852 | 3300005354 | Bacteria | 4543 |
| 17 | Ga0070671_100188351 | 3300005355 | Bacteria | 1748 |
| 18 | Ga0070673_100061252 | 3300005364 | Bacteria | 2985 |
| 19 | Ga0070673_100121434 | 3300005364 | Bacteria | 2180 |
| 20 | Ga0070659_100014081 | 3300005366 | Bacteria | 5969 |
| 21 | Ga0070667_100088412 | 3300005367 | Bacteria | 2660 |
| 22 | Ga0070667_100242811 | 3300005367 | Bacteria | 1609 |
| 23 | Ga0070709_10005845 | 3300005434 | Bacteria | 6671 |
| 24 | Ga0070714_100014233 | 3300005435 | Bacteria | 6388 |
| 25 | Ga0070714_100016661 | 3300005435 | Bacteria | 5940 |
| 26 | Ga0070713_100000003 | 3300005436 | Bacteria | 245840 |
| 27 | Ga0070713_100060003 | 3300005436 | Bacteria | 3179 |
| 28 | Ga0070711_100148170 | 3300005439 | Bacteria | 1767 |
| 29 | Ga0070705_100089673 | 3300005440 | Bacteria | 1912 |
| 30 | Ga0070663_100117198 | 3300005455 | Bacteria | 2008 |
| 31 | Ga0070678_100013030 | 3300005456 | Bacteria | 5196 |
| 32 | Ga0070678_100053499 | 3300005456 | Bacteria | 2936 |
| 33 | Ga0070678_100229984 | 3300005456 | Bacteria | 1545 |
| 34 | Ga0070681_10047413 | 3300005458 | Bacteria | 4295 |
| 35 | Ga0070681_10296172 | 3300005458 | Bacteria | 1528 |
| 36 | Ga0068867_100044290 | 3300005459 | Bacteria | 3260 |
| 37 | Ga0068867_100066650 | 3300005459 | Bacteria | 2682 |
| 38 | Ga0068867_100167130 | 3300005459 | Bacteria | 1739 |
| 39 | Ga0070679_100009547 | 3300005530 | Bacteria | 9177 |
| 40 | Ga0070679_100379375 | 3300005530 | Bacteria | 1361 |
| 41 | Ga0068853_100372377 | 3300005539 | Bacteria | 1333 |
| 42 | Ga0068853_100507117 | 3300005539 | Bacteria | 1139 |
| 43 | Ga0070693_100181581 | 3300005547 | Bacteria | 1355 |
| 44 | Ga0070693_100260168 | 3300005547 | Unclassified | 1154 |
| 45 | Ga0070665_100010246 | 3300005548 | Bacteria | 9485 |
| 46 | Ga0070665_100012139 | 3300005548 | Bacteria | 8688 |
| 47 | Ga0070665_100022755 | 3300005548 | Bacteria | 6309 |
| 48 | Ga0070665_100039508 | 3300005548 | Bacteria | 4744 |
| 49 | Ga0070665_100206836 | 3300005548 | Bacteria | 1963 |
| 50 | Ga0068855_100015988 | 3300005563 | Bacteria | 9025 |
| 51 | Ga0068855_100027286 | 3300005563 | Bacteria | 6833 |
| 52 | Ga0068855_100039414 | 3300005563 | Bacteria | 5608 |
| 53 | Ga0068855_100217105 | 3300005563 | Bacteria | 2146 |
| 54 | Ga0068855_100276838 | 3300005563 | Bacteria | 1865 |
| 55 | Ga0068855_100301691 | 3300005563 | Bacteria | 1774 |
| 56 | Ga0068855_100506991 | 3300005563 | Unclassified | 1310 |
| 57 | Ga0068857_100112291 | 3300005577 | Bacteria | 2450 |
| 58 | Ga0068854_100193652 | 3300005578 | Bacteria | 1594 |
| 59 | Ga0068854_100237046 | 3300005578 | Bacteria | 1451 |
| 60 | Ga0068856_100001113 | 3300005614 | Bacteria | 28416 |
| 61 | Ga0068856_100041021 | 3300005614 | Bacteria | 4548 |
| 62 | Ga0068856_100097797 | 3300005614 | Bacteria | 2924 |
| 63 | Ga0068856_100601429 | 3300005614 | Bacteria | 1121 |
| 64 | Ga0068852_100283528 | 3300005616 | Bacteria | 1598 |
| 65 | Ga0068864_100137354 | 3300005618 | Bacteria | 2202 |
| 66 | Ga0068858_100084440 | 3300005842 | Bacteria | 2953 |
| 67 | Ga0068858_100109083 | 3300005842 | Bacteria | 2584 |
| 68 | Ga0068860_100265301 | 3300005843 | Bacteria | 1675 |
| 69 | Ga0068860_100421846 | 3300005843 | Bacteria | 1323 |
| 70 | Ga0068860_100628635 | 3300005843 | Bacteria | 1081 |
| 71 | Ga0068862_100769798 | 3300005844 | Unclassified | 938 |
| 72 | Ga0070716_100044338 | 3300006173 | Bacteria | 2491 |
| 73 | Ga0070712_100022190 | 3300006175 | Bacteria | 4178 |
| 74 | Ga0097621_100164788 | 3300006237 | Bacteria | 1908 |
| 75 | Ga0068871_100169865 | 3300006358 | Bacteria | 1869 |
| 76 | Ga0075434_100011244 | 3300006871 | Bacteria | 8429 |
| 77 | Ga0068865_100079489 | 3300006881 | Bacteria | 2349 |
| 78 | Ga0068865_100151435 | 3300006881 | Bacteria | 1760 |
| 79 | Ga0075436_100000113 | 3300006914 | Bacteria | 47637 |
| 80 | Ga0105240_10047018 | 3300009093 | Bacteria | 5463 |
| 81 | Ga0105240_10088737 | 3300009093 | Bacteria | 3783 |
| 82 | Ga0105240_10148130 | 3300009093 | Bacteria | 2799 |
| 83 | Ga0105240_10203160 | 3300009093 | Bacteria | 2321 |
| 84 | Ga0105240_10206642 | 3300009093 | Bacteria | 2298 |
| 85 | Ga0105240_10234348 | 3300009093 | Bacteria | 2131 |
| 86 | Ga0105240_10239666 | 3300009093 | Bacteria | 2103 |
| 87 | Ga0105240_10270712 | 3300009093 | Bacteria | 1956 |
| 88 | Ga0105245_10077869 | 3300009098 | Bacteria | 3024 |
| 89 | Ga0105245_10202067 | 3300009098 | Bacteria | 1909 |
| 90 | Ga0105243_10003266 | 3300009148 | Bacteria | 13205 |
| 91 | Ga0105241_10012391 | 3300009174 | Bacteria | 6248 |
| 92 | Ga0105241_10196294 | 3300009174 | Bacteria | 1683 |
| 93 | Ga0105241_10439939 | 3300009174 | Bacteria | 1151 |
| 94 | Ga0105242_10027852 | 3300009176 | Bacteria | 4492 |
| 95 | Ga0105248_10030181 | 3300009177 | Bacteria | 6052 |
| 96 | Ga0105248_10240051 | 3300009177 | Bacteria | 2040 |
| 97 | Ga0105237_10038275 | 3300009545 | Bacteria | 4843 |
| 98 | Ga0105237_10044881 | 3300009545 | Bacteria | 4450 |
| 99 | Ga0105237_10123972 | 3300009545 | Bacteria | 2578 |
| 100 | Ga0105238_10033513 | 3300009551 | Bacteria | 5227 |
| 101 | Ga0105238_10044290 | 3300009551 | Bacteria | 4499 |
| 102 | Ga0105238_10232963 | 3300009551 | Bacteria | 1818 |
| 103 | Ga0105238_10713926 | 3300009551 | Bacteria | 1015 |
| 104 | Ga0105239_10058604 | 3300010375 | Bacteria | 4226 |
| 105 | Ga0105239_10097850 | 3300010375 | Bacteria | 3243 |
| 106 | Ga0105239_10106173 | 3300010375 | Bacteria | 3111 |
| 107 | Ga0105239_10270660 | 3300010375 | Bacteria | 1910 |
| 108 | Ga0105239_10791691 | 3300010375 | Bacteria | 1086 |
| 109 | Ga0105246_10014991 | 3300011119 | Bacteria | 4884 |
| 110 | Ga0105246_10031519 | 3300011119 | Bacteria | 3509 |
| 111 | Ga0157370_10020121 | 3300013104 | Bacteria | 6673 |
| 112 | Ga0157370_10029941 | 3300013104 | Bacteria | 5336 |
| 113 | Ga0157370_10101915 | 3300013104 | Bacteria | 2689 |
| 114 | Ga0157369_10100612 | 3300013105 | Bacteria | 3081 |
| 115 | Ga0157369_10289540 | 3300013105 | Bacteria | 1705 |
| 116 | Ga0157374_10161150 | 3300013296 | Bacteria | 2185 |
| 117 | Ga0157378_10007224 | 3300013297 | Bacteria | 9702 |
| 118 | Ga0157378_10052517 | 3300013297 | Bacteria | 3626 |
| 119 | Ga0157378_10216691 | 3300013297 | Bacteria | 1818 |
| 120 | Ga0163162_10084614 | 3300013306 | Bacteria | 3248 |
| 121 | Ga0163162_10205139 | 3300013306 | Bacteria | 2100 |
| 122 | Ga0157372_10020017 | 3300013307 | Bacteria | 7215 |
| 123 | Ga0157375_10195264 | 3300013308 | Bacteria | 2179 |
| 124 | Ga0163163_10000111 | 3300014325 | Bacteria | 86620 |
| 125 | Ga0163163_10011217 | 3300014325 | Bacteria | 8120 |
| 126 | Ga0163163_10132798 | 3300014325 | Bacteria | 2529 |
| 127 | Ga0163163_10525267 | 3300014325 | Unclassified | 1246 |
| 128 | Ga0157379_10013093 | 3300014968 | Bacteria | 7263 |
| 129 | Ga0157379_10017776 | 3300014968 | Bacteria | 6263 |
| 130 | Ga0157379_10024393 | 3300014968 | Bacteria | 5369 |
| 131 | Ga0157379_10076267 | 3300014968 | Bacteria | 3002 |
| 132 | Ga0157379_10145311 | 3300014968 | Bacteria | 2139 |
| 133 | Ga0157376_10296854 | 3300014969 | Bacteria | 1528 |
| 134 | Ga0157376_10486678 | 3300014969 | Unclassified | 1210 |
| 135 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 136 | Ga0209233_1002143 | 3300025261 | Bacteria | 7418 |
| 137 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 138 | Ga0207642_10060373 | 3300025899 | Bacteria | 1758 |
| 139 | Ga0207680_10134231 | 3300025903 | Bacteria | 1634 |
| 140 | Ga0207699_10000159 | 3300025906 | Bacteria | 42165 |
| 141 | Ga0207645_10256725 | 3300025907 | Bacteria | 1157 |
| 142 | Ga0207705_10000092 | 3300025909 | Bacteria | 109488 |
| 143 | Ga0207705_10001483 | 3300025909 | Bacteria | 18695 |
| 144 | Ga0207654_10028410 | 3300025911 | Bacteria | 3049 |
| 145 | Ga0207654_10130253 | 3300025911 | Bacteria | 1591 |
| 146 | Ga0207707_10004556 | 3300025912 | Bacteria | 12184 |
| 147 | Ga0207707_10147227 | 3300025912 | Bacteria | 2059 |
| 148 | Ga0207707_10162608 | 3300025912 | Bacteria | 1952 |
| 149 | Ga0207707_10313250 | 3300025912 | Unclassified | 1356 |
| 150 | Ga0207695_10006268 | 3300025913 | Bacteria | 15485 |
| 151 | Ga0207695_10077258 | 3300025913 | Bacteria | 3383 |
| 152 | Ga0207695_10316648 | 3300025913 | Bacteria | 1450 |
| 153 | Ga0207671_10083607 | 3300025914 | Bacteria | 2397 |
| 154 | Ga0207671_10098551 | 3300025914 | Bacteria | 2211 |
| 155 | Ga0207671_10122458 | 3300025914 | Bacteria | 1989 |
| 156 | Ga0207693_10002532 | 3300025915 | Bacteria | 15883 |
| 157 | Ga0207663_10188336 | 3300025916 | Bacteria | 1480 |
| 158 | Ga0207660_10005842 | 3300025917 | Bacteria | 7986 |
| 159 | Ga0207660_10262077 | 3300025917 | Bacteria | 1367 |
| 160 | Ga0207657_10031080 | 3300025919 | Bacteria | 4841 |
| 161 | Ga0207657_10519542 | 3300025919 | Unclassified | 932 |
| 162 | Ga0207649_10179402 | 3300025920 | Bacteria | 1481 |
| 163 | Ga0207652_10000892 | 3300025921 | Bacteria | 28252 |
| 164 | Ga0207652_10005445 | 3300025921 | Bacteria | 10330 |
| 165 | Ga0207652_10118419 | 3300025921 | Bacteria | 2354 |
| 166 | Ga0207694_10354178 | 3300025924 | Bacteria | 1215 |
| 167 | Ga0207694_10410120 | 3300025924 | Unclassified | 1127 |
| 168 | Ga0207659_10019312 | 3300025926 | Bacteria | 4484 |
| 169 | Ga0207687_10029495 | 3300025927 | Bacteria | 3691 |
| 170 | Ga0207687_10062983 | 3300025927 | Bacteria | 2624 |
| 171 | Ga0207700_10000010 | 3300025928 | Bacteria | 298473 |
| 172 | Ga0207664_10005602 | 3300025929 | Bacteria | 8594 |
| 173 | Ga0207664_10058319 | 3300025929 | Bacteria | 3071 |
| 174 | Ga0207644_10156048 | 3300025931 | Bacteria | 1770 |
| 175 | Ga0207690_10049646 | 3300025932 | Bacteria | 2798 |
| 176 | Ga0207690_10055276 | 3300025932 | Bacteria | 2673 |
| 177 | Ga0207686_10116738 | 3300025934 | Bacteria | 1809 |
| 178 | Ga0207686_10286731 | 3300025934 | Bacteria | 1218 |
| 179 | Ga0207709_10002218 | 3300025935 | Bacteria | 12386 |
| 180 | Ga0207704_10500778 | 3300025938 | Bacteria | 979 |
| 181 | Ga0207665_10079119 | 3300025939 | Bacteria | 2259 |
| 182 | Ga0207691_10037819 | 3300025940 | Bacteria | 4467 |
| 183 | Ga0207711_10049962 | 3300025941 | Bacteria | 3580 |
| 184 | Ga0207689_10069946 | 3300025942 | Bacteria | 2884 |
| 185 | Ga0207667_10051833 | 3300025949 | Bacteria | 4324 |
| 186 | Ga0207667_10076553 | 3300025949 | Bacteria | 3472 |
| 187 | Ga0207667_10184078 | 3300025949 | Bacteria | 2145 |
| 188 | Ga0207651_10064612 | 3300025960 | Bacteria | 2562 |
| 189 | Ga0207712_10055505 | 3300025961 | Bacteria | 2787 |
| 190 | Ga0207677_10073918 | 3300026023 | Bacteria | 2416 |
| 191 | Ga0207677_10155776 | 3300026023 | Bacteria | 1769 |
| 192 | Ga0207703_10002958 | 3300026035 | Bacteria | 14408 |
| 193 | Ga0207703_10177537 | 3300026035 | Bacteria | 1877 |
| 194 | Ga0207702_10000013 | 3300026078 | Bacteria | 257468 |
| 195 | Ga0207702_10046001 | 3300026078 | Bacteria | 3673 |
| 196 | Ga0207702_10314861 | 3300026078 | Bacteria | 1489 |
| 197 | Ga0207648_10026224 | 3300026089 | Bacteria | 5180 |
| 198 | Ga0207648_10108325 | 3300026089 | Bacteria | 2439 |
| 199 | Ga0207648_10146630 | 3300026089 | Bacteria | 2082 |
| 200 | Ga0207676_10126093 | 3300026095 | Bacteria | 2168 |
| 201 | Ga0207676_10644006 | 3300026095 | Bacteria | 1022 |
| 202 | Ga0207674_10050669 | 3300026116 | Bacteria | 4240 |
| 203 | Ga0207674_10088583 | 3300026116 | Bacteria | 3088 |
| 204 | Ga0207674_10286064 | 3300026116 | Bacteria | 1597 |
| 205 | Ga0207683_10021308 | 3300026121 | Bacteria | 5547 |
| 206 | Ga0207683_10034533 | 3300026121 | Bacteria | 4395 |
| 207 | Ga0207698_10437513 | 3300026142 | Bacteria | 1259 |
| 208 | Ga0268266_10002680 | 3300028379 | Bacteria | 18712 |
| 209 | Ga0268266_10005907 | 3300028379 | Bacteria | 11323 |
| 210 | Ga0268266_10023201 | 3300028379 | Bacteria | 5284 |
| 211 | Ga0268266_10227263 | 3300028379 | Bacteria | 1717 |
| 212 | Ga0268265_10715405 | 3300028380 | Unclassified | 969 |
| 213 | Ga0268264_10095289 | 3300028381 | Bacteria | 2575 |
| 214 | Ga0265318_10065271 | 3300028577 | Bacteria | 1354 |
| 215 | Ga0265338_10003602 | 3300028800 | Bacteria | 21622 |
| 216 | Ga0265338_10029551 | 3300028800 | Bacteria | 5428 |
| 217 | Ga0265338_10145123 | 3300028800 | Bacteria | 1853 |
| 218 | Ga0265338_10148426 | 3300028800 | Bacteria | 1825 |
| 219 | Ga0265338_10219206 | 3300028800 | Unclassified | 1422 |
| 220 | Ga0265332_10044686 | 3300031238 | Bacteria | 1910 |
| 221 | Ga0265325_10000413 | 3300031241 | Bacteria | 30484 |
| 222 | Ga0265325_10002804 | 3300031241 | Bacteria | 11626 |
| 223 | Ga0265340_10002678 | 3300031247 | Bacteria | 10128 |
| 224 | Ga0265340_10085525 | 3300031247 | Bacteria | 1480 |
| 225 | Ga0265339_10003504 | 3300031249 | Bacteria | 10962 |
| 226 | Ga0265339_10106813 | 3300031249 | Bacteria | 1452 |
| 227 | Ga0265331_10055147 | 3300031250 | Bacteria | 1891 |
| 228 | Ga0265316_10121613 | 3300031344 | Bacteria | 1971 |
| 229 | Ga0265313_10000660 | 3300031595 | Bacteria | 35564 |
| 230 | Ga0265313_10003294 | 3300031595 | Bacteria | 13231 |
| 231 | Ga0265313_10038532 | 3300031595 | Bacteria | 2379 |
| 232 | Ga0265313_10091230 | 3300031595 | Unclassified | 1368 |
| 233 | Ga0265314_10124972 | 3300031711 | Bacteria | 1613 |
| 234 | Ga0265314_10247567 | 3300031711 | Bacteria | 1025 |
| 235 | Ga0373933_0221187 | 3300035724 | Unclassified | 1215 |
| 236 | Ga0373925_0249569 | 3300037068 | Bacteria | 1423 |
| 237 | Ga0395899_0110143 | 3300037312 | Bacteria | 1981 |
| 238 | Ga0395900_0022307 | 3300037418 | Bacteria | 6477 |
| 239 | Ga0395901_0049097 | 3300038443 | Bacteria | 4384 |
| 240 | Ga0436365_1926500 | 3300039437 | Bacteria | 1393 |
| 241 | Ga0495582_0146289 | 3300046473 | Bacteria | 1341 |
| 242 | Ga0495652_0376903 | 3300046529 | Unclassified | 1010 |
| 243 | Ga0495587_0047144 | 3300046536 | Bacteria | 2556 |
| 244 | Ga0495609_0055358 | 3300046538 | Bacteria | 1760 |
| 245 | Ga0495611_0102060 | 3300046648 | Bacteria | 1333 |
| 246 | Ga0495625_0156718 | 3300046660 | Bacteria | 1528 |
| 247 | Ga0495675_0133233 | 3300047444 | Bacteria | 1544 |
| 248 | Ga0495602_0088981 | 3300048088 | Bacteria | 2569 |
| 249 | Ga0496104_0355330 | 3300048907 | Bacteria | 1378 |
| 250 | Ga0496126_0001513 | 3300048929 | Bacteria | 35899 |
| 251 | Ga0496126_0305111 | 3300048929 | Bacteria | 1312 |
| 252 | Ga0501031_0002127 | 3300049568 | Bacteria | 12497 |
| 253 | Ga0501032_0041632 | 3300049569 | Bacteria | 3118 |
| 254 | Ga0501033_0003945 | 3300049570 | Bacteria | 12027 |
| 255 | Ga0501033_0015038 | 3300049570 | Bacteria | 5873 |
| 256 | Ga0501033_0043351 | 3300049570 | Bacteria | 3351 |
| 257 | Ga0501033_0090547 | 3300049570 | Bacteria | 2238 |
| 258 | Ga0501033_0105952 | 3300049570 | Bacteria | 2048 |
| 259 | Ga0501033_0131825 | 3300049570 | Bacteria | 1810 |
| 260 | Ga0501034_0004847 | 3300049571 | Bacteria | 14856 |
| 261 | Ga0501034_0120187 | 3300049571 | Bacteria | 2614 |
| 262 | Ga0501034_0331296 | 3300049571 | Unclassified | 1454 |
| 263 | Ga0501036_0004049 | 3300049572 | Bacteria | 11785 |
| 264 | Ga0501037_0002141 | 3300049573 | Bacteria | 14291 |
| 265 | Ga0501037_0047476 | 3300049573 | Bacteria | 3147 |
| 266 | Ga0501038_0086165 | 3300049574 | Bacteria | 2640 |
| 267 | Ga0501038_0097405 | 3300049574 | Bacteria | 2454 |
| 268 | Ga0501038_0276858 | 3300049574 | Bacteria | 1322 |
| 269 | Ga0501043_0024083 | 3300049579 | Bacteria | 4777 |
| 270 | Ga0501043_0043621 | 3300049579 | Bacteria | 3525 |
| 271 | Ga0501043_0060145 | 3300049579 | Bacteria | 2981 |
| 272 | Ga0501043_0184515 | 3300049579 | Bacteria | 1625 |
| 273 | Ga0501043_0230965 | 3300049579 | Bacteria | 1429 |
| 274 | Ga0501046_0002196 | 3300049580 | Bacteria | 18436 |
| 275 | Ga0501046_0034820 | 3300049580 | Bacteria | 4062 |
| 276 | Ga0501046_0036190 | 3300049580 | Bacteria | 3975 |
| 277 | Ga0501047_0003221 | 3300049581 | Bacteria | 15472 |
| 278 | Ga0501047_0004336 | 3300049581 | Bacteria | 13356 |
| 279 | Ga0501047_0026719 | 3300049581 | Bacteria | 5556 |
| 280 | Ga0501047_0221337 | 3300049581 | Bacteria | 1749 |
| 281 | Ga0501047_0281559 | 3300049581 | Unclassified | 1507 |
| 282 | Ga0501047_0537854 | 3300049581 | Bacteria | 993 |
| 283 | Ga0501048_0001595 | 3300049582 | Bacteria | 17213 |
| 284 | Ga0501048_0257827 | 3300049582 | Bacteria | 1239 |
| 285 | Ga0501067_0007014 | 3300049583 | Bacteria | 6256 |
| 286 | Ga0501068_0149862 | 3300049584 | Unclassified | 1465 |
| 287 | Ga0501069_0070383 | 3300049585 | Bacteria | 1959 |
| 288 | Ga0501070_0000109 | 3300049586 | Bacteria | 72583 |
| 289 | Ga0501070_0038503 | 3300049586 | Bacteria | 3989 |
| 290 | Ga0501073_0008771 | 3300049589 | Bacteria | 7483 |
| 291 | Ga0501074_0001610 | 3300049590 | Bacteria | 15287 |
| 292 | Ga0501079_0001965 | 3300049741 | Bacteria | 14735 |
| 293 | Ga0501080_0055866 | 3300049742 | Bacteria | 3677 |
| 294 | Ga0501080_0071913 | 3300049742 | Bacteria | 3218 |
| 295 | Ga0501083_0030458 | 3300049744 | Bacteria | 3707 |
| 296 | Ga0501083_0049495 | 3300049744 | Bacteria | 2832 |
| 297 | Ga0501035_0008525 | 3300049822 | Bacteria | 9543 |
| 298 | Ga0501035_0071374 | 3300049822 | Bacteria | 3074 |
| 299 | Ga0501035_0092167 | 3300049822 | Bacteria | 2666 |
| 300 | Ga0501035_0158373 | 3300049822 | Bacteria | 1961 |
| 301 | Ga0501035_0188988 | 3300049822 | Bacteria | 1771 |
| 302 | Ga0501035_0198305 | 3300049822 | Bacteria | 1723 |
| 303 | Ga0501044_0005359 | 3300049823 | Bacteria | 14252 |
| 304 | Ga0501044_0008325 | 3300049823 | Bacteria | 11365 |
| 305 | Ga0501044_0008620 | 3300049823 | Bacteria | 11166 |
| 306 | Ga0501044_0008931 | 3300049823 | Bacteria | 10955 |
| 307 | Ga0501044_0025782 | 3300049823 | Bacteria | 6232 |
| 308 | Ga0501044_0042251 | 3300049823 | Bacteria | 4742 |
| 309 | Ga0501044_0044713 | 3300049823 | Bacteria | 4593 |
| 310 | Ga0501044_0051080 | 3300049823 | Bacteria | 4264 |
| 311 | Ga0501044_0106469 | 3300049823 | Bacteria | 2816 |
| 312 | Ga0501044_0121823 | 3300049823 | Bacteria | 2608 |
| 313 | Ga0501044_0225819 | 3300049823 | Bacteria | 1822 |
| 314 | Ga0501045_0207524 | 3300049824 | Unclassified | 1459 |
| 315 | nmdc:mga0n895_12885_c1 | 3300050512 | Bacteria | 7514 |
| 316 | nmdc:mga08x19_140_c1 | 3300050514 | Bacteria | 64178 |
| 317 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 318 | Ga0500646_0018302 | 3300053090 | Bacteria | 1844 |
| 319 | Ga0500595_001130 | 3300053119 | Bacteria | 14796 |
| 320 | Ga0500568_0016389 | 3300053139 | Bacteria | 3297 |
| 321 | Ga0500568_0101364 | 3300053139 | Bacteria | 1080 |
| 322 | Ga0500573_0000003 | 3300053140 | Bacteria | 355643 |
| 323 | Ga0500604_0105290 | 3300053151 | Bacteria | 933 |
| 324 | Ga0501084_0005458 | 3300054114 | Bacteria | 10431 |
| 325 | Ga0501082_0006508 | 3300060353 | Bacteria | 10128 |
| 326 | Ga0501082_0026545 | 3300060353 | Bacteria | 4992 |
| 327 | Ga0501082_0430222 | 3300060353 | Unclassified | 1153 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0430222 | Ga0501082_0430222_23_727 | 223 |
| 2 | 3300028800 | Ga0265338_10148426 | Ga0265338_101484262 | 239 |
| 3 | 3300031241 | Ga0265325_10000413 | Ga0265325_100004138 | 239 |
| 4 | 3300031249 | Ga0265339_10003504 | Ga0265339_100035043 | 239 |
| 5 | 3300031344 | Ga0265316_10121613 | Ga0265316_101216132 | 239 |
| 6 | 3300031595 | Ga0265313_10003294 | Ga0265313_100032947 | 239 |
| 7 | 3300049823 | Ga0501044_0008620 | Ga0501044_0008620_6253_7068 | 240 |
| 8 | 3300005336 | Ga0070680_100008480 | Ga0070680_1000084808 | 241 |
| 9 | 3300005366 | Ga0070659_100014081 | Ga0070659_1000140815 | 241 |
| 10 | 3300005455 | Ga0070663_100117198 | Ga0070663_1001171982 | 241 |
| 11 | 3300005563 | Ga0068855_100027286 | Ga0068855_1000272868 | 241 |
| 12 | 3300005578 | Ga0068854_100193652 | Ga0068854_1001936521 | 241 |
| 13 | 3300013104 | Ga0157370_10020121 | Ga0157370_100201219 | 241 |
| 14 | 3300013307 | Ga0157372_10020017 | Ga0157372_100200173 | 241 |
| 15 | 3300025912 | Ga0207707_10004556 | Ga0207707_100045568 | 241 |
| 16 | 3300025917 | Ga0207660_10005842 | Ga0207660_100058428 | 241 |
| 17 | 3300025921 | Ga0207652_10000892 | Ga0207652_100008928 | 241 |
| 18 | 3300025932 | Ga0207690_10055276 | Ga0207690_100552762 | 241 |
| 19 | 3300009093 | Ga0105240_10203160 | Ga0105240_102031603 | 244 |
| 20 | 3300046473 | Ga0495582_0146289 | Ga0495582_0146289_129_1001 | 244 |
| 21 | 3300025909 | Ga0207705_10000092 | Ga0207705_1000009269 | 249 |
| 22 | 3300049742 | Ga0501080_0071913 | Ga0501080_0071913_1863_2630 | 253 |
| 23 | 3300038443 | Ga0395901_0049097 | Ga0395901_0049097_3584_4366 | 254 |
| 24 | 3300049568 | Ga0501031_0002127 | Ga0501031_0002127_6640_7413 | 255 |
| 25 | 3300049569 | Ga0501032_0041632 | Ga0501032_0041632_918_1691 | 255 |
| 26 | 3300049570 | Ga0501033_0003945 | Ga0501033_0003945_9559_10332 | 255 |
| 27 | 3300049571 | Ga0501034_0004847 | Ga0501034_0004847_9896_10669 | 255 |
| 28 | 3300049572 | Ga0501036_0004049 | Ga0501036_0004049_5273_6046 | 255 |
| 29 | 3300049573 | Ga0501037_0002141 | Ga0501037_0002141_5485_6258 | 255 |
| 30 | 3300049579 | Ga0501043_0060145 | Ga0501043_0060145_1646_2419 | 255 |
| 31 | 3300049580 | Ga0501046_0002196 | Ga0501046_0002196_4978_5751 | 255 |
| 32 | 3300049582 | Ga0501048_0001595 | Ga0501048_0001595_15158_15931 | 255 |
| 33 | 3300049583 | Ga0501067_0007014 | Ga0501067_0007014_3476_4249 | 255 |
| 34 | 3300049584 | Ga0501068_0149862 | Ga0501068_0149862_460_1233 | 255 |
| 35 | 3300049585 | Ga0501069_0070383 | Ga0501069_0070383_266_1039 | 255 |
| 36 | 3300049586 | Ga0501070_0038503 | Ga0501070_0038503_2532_3305 | 255 |
| 37 | 3300049589 | Ga0501073_0008771 | Ga0501073_0008771_3234_4007 | 255 |
| 38 | 3300049590 | Ga0501074_0001610 | Ga0501074_0001610_4444_5217 | 255 |
| 39 | 3300049741 | Ga0501079_0001965 | Ga0501079_0001965_5740_6513 | 255 |
| 40 | 3300049744 | Ga0501083_0030458 | Ga0501083_0030458_1273_2046 | 255 |
| 41 | 3300049822 | Ga0501035_0071374 | Ga0501035_0071374_1745_2518 | 255 |
| 42 | 3300049823 | Ga0501044_0042251 | Ga0501044_0042251_3413_4186 | 255 |
| 43 | 3300049824 | Ga0501045_0207524 | Ga0501045_0207524_256_1029 | 255 |
| 44 | 3300054114 | Ga0501084_0005458 | Ga0501084_0005458_5269_6042 | 255 |
| 45 | 3300060353 | Ga0501082_0006508 | Ga0501082_0006508_8650_9423 | 255 |
| 46 | 3300046648 | Ga0495611_0102060 | Ga0495611_0102060_157_1008 | 256 |
| 47 | 3300049579 | Ga0501043_0024083 | Ga0501043_0024083_2136_2963 | 256 |
| 48 | 3300003320 | rootH2_10051869 | rootH2_100518693 | 257 |
| 49 | 3300028800 | Ga0265338_10145123 | Ga0265338_101451231 | 257 |
| 50 | 3300031247 | Ga0265340_10002678 | Ga0265340_100026786 | 257 |
| 51 | 3300049573 | Ga0501037_0047476 | Ga0501037_0047476_1956_2771 | 257 |
| 52 | 3300049574 | Ga0501038_0086165 | Ga0501038_0086165_88_903 | 257 |
| 53 | 3300049586 | Ga0501070_0000109 | Ga0501070_0000109_1524_2339 | 257 |
| 54 | 3300049822 | Ga0501035_0008525 | Ga0501035_0008525_2759_3574 | 257 |
| 55 | 3300049822 | Ga0501035_0198305 | Ga0501035_0198305_711_1523 | 257 |
| 56 | 3300049823 | Ga0501044_0008931 | Ga0501044_0008931_7495_8310 | 257 |
| 57 | 3300049823 | Ga0501044_0025782 | Ga0501044_0025782_5251_6066 | 257 |
| 58 | 3300005434 | Ga0070709_10005845 | Ga0070709_100058457 | 258 |
| 59 | 3300005435 | Ga0070714_100014233 | Ga0070714_1000142332 | 258 |
| 60 | 3300005436 | Ga0070713_100000003 | Ga0070713_100000003156 | 258 |
| 61 | 3300005439 | Ga0070711_100148170 | Ga0070711_1001481702 | 258 |
| 62 | 3300005440 | Ga0070705_100089673 | Ga0070705_1000896733 | 258 |
| 63 | 3300005614 | Ga0068856_100001113 | Ga0068856_10000111318 | 258 |
| 64 | 3300006173 | Ga0070716_100044338 | Ga0070716_1000443382 | 258 |
| 65 | 3300006175 | Ga0070712_100022190 | Ga0070712_1000221903 | 258 |
| 66 | 3300006871 | Ga0075434_100011244 | Ga0075434_1000112442 | 258 |
| 67 | 3300006914 | Ga0075436_100000113 | Ga0075436_1000001137 | 258 |
| 68 | 3300013297 | Ga0157378_10216691 | Ga0157378_102166912 | 258 |
| 69 | 3300014968 | Ga0157379_10013093 | Ga0157379_100130932 | 258 |
| 70 | 3300025906 | Ga0207699_10000159 | Ga0207699_1000015941 | 258 |
| 71 | 3300025915 | Ga0207693_10002532 | Ga0207693_100025324 | 258 |
| 72 | 3300025916 | Ga0207663_10188336 | Ga0207663_101883362 | 258 |
| 73 | 3300025928 | Ga0207700_10000010 | Ga0207700_10000010182 | 258 |
| 74 | 3300025929 | Ga0207664_10058319 | Ga0207664_100583192 | 258 |
| 75 | 3300025939 | Ga0207665_10079119 | Ga0207665_100791192 | 258 |
| 76 | 3300026078 | Ga0207702_10000013 | Ga0207702_10000013105 | 258 |
| 77 | 3300050512 | nmdc:mga0n895_12885_c1 | nmdc:mga0n895_12885_c1_5516_6343 | 258 |
| 78 | 3300050514 | nmdc:mga08x19_140_c1 | nmdc:mga08x19_140_c1_32913_33740 | 258 |
| 79 | 3300046660 | Ga0495625_0156718 | Ga0495625_0156718_54_878 | 259 |
| 80 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_193768_194592 | 259 |
| 81 | 3300009176 | Ga0105242_10027852 | Ga0105242_100278527 | 260 |
| 82 | 3300013296 | Ga0157374_10161150 | Ga0157374_101611503 | 260 |
| 83 | 3300013306 | Ga0163162_10205139 | Ga0163162_102051392 | 260 |
| 84 | 3300013308 | Ga0157375_10195264 | Ga0157375_101952642 | 260 |
| 85 | 3300014969 | Ga0157376_10296854 | Ga0157376_102968542 | 260 |
| 86 | 3300049570 | Ga0501033_0131825 | Ga0501033_0131825_725_1558 | 260 |
| 87 | 3300049571 | Ga0501034_0120187 | Ga0501034_0120187_456_1289 | 260 |
| 88 | 3300028800 | Ga0265338_10219206 | Ga0265338_102192061 | 261 |
| 89 | 3300031241 | Ga0265325_10002804 | Ga0265325_100028048 | 261 |
| 90 | 3300031249 | Ga0265339_10106813 | Ga0265339_101068133 | 261 |
| 91 | 3300037068 | Ga0373925_0249569 | Ga0373925_0249569_564_1397 | 261 |
| 92 | 3300048929 | Ga0496126_0001513 | Ga0496126_0001513_126_944 | 261 |
| 93 | 3300005435 | Ga0070714_100016661 | Ga0070714_1000166612 | 263 |
| 94 | 3300025929 | Ga0207664_10005602 | Ga0207664_100056025 | 263 |
| 95 | 3300005327 | Ga0070658_10040543 | Ga0070658_100405432 | 264 |
| 96 | 3300005327 | Ga0070658_10316312 | Ga0070658_103163122 | 264 |
| 97 | 3300005458 | Ga0070681_10047413 | Ga0070681_100474133 | 264 |
| 98 | 3300005530 | Ga0070679_100009547 | Ga0070679_1000095479 | 264 |
| 99 | 3300005548 | Ga0070665_100022755 | Ga0070665_1000227555 | 264 |
| 100 | 3300005548 | Ga0070665_100206836 | Ga0070665_1002068362 | 264 |
| 101 | 3300005563 | Ga0068855_100039414 | Ga0068855_1000394146 | 264 |
| 102 | 3300005563 | Ga0068855_100301691 | Ga0068855_1003016912 | 264 |
| 103 | 3300005614 | Ga0068856_100601429 | Ga0068856_1006014292 | 264 |
| 104 | 3300009093 | Ga0105240_10047018 | Ga0105240_100470185 | 264 |
| 105 | 3300009093 | Ga0105240_10088737 | Ga0105240_100887372 | 264 |
| 106 | 3300009174 | Ga0105241_10196294 | Ga0105241_101962942 | 264 |
| 107 | 3300009545 | Ga0105237_10038275 | Ga0105237_100382753 | 264 |
| 108 | 3300009551 | Ga0105238_10232963 | Ga0105238_102329633 | 264 |
| 109 | 3300010375 | Ga0105239_10106173 | Ga0105239_101061733 | 264 |
| 110 | 3300010375 | Ga0105239_10791691 | Ga0105239_107916912 | 264 |
| 111 | 3300013105 | Ga0157369_10289540 | Ga0157369_102895403 | 264 |
| 112 | 3300014325 | Ga0163163_10525267 | Ga0163163_105252672 | 264 |
| 113 | 3300014969 | Ga0157376_10486678 | Ga0157376_104866782 | 264 |
| 114 | 3300025911 | Ga0207654_10130253 | Ga0207654_101302532 | 264 |
| 115 | 3300025912 | Ga0207707_10313250 | Ga0207707_103132502 | 264 |
| 116 | 3300025913 | Ga0207695_10006268 | Ga0207695_1000626812 | 264 |
| 117 | 3300025914 | Ga0207671_10098551 | Ga0207671_100985512 | 264 |
| 118 | 3300025919 | Ga0207657_10519542 | Ga0207657_105195421 | 264 |
| 119 | 3300025921 | Ga0207652_10118419 | Ga0207652_101184193 | 264 |
| 120 | 3300025924 | Ga0207694_10354178 | Ga0207694_103541782 | 264 |
| 121 | 3300025949 | Ga0207667_10184078 | Ga0207667_101840782 | 264 |
| 122 | 3300026116 | Ga0207674_10050669 | Ga0207674_100506692 | 264 |
| 123 | 3300035724 | Ga0373933_0221187 | Ga0373933_0221187_231_1028 | 264 |
| 124 | 3300037312 | Ga0395899_0110143 | Ga0395899_0110143_636_1433 | 264 |
| 125 | 3300046536 | Ga0495587_0047144 | Ga0495587_0047144_1065_1862 | 264 |
| 126 | 3300047444 | Ga0495675_0133233 | Ga0495675_0133233_82_915 | 264 |
| 127 | 3300048088 | Ga0495602_0088981 | Ga0495602_0088981_1244_2041 | 264 |
| 128 | 3300049570 | Ga0501033_0043351 | Ga0501033_0043351_302_1099 | 264 |
| 129 | 3300049579 | Ga0501043_0043621 | Ga0501043_0043621_2561_3358 | 264 |
| 130 | 3300049581 | Ga0501047_0281559 | Ga0501047_0281559_222_1019 | 264 |
| 131 | 3300049742 | Ga0501080_0055866 | Ga0501080_0055866_912_1709 | 264 |
| 132 | 3300049823 | Ga0501044_0051080 | Ga0501044_0051080_1130_1927 | 264 |
| 133 | 3300009098 | Ga0105245_10202067 | Ga0105245_102020673 | 265 |
| 134 | 3300025261 | Ga0209233_1002143 | Ga0209233_10021432 | 265 |
| 135 | 3300026121 | Ga0207683_10034533 | Ga0207683_100345335 | 265 |
| 136 | 3300028577 | Ga0265318_10065271 | Ga0265318_100652712 | 265 |
| 137 | 3300028800 | Ga0265338_10029551 | Ga0265338_100295514 | 265 |
| 138 | 3300031250 | Ga0265331_10055147 | Ga0265331_100551471 | 265 |
| 139 | 3300031595 | Ga0265313_10000660 | Ga0265313_1000066013 | 265 |
| 140 | 3300031595 | Ga0265313_10038532 | Ga0265313_100385323 | 265 |
| 141 | 3300031711 | Ga0265314_10124972 | Ga0265314_101249722 | 265 |
| 142 | 3300031711 | Ga0265314_10247567 | Ga0265314_102475671 | 265 |
| 143 | 3300039437 | Ga0436365_1926500 | Ga0436365_1926500_235_1074 | 265 |
| 144 | 3300049571 | Ga0501034_0331296 | Ga0501034_0331296_412_1215 | 265 |
| 145 | 3300049574 | Ga0501038_0097405 | Ga0501038_0097405_972_1775 | 265 |
| 146 | 3300049580 | Ga0501046_0036190 | Ga0501046_0036190_166_969 | 265 |
| 147 | 3300049581 | Ga0501047_0004336 | Ga0501047_0004336_11448_12251 | 265 |
| 148 | 3300049581 | Ga0501047_0537854 | Ga0501047_0537854_148_951 | 265 |
| 149 | 3300049582 | Ga0501048_0257827 | Ga0501048_0257827_46_891 | 265 |
| 150 | 3300049744 | Ga0501083_0049495 | Ga0501083_0049495_18_818 | 265 |
| 151 | 3300049822 | Ga0501035_0092167 | Ga0501035_0092167_1715_2536 | 265 |
| 152 | 3300049822 | Ga0501035_0188988 | Ga0501035_0188988_791_1594 | 265 |
| 153 | 3300049823 | Ga0501044_0044713 | Ga0501044_0044713_1927_2730 | 265 |
| 154 | 3300049823 | Ga0501044_0106469 | Ga0501044_0106469_1941_2762 | 265 |
| 155 | 3300049823 | Ga0501044_0121823 | Ga0501044_0121823_1682_2527 | 265 |
| 156 | 3300060353 | Ga0501082_0026545 | Ga0501082_0026545_3951_4751 | 265 |
| 157 | 3300003214 | JGI25165J46597_1000425 | JGI25165J46597_100042539 | 266 |
| 158 | 3300003215 | JGI25153J46596_10001493 | JGI25153J46596_100014934 | 266 |
| 159 | 3300005327 | Ga0070658_10005088 | Ga0070658_100050887 | 266 |
| 160 | 3300005329 | Ga0070683_100280983 | Ga0070683_1002809832 | 266 |
| 161 | 3300005330 | Ga0070690_100130982 | Ga0070690_1001309822 | 266 |
| 162 | 3300005334 | Ga0068869_100003098 | Ga0068869_1000030987 | 266 |
| 163 | 3300005335 | Ga0070666_10095697 | Ga0070666_100956972 | 266 |
| 164 | 3300005338 | Ga0068868_100129718 | Ga0068868_1001297182 | 266 |
| 165 | 3300005338 | Ga0068868_100199032 | Ga0068868_1001990322 | 266 |
| 166 | 3300005338 | Ga0068868_100228678 | Ga0068868_1002286782 | 266 |
| 167 | 3300005344 | Ga0070661_100184497 | Ga0070661_1001844972 | 266 |
| 168 | 3300005354 | Ga0070675_100027852 | Ga0070675_1000278524 | 266 |
| 169 | 3300005355 | Ga0070671_100188351 | Ga0070671_1001883512 | 266 |
| 170 | 3300005364 | Ga0070673_100061252 | Ga0070673_1000612522 | 266 |
| 171 | 3300005364 | Ga0070673_100121434 | Ga0070673_1001214342 | 266 |
| 172 | 3300005367 | Ga0070667_100088412 | Ga0070667_1000884123 | 266 |
| 173 | 3300005367 | Ga0070667_100242811 | Ga0070667_1002428111 | 266 |
| 174 | 3300005436 | Ga0070713_100060003 | Ga0070713_1000600032 | 266 |
| 175 | 3300005456 | Ga0070678_100013030 | Ga0070678_1000130307 | 266 |
| 176 | 3300005456 | Ga0070678_100053499 | Ga0070678_1000534992 | 266 |
| 177 | 3300005456 | Ga0070678_100229984 | Ga0070678_1002299842 | 266 |
| 178 | 3300005458 | Ga0070681_10296172 | Ga0070681_102961722 | 266 |
| 179 | 3300005459 | Ga0068867_100044290 | Ga0068867_1000442903 | 266 |
| 180 | 3300005459 | Ga0068867_100066650 | Ga0068867_1000666503 | 266 |
| 181 | 3300005459 | Ga0068867_100167130 | Ga0068867_1001671303 | 266 |
| 182 | 3300005530 | Ga0070679_100379375 | Ga0070679_1003793752 | 266 |
| 183 | 3300005539 | Ga0068853_100372377 | Ga0068853_1003723772 | 266 |
| 184 | 3300005539 | Ga0068853_100507117 | Ga0068853_1005071171 | 266 |
| 185 | 3300005547 | Ga0070693_100181581 | Ga0070693_1001815812 | 266 |
| 186 | 3300005547 | Ga0070693_100260168 | Ga0070693_1002601682 | 266 |
| 187 | 3300005548 | Ga0070665_100010246 | Ga0070665_1000102468 | 266 |
| 188 | 3300005548 | Ga0070665_100012139 | Ga0070665_1000121392 | 266 |
| 189 | 3300005548 | Ga0070665_100039508 | Ga0070665_1000395085 | 266 |
| 190 | 3300005563 | Ga0068855_100015988 | Ga0068855_1000159887 | 266 |
| 191 | 3300005563 | Ga0068855_100217105 | Ga0068855_1002171053 | 266 |
| 192 | 3300005563 | Ga0068855_100276838 | Ga0068855_1002768382 | 266 |
| 193 | 3300005563 | Ga0068855_100506991 | Ga0068855_1005069912 | 266 |
| 194 | 3300005577 | Ga0068857_100112291 | Ga0068857_1001122912 | 266 |
| 195 | 3300005578 | Ga0068854_100237046 | Ga0068854_1002370461 | 266 |
| 196 | 3300005614 | Ga0068856_100041021 | Ga0068856_1000410213 | 266 |
| 197 | 3300005614 | Ga0068856_100097797 | Ga0068856_1000977973 | 266 |
| 198 | 3300005616 | Ga0068852_100283528 | Ga0068852_1002835282 | 266 |
| 199 | 3300005618 | Ga0068864_100137354 | Ga0068864_1001373542 | 266 |
| 200 | 3300005842 | Ga0068858_100084440 | Ga0068858_1000844403 | 266 |
| 201 | 3300005842 | Ga0068858_100109083 | Ga0068858_1001090833 | 266 |
| 202 | 3300005843 | Ga0068860_100265301 | Ga0068860_1002653012 | 266 |
| 203 | 3300005843 | Ga0068860_100421846 | Ga0068860_1004218462 | 266 |
| 204 | 3300005843 | Ga0068860_100628635 | Ga0068860_1006286352 | 266 |
| 205 | 3300005844 | Ga0068862_100769798 | Ga0068862_1007697981 | 266 |
| 206 | 3300006237 | Ga0097621_100164788 | Ga0097621_1001647883 | 266 |
| 207 | 3300006358 | Ga0068871_100169865 | Ga0068871_1001698653 | 266 |
| 208 | 3300006881 | Ga0068865_100079489 | Ga0068865_1000794893 | 266 |
| 209 | 3300006881 | Ga0068865_100151435 | Ga0068865_1001514351 | 266 |
| 210 | 3300009093 | Ga0105240_10148130 | Ga0105240_101481303 | 266 |
| 211 | 3300009093 | Ga0105240_10206642 | Ga0105240_102066422 | 266 |
| 212 | 3300009093 | Ga0105240_10234348 | Ga0105240_102343482 | 266 |
| 213 | 3300009093 | Ga0105240_10239666 | Ga0105240_102396661 | 266 |
| 214 | 3300009093 | Ga0105240_10270712 | Ga0105240_102707121 | 266 |
| 215 | 3300009098 | Ga0105245_10077869 | Ga0105245_100778692 | 266 |
| 216 | 3300009148 | Ga0105243_10003266 | Ga0105243_100032666 | 266 |
| 217 | 3300009174 | Ga0105241_10012391 | Ga0105241_100123915 | 266 |
| 218 | 3300009174 | Ga0105241_10439939 | Ga0105241_104399392 | 266 |
| 219 | 3300009177 | Ga0105248_10030181 | Ga0105248_100301814 | 266 |
| 220 | 3300009177 | Ga0105248_10240051 | Ga0105248_102400512 | 266 |
| 221 | 3300009545 | Ga0105237_10044881 | Ga0105237_100448813 | 266 |
| 222 | 3300009545 | Ga0105237_10123972 | Ga0105237_101239723 | 266 |
| 223 | 3300009551 | Ga0105238_10033513 | Ga0105238_100335132 | 266 |
| 224 | 3300009551 | Ga0105238_10044290 | Ga0105238_100442903 | 266 |
| 225 | 3300009551 | Ga0105238_10713926 | Ga0105238_107139261 | 266 |
| 226 | 3300010375 | Ga0105239_10058604 | Ga0105239_100586046 | 266 |
| 227 | 3300010375 | Ga0105239_10097850 | Ga0105239_100978503 | 266 |
| 228 | 3300010375 | Ga0105239_10270660 | Ga0105239_102706602 | 266 |
| 229 | 3300011119 | Ga0105246_10014991 | Ga0105246_100149913 | 266 |
| 230 | 3300011119 | Ga0105246_10031519 | Ga0105246_100315193 | 266 |
| 231 | 3300013104 | Ga0157370_10029941 | Ga0157370_100299412 | 266 |
| 232 | 3300013104 | Ga0157370_10101915 | Ga0157370_101019153 | 266 |
| 233 | 3300013105 | Ga0157369_10100612 | Ga0157369_101006123 | 266 |
| 234 | 3300013297 | Ga0157378_10007224 | Ga0157378_100072245 | 266 |
| 235 | 3300013297 | Ga0157378_10052517 | Ga0157378_100525173 | 266 |
| 236 | 3300013306 | Ga0163162_10084614 | Ga0163162_100846143 | 266 |
| 237 | 3300014325 | Ga0163163_10000111 | Ga0163163_1000011147 | 266 |
| 238 | 3300014325 | Ga0163163_10011217 | Ga0163163_100112177 | 266 |
| 239 | 3300014325 | Ga0163163_10132798 | Ga0163163_101327983 | 266 |
| 240 | 3300014968 | Ga0157379_10017776 | Ga0157379_100177767 | 266 |
| 241 | 3300014968 | Ga0157379_10024393 | Ga0157379_100243933 | 266 |
| 242 | 3300014968 | Ga0157379_10076267 | Ga0157379_100762672 | 266 |
| 243 | 3300014968 | Ga0157379_10145311 | Ga0157379_101453112 | 266 |
| 244 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013250 | 266 |
| 245 | 3300025297 | Ga0209758_1000036 | Ga0209758_1000036218 | 266 |
| 246 | 3300025899 | Ga0207642_10060373 | Ga0207642_100603732 | 266 |
| 247 | 3300025903 | Ga0207680_10134231 | Ga0207680_101342311 | 266 |
| 248 | 3300025907 | Ga0207645_10256725 | Ga0207645_102567251 | 266 |
| 249 | 3300025909 | Ga0207705_10001483 | Ga0207705_1000148316 | 266 |
| 250 | 3300025911 | Ga0207654_10028410 | Ga0207654_100284101 | 266 |
| 251 | 3300025912 | Ga0207707_10147227 | Ga0207707_101472272 | 266 |
| 252 | 3300025912 | Ga0207707_10162608 | Ga0207707_101626082 | 266 |
| 253 | 3300025913 | Ga0207695_10077258 | Ga0207695_100772583 | 266 |
| 254 | 3300025913 | Ga0207695_10316648 | Ga0207695_103166482 | 266 |
| 255 | 3300025914 | Ga0207671_10083607 | Ga0207671_100836072 | 266 |
| 256 | 3300025914 | Ga0207671_10122458 | Ga0207671_101224581 | 266 |
| 257 | 3300025917 | Ga0207660_10262077 | Ga0207660_102620772 | 266 |
| 258 | 3300025919 | Ga0207657_10031080 | Ga0207657_100310805 | 266 |
| 259 | 3300025920 | Ga0207649_10179402 | Ga0207649_101794022 | 266 |
| 260 | 3300025921 | Ga0207652_10005445 | Ga0207652_100054456 | 266 |
| 261 | 3300025924 | Ga0207694_10410120 | Ga0207694_104101201 | 266 |
| 262 | 3300025926 | Ga0207659_10019312 | Ga0207659_100193123 | 266 |
| 263 | 3300025927 | Ga0207687_10029495 | Ga0207687_100294954 | 266 |
| 264 | 3300025927 | Ga0207687_10062983 | Ga0207687_100629832 | 266 |
| 265 | 3300025931 | Ga0207644_10156048 | Ga0207644_101560482 | 266 |
| 266 | 3300025932 | Ga0207690_10049646 | Ga0207690_100496463 | 266 |
| 267 | 3300025934 | Ga0207686_10116738 | Ga0207686_101167382 | 266 |
| 268 | 3300025934 | Ga0207686_10286731 | Ga0207686_102867312 | 266 |
| 269 | 3300025935 | Ga0207709_10002218 | Ga0207709_100022187 | 266 |
| 270 | 3300025938 | Ga0207704_10500778 | Ga0207704_105007781 | 266 |
| 271 | 3300025940 | Ga0207691_10037819 | Ga0207691_100378193 | 266 |
| 272 | 3300025941 | Ga0207711_10049962 | Ga0207711_100499623 | 266 |
| 273 | 3300025942 | Ga0207689_10069946 | Ga0207689_100699463 | 266 |
| 274 | 3300025949 | Ga0207667_10051833 | Ga0207667_100518333 | 266 |
| 275 | 3300025949 | Ga0207667_10076553 | Ga0207667_100765533 | 266 |
| 276 | 3300025960 | Ga0207651_10064612 | Ga0207651_100646123 | 266 |
| 277 | 3300025961 | Ga0207712_10055505 | Ga0207712_100555051 | 266 |
| 278 | 3300026023 | Ga0207677_10073918 | Ga0207677_100739181 | 266 |
| 279 | 3300026023 | Ga0207677_10155776 | Ga0207677_101557762 | 266 |
| 280 | 3300026035 | Ga0207703_10002958 | Ga0207703_1000295811 | 266 |
| 281 | 3300026035 | Ga0207703_10177537 | Ga0207703_101775372 | 266 |
| 282 | 3300026078 | Ga0207702_10046001 | Ga0207702_100460011 | 266 |
| 283 | 3300026078 | Ga0207702_10314861 | Ga0207702_103148612 | 266 |
| 284 | 3300026089 | Ga0207648_10026224 | Ga0207648_100262248 | 266 |
| 285 | 3300026089 | Ga0207648_10108325 | Ga0207648_101083253 | 266 |
| 286 | 3300026089 | Ga0207648_10146630 | Ga0207648_101466302 | 266 |
| 287 | 3300026095 | Ga0207676_10126093 | Ga0207676_101260933 | 266 |
| 288 | 3300026095 | Ga0207676_10644006 | Ga0207676_106440061 | 266 |
| 289 | 3300026116 | Ga0207674_10088583 | Ga0207674_100885832 | 266 |
| 290 | 3300026116 | Ga0207674_10286064 | Ga0207674_102860641 | 266 |
| 291 | 3300026121 | Ga0207683_10021308 | Ga0207683_100213082 | 266 |
| 292 | 3300026142 | Ga0207698_10437513 | Ga0207698_104375132 | 266 |
| 293 | 3300028379 | Ga0268266_10002680 | Ga0268266_1000268013 | 266 |
| 294 | 3300028379 | Ga0268266_10005907 | Ga0268266_100059076 | 266 |
| 295 | 3300028379 | Ga0268266_10023201 | Ga0268266_100232014 | 266 |
| 296 | 3300028379 | Ga0268266_10227263 | Ga0268266_102272632 | 266 |
| 297 | 3300028380 | Ga0268265_10715405 | Ga0268265_107154051 | 266 |
| 298 | 3300028381 | Ga0268264_10095289 | Ga0268264_100952893 | 266 |
| 299 | 3300028800 | Ga0265338_10003602 | Ga0265338_1000360210 | 266 |
| 300 | 3300031238 | Ga0265332_10044686 | Ga0265332_100446862 | 266 |
| 301 | 3300031247 | Ga0265340_10085525 | Ga0265340_100855252 | 266 |
| 302 | 3300031595 | Ga0265313_10091230 | Ga0265313_100912301 | 266 |
| 303 | 3300037418 | Ga0395900_0022307 | Ga0395900_0022307_4041_4859 | 266 |
| 304 | 3300046529 | Ga0495652_0376903 | Ga0495652_0376903_143_958 | 266 |
| 305 | 3300046538 | Ga0495609_0055358 | Ga0495609_0055358_799_1608 | 266 |
| 306 | 3300048907 | Ga0496104_0355330 | Ga0496104_0355330_91_924 | 266 |
| 307 | 3300048929 | Ga0496126_0305111 | Ga0496126_0305111_336_1142 | 266 |
| 308 | 3300049570 | Ga0501033_0015038 | Ga0501033_0015038_3190_3996 | 266 |
| 309 | 3300049570 | Ga0501033_0090547 | Ga0501033_0090547_1327_2139 | 266 |
| 310 | 3300049570 | Ga0501033_0105952 | Ga0501033_0105952_821_1678 | 266 |
| 311 | 3300049574 | Ga0501038_0276858 | Ga0501038_0276858_336_1142 | 266 |
| 312 | 3300049579 | Ga0501043_0184515 | Ga0501043_0184515_651_1484 | 266 |
| 313 | 3300049579 | Ga0501043_0230965 | Ga0501043_0230965_409_1215 | 266 |
| 314 | 3300049580 | Ga0501046_0034820 | Ga0501046_0034820_258_1115 | 266 |
| 315 | 3300049581 | Ga0501047_0003221 | Ga0501047_0003221_8278_9135 | 266 |
| 316 | 3300049581 | Ga0501047_0026719 | Ga0501047_0026719_2138_2944 | 266 |
| 317 | 3300049581 | Ga0501047_0221337 | Ga0501047_0221337_720_1553 | 266 |
| 318 | 3300049822 | Ga0501035_0158373 | Ga0501035_0158373_858_1664 | 266 |
| 319 | 3300049823 | Ga0501044_0005359 | Ga0501044_0005359_38_895 | 266 |
| 320 | 3300049823 | Ga0501044_0008325 | Ga0501044_0008325_5311_6117 | 266 |
| 321 | 3300049823 | Ga0501044_0225819 | Ga0501044_0225819_751_1563 | 266 |
| 322 | 3300053090 | Ga0500646_0018302 | Ga0500646_0018302_251_1075 | 266 |
| 323 | 3300053119 | Ga0500595_001130 | Ga0500595_001130_9029_9844 | 266 |
| 324 | 3300053139 | Ga0500568_0016389 | Ga0500568_0016389_1723_2529 | 266 |
| 325 | 3300053139 | Ga0500568_0101364 | Ga0500568_0101364_160_984 | 266 |
| 326 | 3300053140 | Ga0500573_0000003 | Ga0500573_0000003_152426_153241 | 266 |
| 327 | 3300053151 | Ga0500604_0105290 | Ga0500604_0105290_19_843 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ae0-assembly2.cif.gz_B | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate | 0.8372 | 1 | 263 |
| 3vje-assembly2.cif.gz_B | crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a | 0.8338 | 1 | 263 |
| 3adz-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp | 0.8302 | 4 | 263 |
| 4ea1-assembly1.cif.gz_A | co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109 | 0.83 | 1 | 263 |
| 3ae0-assembly2.cif.gz_B | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate | 0.8258 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q17477_122_396_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8768 | 2 | 242 | 1.10.600.10 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8728 | 6 | 257 | 1.10.600.10 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.863 | 6 | 257 | 1.10.600.10 |
| af_B4FPS7_5_269_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8589 | 4 | 246 | 1.10.600.10 |
| af_Q54E48_68_332_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8474 | 2 | 257 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9S8R0-F1-model_v4 | Squalene/phytoene synthase family protein | 0.9974 | 1 | 266 |
GO:0005737
GO:0009058 GO:0043231 |
| AF-A0A1M3A8J6-F1-model_v4 | deleted | 0.9472 | 1 | 266 |
|
| AF-A0A433PF69-F1-model_v4 | Squalene/phytoene synthase-domain-containing protein | 0.9441 | 9 | 184 |
GO:0005743
GO:0009058 |
| AF-A0A1M3A8J6-F1-model_v4 | deleted | 0.9437 | 1 | 266 |
|
| AF-A0A1A8SNG7-F1-model_v4 | NADH dehydrogenase (Ubiquinone) complex I, assembly factor 6 | 0.939 | 23 | 167 |
GO:0005743
GO:0009058 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar