F408838

General Info

Members Datasets Scaffolds Average Seq Length
327 169 327 269

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10029551|Ga0265338_100295514
Length 305
Sequence MLLQRAALSKPNKSSAAPRLRVSPFLLWTGLERRMDSLDVSIRKADEDRYFAALFAPADRRGGLFALYALNHELARIAETVREPMMGAIRLQWWRETIECARAGNPREHPVALALAELFKRHDLPQSLFDTMIDAREMDAAVHIFPDLPALENYADATSGNLMRLAGRLLGGADDNLAREVGIAYALTGILRAIPFHAARGKVYLPEDLLRAAGTSQADLIGTHSGKKLAPVIARVANAARAHFAKARAFRPPKQALSAFLPAATAPLYLKRVTPPNFDAFKDEVSVPLFRRQLAMLRANWRGRL

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 0.31
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000425 3300003214 Bacteria 43589
2 JGI25153J46596_10001493 3300003215 Bacteria 13955
3 rootH2_10051869 3300003320 Bacteria 8526
4 Ga0070658_10005088 3300005327 Bacteria 10697
5 Ga0070658_10040543 3300005327 Bacteria 3757
6 Ga0070658_10316312 3300005327 Bacteria 1332
7 Ga0070683_100280983 3300005329 Bacteria 1583
8 Ga0070690_100130982 3300005330 Bacteria 1694
9 Ga0068869_100003098 3300005334 Bacteria 10135
10 Ga0070666_10095697 3300005335 Bacteria 2044
11 Ga0070680_100008480 3300005336 Bacteria 7870
12 Ga0068868_100129718 3300005338 Bacteria 2062
13 Ga0068868_100199032 3300005338 Bacteria 1669
14 Ga0068868_100228678 3300005338 Bacteria 1560
15 Ga0070661_100184497 3300005344 Bacteria 1589
16 Ga0070675_100027852 3300005354 Bacteria 4543
17 Ga0070671_100188351 3300005355 Bacteria 1748
18 Ga0070673_100061252 3300005364 Bacteria 2985
19 Ga0070673_100121434 3300005364 Bacteria 2180
20 Ga0070659_100014081 3300005366 Bacteria 5969
21 Ga0070667_100088412 3300005367 Bacteria 2660
22 Ga0070667_100242811 3300005367 Bacteria 1609
23 Ga0070709_10005845 3300005434 Bacteria 6671
24 Ga0070714_100014233 3300005435 Bacteria 6388
25 Ga0070714_100016661 3300005435 Bacteria 5940
26 Ga0070713_100000003 3300005436 Bacteria 245840
27 Ga0070713_100060003 3300005436 Bacteria 3179
28 Ga0070711_100148170 3300005439 Bacteria 1767
29 Ga0070705_100089673 3300005440 Bacteria 1912
30 Ga0070663_100117198 3300005455 Bacteria 2008
31 Ga0070678_100013030 3300005456 Bacteria 5196
32 Ga0070678_100053499 3300005456 Bacteria 2936
33 Ga0070678_100229984 3300005456 Bacteria 1545
34 Ga0070681_10047413 3300005458 Bacteria 4295
35 Ga0070681_10296172 3300005458 Bacteria 1528
36 Ga0068867_100044290 3300005459 Bacteria 3260
37 Ga0068867_100066650 3300005459 Bacteria 2682
38 Ga0068867_100167130 3300005459 Bacteria 1739
39 Ga0070679_100009547 3300005530 Bacteria 9177
40 Ga0070679_100379375 3300005530 Bacteria 1361
41 Ga0068853_100372377 3300005539 Bacteria 1333
42 Ga0068853_100507117 3300005539 Bacteria 1139
43 Ga0070693_100181581 3300005547 Bacteria 1355
44 Ga0070693_100260168 3300005547 Unclassified 1154
45 Ga0070665_100010246 3300005548 Bacteria 9485
46 Ga0070665_100012139 3300005548 Bacteria 8688
47 Ga0070665_100022755 3300005548 Bacteria 6309
48 Ga0070665_100039508 3300005548 Bacteria 4744
49 Ga0070665_100206836 3300005548 Bacteria 1963
50 Ga0068855_100015988 3300005563 Bacteria 9025
51 Ga0068855_100027286 3300005563 Bacteria 6833
52 Ga0068855_100039414 3300005563 Bacteria 5608
53 Ga0068855_100217105 3300005563 Bacteria 2146
54 Ga0068855_100276838 3300005563 Bacteria 1865
55 Ga0068855_100301691 3300005563 Bacteria 1774
56 Ga0068855_100506991 3300005563 Unclassified 1310
57 Ga0068857_100112291 3300005577 Bacteria 2450
58 Ga0068854_100193652 3300005578 Bacteria 1594
59 Ga0068854_100237046 3300005578 Bacteria 1451
60 Ga0068856_100001113 3300005614 Bacteria 28416
61 Ga0068856_100041021 3300005614 Bacteria 4548
62 Ga0068856_100097797 3300005614 Bacteria 2924
63 Ga0068856_100601429 3300005614 Bacteria 1121
64 Ga0068852_100283528 3300005616 Bacteria 1598
65 Ga0068864_100137354 3300005618 Bacteria 2202
66 Ga0068858_100084440 3300005842 Bacteria 2953
67 Ga0068858_100109083 3300005842 Bacteria 2584
68 Ga0068860_100265301 3300005843 Bacteria 1675
69 Ga0068860_100421846 3300005843 Bacteria 1323
70 Ga0068860_100628635 3300005843 Bacteria 1081
71 Ga0068862_100769798 3300005844 Unclassified 938
72 Ga0070716_100044338 3300006173 Bacteria 2491
73 Ga0070712_100022190 3300006175 Bacteria 4178
74 Ga0097621_100164788 3300006237 Bacteria 1908
75 Ga0068871_100169865 3300006358 Bacteria 1869
76 Ga0075434_100011244 3300006871 Bacteria 8429
77 Ga0068865_100079489 3300006881 Bacteria 2349
78 Ga0068865_100151435 3300006881 Bacteria 1760
79 Ga0075436_100000113 3300006914 Bacteria 47637
80 Ga0105240_10047018 3300009093 Bacteria 5463
81 Ga0105240_10088737 3300009093 Bacteria 3783
82 Ga0105240_10148130 3300009093 Bacteria 2799
83 Ga0105240_10203160 3300009093 Bacteria 2321
84 Ga0105240_10206642 3300009093 Bacteria 2298
85 Ga0105240_10234348 3300009093 Bacteria 2131
86 Ga0105240_10239666 3300009093 Bacteria 2103
87 Ga0105240_10270712 3300009093 Bacteria 1956
88 Ga0105245_10077869 3300009098 Bacteria 3024
89 Ga0105245_10202067 3300009098 Bacteria 1909
90 Ga0105243_10003266 3300009148 Bacteria 13205
91 Ga0105241_10012391 3300009174 Bacteria 6248
92 Ga0105241_10196294 3300009174 Bacteria 1683
93 Ga0105241_10439939 3300009174 Bacteria 1151
94 Ga0105242_10027852 3300009176 Bacteria 4492
95 Ga0105248_10030181 3300009177 Bacteria 6052
96 Ga0105248_10240051 3300009177 Bacteria 2040
97 Ga0105237_10038275 3300009545 Bacteria 4843
98 Ga0105237_10044881 3300009545 Bacteria 4450
99 Ga0105237_10123972 3300009545 Bacteria 2578
100 Ga0105238_10033513 3300009551 Bacteria 5227
101 Ga0105238_10044290 3300009551 Bacteria 4499
102 Ga0105238_10232963 3300009551 Bacteria 1818
103 Ga0105238_10713926 3300009551 Bacteria 1015
104 Ga0105239_10058604 3300010375 Bacteria 4226
105 Ga0105239_10097850 3300010375 Bacteria 3243
106 Ga0105239_10106173 3300010375 Bacteria 3111
107 Ga0105239_10270660 3300010375 Bacteria 1910
108 Ga0105239_10791691 3300010375 Bacteria 1086
109 Ga0105246_10014991 3300011119 Bacteria 4884
110 Ga0105246_10031519 3300011119 Bacteria 3509
111 Ga0157370_10020121 3300013104 Bacteria 6673
112 Ga0157370_10029941 3300013104 Bacteria 5336
113 Ga0157370_10101915 3300013104 Bacteria 2689
114 Ga0157369_10100612 3300013105 Bacteria 3081
115 Ga0157369_10289540 3300013105 Bacteria 1705
116 Ga0157374_10161150 3300013296 Bacteria 2185
117 Ga0157378_10007224 3300013297 Bacteria 9702
118 Ga0157378_10052517 3300013297 Bacteria 3626
119 Ga0157378_10216691 3300013297 Bacteria 1818
120 Ga0163162_10084614 3300013306 Bacteria 3248
121 Ga0163162_10205139 3300013306 Bacteria 2100
122 Ga0157372_10020017 3300013307 Bacteria 7215
123 Ga0157375_10195264 3300013308 Bacteria 2179
124 Ga0163163_10000111 3300014325 Bacteria 86620
125 Ga0163163_10011217 3300014325 Bacteria 8120
126 Ga0163163_10132798 3300014325 Bacteria 2529
127 Ga0163163_10525267 3300014325 Unclassified 1246
128 Ga0157379_10013093 3300014968 Bacteria 7263
129 Ga0157379_10017776 3300014968 Bacteria 6263
130 Ga0157379_10024393 3300014968 Bacteria 5369
131 Ga0157379_10076267 3300014968 Bacteria 3002
132 Ga0157379_10145311 3300014968 Bacteria 2139
133 Ga0157376_10296854 3300014969 Bacteria 1528
134 Ga0157376_10486678 3300014969 Unclassified 1210
135 Ga0209233_1000013 3300025261 Bacteria 1013785
136 Ga0209233_1002143 3300025261 Bacteria 7418
137 Ga0209758_1000036 3300025297 Bacteria 441671
138 Ga0207642_10060373 3300025899 Bacteria 1758
139 Ga0207680_10134231 3300025903 Bacteria 1634
140 Ga0207699_10000159 3300025906 Bacteria 42165
141 Ga0207645_10256725 3300025907 Bacteria 1157
142 Ga0207705_10000092 3300025909 Bacteria 109488
143 Ga0207705_10001483 3300025909 Bacteria 18695
144 Ga0207654_10028410 3300025911 Bacteria 3049
145 Ga0207654_10130253 3300025911 Bacteria 1591
146 Ga0207707_10004556 3300025912 Bacteria 12184
147 Ga0207707_10147227 3300025912 Bacteria 2059
148 Ga0207707_10162608 3300025912 Bacteria 1952
149 Ga0207707_10313250 3300025912 Unclassified 1356
150 Ga0207695_10006268 3300025913 Bacteria 15485
151 Ga0207695_10077258 3300025913 Bacteria 3383
152 Ga0207695_10316648 3300025913 Bacteria 1450
153 Ga0207671_10083607 3300025914 Bacteria 2397
154 Ga0207671_10098551 3300025914 Bacteria 2211
155 Ga0207671_10122458 3300025914 Bacteria 1989
156 Ga0207693_10002532 3300025915 Bacteria 15883
157 Ga0207663_10188336 3300025916 Bacteria 1480
158 Ga0207660_10005842 3300025917 Bacteria 7986
159 Ga0207660_10262077 3300025917 Bacteria 1367
160 Ga0207657_10031080 3300025919 Bacteria 4841
161 Ga0207657_10519542 3300025919 Unclassified 932
162 Ga0207649_10179402 3300025920 Bacteria 1481
163 Ga0207652_10000892 3300025921 Bacteria 28252
164 Ga0207652_10005445 3300025921 Bacteria 10330
165 Ga0207652_10118419 3300025921 Bacteria 2354
166 Ga0207694_10354178 3300025924 Bacteria 1215
167 Ga0207694_10410120 3300025924 Unclassified 1127
168 Ga0207659_10019312 3300025926 Bacteria 4484
169 Ga0207687_10029495 3300025927 Bacteria 3691
170 Ga0207687_10062983 3300025927 Bacteria 2624
171 Ga0207700_10000010 3300025928 Bacteria 298473
172 Ga0207664_10005602 3300025929 Bacteria 8594
173 Ga0207664_10058319 3300025929 Bacteria 3071
174 Ga0207644_10156048 3300025931 Bacteria 1770
175 Ga0207690_10049646 3300025932 Bacteria 2798
176 Ga0207690_10055276 3300025932 Bacteria 2673
177 Ga0207686_10116738 3300025934 Bacteria 1809
178 Ga0207686_10286731 3300025934 Bacteria 1218
179 Ga0207709_10002218 3300025935 Bacteria 12386
180 Ga0207704_10500778 3300025938 Bacteria 979
181 Ga0207665_10079119 3300025939 Bacteria 2259
182 Ga0207691_10037819 3300025940 Bacteria 4467
183 Ga0207711_10049962 3300025941 Bacteria 3580
184 Ga0207689_10069946 3300025942 Bacteria 2884
185 Ga0207667_10051833 3300025949 Bacteria 4324
186 Ga0207667_10076553 3300025949 Bacteria 3472
187 Ga0207667_10184078 3300025949 Bacteria 2145
188 Ga0207651_10064612 3300025960 Bacteria 2562
189 Ga0207712_10055505 3300025961 Bacteria 2787
190 Ga0207677_10073918 3300026023 Bacteria 2416
191 Ga0207677_10155776 3300026023 Bacteria 1769
192 Ga0207703_10002958 3300026035 Bacteria 14408
193 Ga0207703_10177537 3300026035 Bacteria 1877
194 Ga0207702_10000013 3300026078 Bacteria 257468
195 Ga0207702_10046001 3300026078 Bacteria 3673
196 Ga0207702_10314861 3300026078 Bacteria 1489
197 Ga0207648_10026224 3300026089 Bacteria 5180
198 Ga0207648_10108325 3300026089 Bacteria 2439
199 Ga0207648_10146630 3300026089 Bacteria 2082
200 Ga0207676_10126093 3300026095 Bacteria 2168
201 Ga0207676_10644006 3300026095 Bacteria 1022
202 Ga0207674_10050669 3300026116 Bacteria 4240
203 Ga0207674_10088583 3300026116 Bacteria 3088
204 Ga0207674_10286064 3300026116 Bacteria 1597
205 Ga0207683_10021308 3300026121 Bacteria 5547
206 Ga0207683_10034533 3300026121 Bacteria 4395
207 Ga0207698_10437513 3300026142 Bacteria 1259
208 Ga0268266_10002680 3300028379 Bacteria 18712
209 Ga0268266_10005907 3300028379 Bacteria 11323
210 Ga0268266_10023201 3300028379 Bacteria 5284
211 Ga0268266_10227263 3300028379 Bacteria 1717
212 Ga0268265_10715405 3300028380 Unclassified 969
213 Ga0268264_10095289 3300028381 Bacteria 2575
214 Ga0265318_10065271 3300028577 Bacteria 1354
215 Ga0265338_10003602 3300028800 Bacteria 21622
216 Ga0265338_10029551 3300028800 Bacteria 5428
217 Ga0265338_10145123 3300028800 Bacteria 1853
218 Ga0265338_10148426 3300028800 Bacteria 1825
219 Ga0265338_10219206 3300028800 Unclassified 1422
220 Ga0265332_10044686 3300031238 Bacteria 1910
221 Ga0265325_10000413 3300031241 Bacteria 30484
222 Ga0265325_10002804 3300031241 Bacteria 11626
223 Ga0265340_10002678 3300031247 Bacteria 10128
224 Ga0265340_10085525 3300031247 Bacteria 1480
225 Ga0265339_10003504 3300031249 Bacteria 10962
226 Ga0265339_10106813 3300031249 Bacteria 1452
227 Ga0265331_10055147 3300031250 Bacteria 1891
228 Ga0265316_10121613 3300031344 Bacteria 1971
229 Ga0265313_10000660 3300031595 Bacteria 35564
230 Ga0265313_10003294 3300031595 Bacteria 13231
231 Ga0265313_10038532 3300031595 Bacteria 2379
232 Ga0265313_10091230 3300031595 Unclassified 1368
233 Ga0265314_10124972 3300031711 Bacteria 1613
234 Ga0265314_10247567 3300031711 Bacteria 1025
235 Ga0373933_0221187 3300035724 Unclassified 1215
236 Ga0373925_0249569 3300037068 Bacteria 1423
237 Ga0395899_0110143 3300037312 Bacteria 1981
238 Ga0395900_0022307 3300037418 Bacteria 6477
239 Ga0395901_0049097 3300038443 Bacteria 4384
240 Ga0436365_1926500 3300039437 Bacteria 1393
241 Ga0495582_0146289 3300046473 Bacteria 1341
242 Ga0495652_0376903 3300046529 Unclassified 1010
243 Ga0495587_0047144 3300046536 Bacteria 2556
244 Ga0495609_0055358 3300046538 Bacteria 1760
245 Ga0495611_0102060 3300046648 Bacteria 1333
246 Ga0495625_0156718 3300046660 Bacteria 1528
247 Ga0495675_0133233 3300047444 Bacteria 1544
248 Ga0495602_0088981 3300048088 Bacteria 2569
249 Ga0496104_0355330 3300048907 Bacteria 1378
250 Ga0496126_0001513 3300048929 Bacteria 35899
251 Ga0496126_0305111 3300048929 Bacteria 1312
252 Ga0501031_0002127 3300049568 Bacteria 12497
253 Ga0501032_0041632 3300049569 Bacteria 3118
254 Ga0501033_0003945 3300049570 Bacteria 12027
255 Ga0501033_0015038 3300049570 Bacteria 5873
256 Ga0501033_0043351 3300049570 Bacteria 3351
257 Ga0501033_0090547 3300049570 Bacteria 2238
258 Ga0501033_0105952 3300049570 Bacteria 2048
259 Ga0501033_0131825 3300049570 Bacteria 1810
260 Ga0501034_0004847 3300049571 Bacteria 14856
261 Ga0501034_0120187 3300049571 Bacteria 2614
262 Ga0501034_0331296 3300049571 Unclassified 1454
263 Ga0501036_0004049 3300049572 Bacteria 11785
264 Ga0501037_0002141 3300049573 Bacteria 14291
265 Ga0501037_0047476 3300049573 Bacteria 3147
266 Ga0501038_0086165 3300049574 Bacteria 2640
267 Ga0501038_0097405 3300049574 Bacteria 2454
268 Ga0501038_0276858 3300049574 Bacteria 1322
269 Ga0501043_0024083 3300049579 Bacteria 4777
270 Ga0501043_0043621 3300049579 Bacteria 3525
271 Ga0501043_0060145 3300049579 Bacteria 2981
272 Ga0501043_0184515 3300049579 Bacteria 1625
273 Ga0501043_0230965 3300049579 Bacteria 1429
274 Ga0501046_0002196 3300049580 Bacteria 18436
275 Ga0501046_0034820 3300049580 Bacteria 4062
276 Ga0501046_0036190 3300049580 Bacteria 3975
277 Ga0501047_0003221 3300049581 Bacteria 15472
278 Ga0501047_0004336 3300049581 Bacteria 13356
279 Ga0501047_0026719 3300049581 Bacteria 5556
280 Ga0501047_0221337 3300049581 Bacteria 1749
281 Ga0501047_0281559 3300049581 Unclassified 1507
282 Ga0501047_0537854 3300049581 Bacteria 993
283 Ga0501048_0001595 3300049582 Bacteria 17213
284 Ga0501048_0257827 3300049582 Bacteria 1239
285 Ga0501067_0007014 3300049583 Bacteria 6256
286 Ga0501068_0149862 3300049584 Unclassified 1465
287 Ga0501069_0070383 3300049585 Bacteria 1959
288 Ga0501070_0000109 3300049586 Bacteria 72583
289 Ga0501070_0038503 3300049586 Bacteria 3989
290 Ga0501073_0008771 3300049589 Bacteria 7483
291 Ga0501074_0001610 3300049590 Bacteria 15287
292 Ga0501079_0001965 3300049741 Bacteria 14735
293 Ga0501080_0055866 3300049742 Bacteria 3677
294 Ga0501080_0071913 3300049742 Bacteria 3218
295 Ga0501083_0030458 3300049744 Bacteria 3707
296 Ga0501083_0049495 3300049744 Bacteria 2832
297 Ga0501035_0008525 3300049822 Bacteria 9543
298 Ga0501035_0071374 3300049822 Bacteria 3074
299 Ga0501035_0092167 3300049822 Bacteria 2666
300 Ga0501035_0158373 3300049822 Bacteria 1961
301 Ga0501035_0188988 3300049822 Bacteria 1771
302 Ga0501035_0198305 3300049822 Bacteria 1723
303 Ga0501044_0005359 3300049823 Bacteria 14252
304 Ga0501044_0008325 3300049823 Bacteria 11365
305 Ga0501044_0008620 3300049823 Bacteria 11166
306 Ga0501044_0008931 3300049823 Bacteria 10955
307 Ga0501044_0025782 3300049823 Bacteria 6232
308 Ga0501044_0042251 3300049823 Bacteria 4742
309 Ga0501044_0044713 3300049823 Bacteria 4593
310 Ga0501044_0051080 3300049823 Bacteria 4264
311 Ga0501044_0106469 3300049823 Bacteria 2816
312 Ga0501044_0121823 3300049823 Bacteria 2608
313 Ga0501044_0225819 3300049823 Bacteria 1822
314 Ga0501045_0207524 3300049824 Unclassified 1459
315 nmdc:mga0n895_12885_c1 3300050512 Bacteria 7514
316 nmdc:mga08x19_140_c1 3300050514 Bacteria 64178
317 Ga0500643_000014 3300053087 Bacteria 318249
318 Ga0500646_0018302 3300053090 Bacteria 1844
319 Ga0500595_001130 3300053119 Bacteria 14796
320 Ga0500568_0016389 3300053139 Bacteria 3297
321 Ga0500568_0101364 3300053139 Bacteria 1080
322 Ga0500573_0000003 3300053140 Bacteria 355643
323 Ga0500604_0105290 3300053151 Bacteria 933
324 Ga0501084_0005458 3300054114 Bacteria 10431
325 Ga0501082_0006508 3300060353 Bacteria 10128
326 Ga0501082_0026545 3300060353 Bacteria 4992
327 Ga0501082_0430222 3300060353 Unclassified 1153

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0430222 Ga0501082_0430222_23_727 223
2 3300028800 Ga0265338_10148426 Ga0265338_101484262 239
3 3300031241 Ga0265325_10000413 Ga0265325_100004138 239
4 3300031249 Ga0265339_10003504 Ga0265339_100035043 239
5 3300031344 Ga0265316_10121613 Ga0265316_101216132 239
6 3300031595 Ga0265313_10003294 Ga0265313_100032947 239
7 3300049823 Ga0501044_0008620 Ga0501044_0008620_6253_7068 240
8 3300005336 Ga0070680_100008480 Ga0070680_1000084808 241
9 3300005366 Ga0070659_100014081 Ga0070659_1000140815 241
10 3300005455 Ga0070663_100117198 Ga0070663_1001171982 241
11 3300005563 Ga0068855_100027286 Ga0068855_1000272868 241
12 3300005578 Ga0068854_100193652 Ga0068854_1001936521 241
13 3300013104 Ga0157370_10020121 Ga0157370_100201219 241
14 3300013307 Ga0157372_10020017 Ga0157372_100200173 241
15 3300025912 Ga0207707_10004556 Ga0207707_100045568 241
16 3300025917 Ga0207660_10005842 Ga0207660_100058428 241
17 3300025921 Ga0207652_10000892 Ga0207652_100008928 241
18 3300025932 Ga0207690_10055276 Ga0207690_100552762 241
19 3300009093 Ga0105240_10203160 Ga0105240_102031603 244
20 3300046473 Ga0495582_0146289 Ga0495582_0146289_129_1001 244
21 3300025909 Ga0207705_10000092 Ga0207705_1000009269 249
22 3300049742 Ga0501080_0071913 Ga0501080_0071913_1863_2630 253
23 3300038443 Ga0395901_0049097 Ga0395901_0049097_3584_4366 254
24 3300049568 Ga0501031_0002127 Ga0501031_0002127_6640_7413 255
25 3300049569 Ga0501032_0041632 Ga0501032_0041632_918_1691 255
26 3300049570 Ga0501033_0003945 Ga0501033_0003945_9559_10332 255
27 3300049571 Ga0501034_0004847 Ga0501034_0004847_9896_10669 255
28 3300049572 Ga0501036_0004049 Ga0501036_0004049_5273_6046 255
29 3300049573 Ga0501037_0002141 Ga0501037_0002141_5485_6258 255
30 3300049579 Ga0501043_0060145 Ga0501043_0060145_1646_2419 255
31 3300049580 Ga0501046_0002196 Ga0501046_0002196_4978_5751 255
32 3300049582 Ga0501048_0001595 Ga0501048_0001595_15158_15931 255
33 3300049583 Ga0501067_0007014 Ga0501067_0007014_3476_4249 255
34 3300049584 Ga0501068_0149862 Ga0501068_0149862_460_1233 255
35 3300049585 Ga0501069_0070383 Ga0501069_0070383_266_1039 255
36 3300049586 Ga0501070_0038503 Ga0501070_0038503_2532_3305 255
37 3300049589 Ga0501073_0008771 Ga0501073_0008771_3234_4007 255
38 3300049590 Ga0501074_0001610 Ga0501074_0001610_4444_5217 255
39 3300049741 Ga0501079_0001965 Ga0501079_0001965_5740_6513 255
40 3300049744 Ga0501083_0030458 Ga0501083_0030458_1273_2046 255
41 3300049822 Ga0501035_0071374 Ga0501035_0071374_1745_2518 255
42 3300049823 Ga0501044_0042251 Ga0501044_0042251_3413_4186 255
43 3300049824 Ga0501045_0207524 Ga0501045_0207524_256_1029 255
44 3300054114 Ga0501084_0005458 Ga0501084_0005458_5269_6042 255
45 3300060353 Ga0501082_0006508 Ga0501082_0006508_8650_9423 255
46 3300046648 Ga0495611_0102060 Ga0495611_0102060_157_1008 256
47 3300049579 Ga0501043_0024083 Ga0501043_0024083_2136_2963 256
48 3300003320 rootH2_10051869 rootH2_100518693 257
49 3300028800 Ga0265338_10145123 Ga0265338_101451231 257
50 3300031247 Ga0265340_10002678 Ga0265340_100026786 257
51 3300049573 Ga0501037_0047476 Ga0501037_0047476_1956_2771 257
52 3300049574 Ga0501038_0086165 Ga0501038_0086165_88_903 257
53 3300049586 Ga0501070_0000109 Ga0501070_0000109_1524_2339 257
54 3300049822 Ga0501035_0008525 Ga0501035_0008525_2759_3574 257
55 3300049822 Ga0501035_0198305 Ga0501035_0198305_711_1523 257
56 3300049823 Ga0501044_0008931 Ga0501044_0008931_7495_8310 257
57 3300049823 Ga0501044_0025782 Ga0501044_0025782_5251_6066 257
58 3300005434 Ga0070709_10005845 Ga0070709_100058457 258
59 3300005435 Ga0070714_100014233 Ga0070714_1000142332 258
60 3300005436 Ga0070713_100000003 Ga0070713_100000003156 258
61 3300005439 Ga0070711_100148170 Ga0070711_1001481702 258
62 3300005440 Ga0070705_100089673 Ga0070705_1000896733 258
63 3300005614 Ga0068856_100001113 Ga0068856_10000111318 258
64 3300006173 Ga0070716_100044338 Ga0070716_1000443382 258
65 3300006175 Ga0070712_100022190 Ga0070712_1000221903 258
66 3300006871 Ga0075434_100011244 Ga0075434_1000112442 258
67 3300006914 Ga0075436_100000113 Ga0075436_1000001137 258
68 3300013297 Ga0157378_10216691 Ga0157378_102166912 258
69 3300014968 Ga0157379_10013093 Ga0157379_100130932 258
70 3300025906 Ga0207699_10000159 Ga0207699_1000015941 258
71 3300025915 Ga0207693_10002532 Ga0207693_100025324 258
72 3300025916 Ga0207663_10188336 Ga0207663_101883362 258
73 3300025928 Ga0207700_10000010 Ga0207700_10000010182 258
74 3300025929 Ga0207664_10058319 Ga0207664_100583192 258
75 3300025939 Ga0207665_10079119 Ga0207665_100791192 258
76 3300026078 Ga0207702_10000013 Ga0207702_10000013105 258
77 3300050512 nmdc:mga0n895_12885_c1 nmdc:mga0n895_12885_c1_5516_6343 258
78 3300050514 nmdc:mga08x19_140_c1 nmdc:mga08x19_140_c1_32913_33740 258
79 3300046660 Ga0495625_0156718 Ga0495625_0156718_54_878 259
80 3300053087 Ga0500643_000014 Ga0500643_000014_193768_194592 259
81 3300009176 Ga0105242_10027852 Ga0105242_100278527 260
82 3300013296 Ga0157374_10161150 Ga0157374_101611503 260
83 3300013306 Ga0163162_10205139 Ga0163162_102051392 260
84 3300013308 Ga0157375_10195264 Ga0157375_101952642 260
85 3300014969 Ga0157376_10296854 Ga0157376_102968542 260
86 3300049570 Ga0501033_0131825 Ga0501033_0131825_725_1558 260
87 3300049571 Ga0501034_0120187 Ga0501034_0120187_456_1289 260
88 3300028800 Ga0265338_10219206 Ga0265338_102192061 261
89 3300031241 Ga0265325_10002804 Ga0265325_100028048 261
90 3300031249 Ga0265339_10106813 Ga0265339_101068133 261
91 3300037068 Ga0373925_0249569 Ga0373925_0249569_564_1397 261
92 3300048929 Ga0496126_0001513 Ga0496126_0001513_126_944 261
93 3300005435 Ga0070714_100016661 Ga0070714_1000166612 263
94 3300025929 Ga0207664_10005602 Ga0207664_100056025 263
95 3300005327 Ga0070658_10040543 Ga0070658_100405432 264
96 3300005327 Ga0070658_10316312 Ga0070658_103163122 264
97 3300005458 Ga0070681_10047413 Ga0070681_100474133 264
98 3300005530 Ga0070679_100009547 Ga0070679_1000095479 264
99 3300005548 Ga0070665_100022755 Ga0070665_1000227555 264
100 3300005548 Ga0070665_100206836 Ga0070665_1002068362 264
101 3300005563 Ga0068855_100039414 Ga0068855_1000394146 264
102 3300005563 Ga0068855_100301691 Ga0068855_1003016912 264
103 3300005614 Ga0068856_100601429 Ga0068856_1006014292 264
104 3300009093 Ga0105240_10047018 Ga0105240_100470185 264
105 3300009093 Ga0105240_10088737 Ga0105240_100887372 264
106 3300009174 Ga0105241_10196294 Ga0105241_101962942 264
107 3300009545 Ga0105237_10038275 Ga0105237_100382753 264
108 3300009551 Ga0105238_10232963 Ga0105238_102329633 264
109 3300010375 Ga0105239_10106173 Ga0105239_101061733 264
110 3300010375 Ga0105239_10791691 Ga0105239_107916912 264
111 3300013105 Ga0157369_10289540 Ga0157369_102895403 264
112 3300014325 Ga0163163_10525267 Ga0163163_105252672 264
113 3300014969 Ga0157376_10486678 Ga0157376_104866782 264
114 3300025911 Ga0207654_10130253 Ga0207654_101302532 264
115 3300025912 Ga0207707_10313250 Ga0207707_103132502 264
116 3300025913 Ga0207695_10006268 Ga0207695_1000626812 264
117 3300025914 Ga0207671_10098551 Ga0207671_100985512 264
118 3300025919 Ga0207657_10519542 Ga0207657_105195421 264
119 3300025921 Ga0207652_10118419 Ga0207652_101184193 264
120 3300025924 Ga0207694_10354178 Ga0207694_103541782 264
121 3300025949 Ga0207667_10184078 Ga0207667_101840782 264
122 3300026116 Ga0207674_10050669 Ga0207674_100506692 264
123 3300035724 Ga0373933_0221187 Ga0373933_0221187_231_1028 264
124 3300037312 Ga0395899_0110143 Ga0395899_0110143_636_1433 264
125 3300046536 Ga0495587_0047144 Ga0495587_0047144_1065_1862 264
126 3300047444 Ga0495675_0133233 Ga0495675_0133233_82_915 264
127 3300048088 Ga0495602_0088981 Ga0495602_0088981_1244_2041 264
128 3300049570 Ga0501033_0043351 Ga0501033_0043351_302_1099 264
129 3300049579 Ga0501043_0043621 Ga0501043_0043621_2561_3358 264
130 3300049581 Ga0501047_0281559 Ga0501047_0281559_222_1019 264
131 3300049742 Ga0501080_0055866 Ga0501080_0055866_912_1709 264
132 3300049823 Ga0501044_0051080 Ga0501044_0051080_1130_1927 264
133 3300009098 Ga0105245_10202067 Ga0105245_102020673 265
134 3300025261 Ga0209233_1002143 Ga0209233_10021432 265
135 3300026121 Ga0207683_10034533 Ga0207683_100345335 265
136 3300028577 Ga0265318_10065271 Ga0265318_100652712 265
137 3300028800 Ga0265338_10029551 Ga0265338_100295514 265
138 3300031250 Ga0265331_10055147 Ga0265331_100551471 265
139 3300031595 Ga0265313_10000660 Ga0265313_1000066013 265
140 3300031595 Ga0265313_10038532 Ga0265313_100385323 265
141 3300031711 Ga0265314_10124972 Ga0265314_101249722 265
142 3300031711 Ga0265314_10247567 Ga0265314_102475671 265
143 3300039437 Ga0436365_1926500 Ga0436365_1926500_235_1074 265
144 3300049571 Ga0501034_0331296 Ga0501034_0331296_412_1215 265
145 3300049574 Ga0501038_0097405 Ga0501038_0097405_972_1775 265
146 3300049580 Ga0501046_0036190 Ga0501046_0036190_166_969 265
147 3300049581 Ga0501047_0004336 Ga0501047_0004336_11448_12251 265
148 3300049581 Ga0501047_0537854 Ga0501047_0537854_148_951 265
149 3300049582 Ga0501048_0257827 Ga0501048_0257827_46_891 265
150 3300049744 Ga0501083_0049495 Ga0501083_0049495_18_818 265
151 3300049822 Ga0501035_0092167 Ga0501035_0092167_1715_2536 265
152 3300049822 Ga0501035_0188988 Ga0501035_0188988_791_1594 265
153 3300049823 Ga0501044_0044713 Ga0501044_0044713_1927_2730 265
154 3300049823 Ga0501044_0106469 Ga0501044_0106469_1941_2762 265
155 3300049823 Ga0501044_0121823 Ga0501044_0121823_1682_2527 265
156 3300060353 Ga0501082_0026545 Ga0501082_0026545_3951_4751 265
157 3300003214 JGI25165J46597_1000425 JGI25165J46597_100042539 266
158 3300003215 JGI25153J46596_10001493 JGI25153J46596_100014934 266
159 3300005327 Ga0070658_10005088 Ga0070658_100050887 266
160 3300005329 Ga0070683_100280983 Ga0070683_1002809832 266
161 3300005330 Ga0070690_100130982 Ga0070690_1001309822 266
162 3300005334 Ga0068869_100003098 Ga0068869_1000030987 266
163 3300005335 Ga0070666_10095697 Ga0070666_100956972 266
164 3300005338 Ga0068868_100129718 Ga0068868_1001297182 266
165 3300005338 Ga0068868_100199032 Ga0068868_1001990322 266
166 3300005338 Ga0068868_100228678 Ga0068868_1002286782 266
167 3300005344 Ga0070661_100184497 Ga0070661_1001844972 266
168 3300005354 Ga0070675_100027852 Ga0070675_1000278524 266
169 3300005355 Ga0070671_100188351 Ga0070671_1001883512 266
170 3300005364 Ga0070673_100061252 Ga0070673_1000612522 266
171 3300005364 Ga0070673_100121434 Ga0070673_1001214342 266
172 3300005367 Ga0070667_100088412 Ga0070667_1000884123 266
173 3300005367 Ga0070667_100242811 Ga0070667_1002428111 266
174 3300005436 Ga0070713_100060003 Ga0070713_1000600032 266
175 3300005456 Ga0070678_100013030 Ga0070678_1000130307 266
176 3300005456 Ga0070678_100053499 Ga0070678_1000534992 266
177 3300005456 Ga0070678_100229984 Ga0070678_1002299842 266
178 3300005458 Ga0070681_10296172 Ga0070681_102961722 266
179 3300005459 Ga0068867_100044290 Ga0068867_1000442903 266
180 3300005459 Ga0068867_100066650 Ga0068867_1000666503 266
181 3300005459 Ga0068867_100167130 Ga0068867_1001671303 266
182 3300005530 Ga0070679_100379375 Ga0070679_1003793752 266
183 3300005539 Ga0068853_100372377 Ga0068853_1003723772 266
184 3300005539 Ga0068853_100507117 Ga0068853_1005071171 266
185 3300005547 Ga0070693_100181581 Ga0070693_1001815812 266
186 3300005547 Ga0070693_100260168 Ga0070693_1002601682 266
187 3300005548 Ga0070665_100010246 Ga0070665_1000102468 266
188 3300005548 Ga0070665_100012139 Ga0070665_1000121392 266
189 3300005548 Ga0070665_100039508 Ga0070665_1000395085 266
190 3300005563 Ga0068855_100015988 Ga0068855_1000159887 266
191 3300005563 Ga0068855_100217105 Ga0068855_1002171053 266
192 3300005563 Ga0068855_100276838 Ga0068855_1002768382 266
193 3300005563 Ga0068855_100506991 Ga0068855_1005069912 266
194 3300005577 Ga0068857_100112291 Ga0068857_1001122912 266
195 3300005578 Ga0068854_100237046 Ga0068854_1002370461 266
196 3300005614 Ga0068856_100041021 Ga0068856_1000410213 266
197 3300005614 Ga0068856_100097797 Ga0068856_1000977973 266
198 3300005616 Ga0068852_100283528 Ga0068852_1002835282 266
199 3300005618 Ga0068864_100137354 Ga0068864_1001373542 266
200 3300005842 Ga0068858_100084440 Ga0068858_1000844403 266
201 3300005842 Ga0068858_100109083 Ga0068858_1001090833 266
202 3300005843 Ga0068860_100265301 Ga0068860_1002653012 266
203 3300005843 Ga0068860_100421846 Ga0068860_1004218462 266
204 3300005843 Ga0068860_100628635 Ga0068860_1006286352 266
205 3300005844 Ga0068862_100769798 Ga0068862_1007697981 266
206 3300006237 Ga0097621_100164788 Ga0097621_1001647883 266
207 3300006358 Ga0068871_100169865 Ga0068871_1001698653 266
208 3300006881 Ga0068865_100079489 Ga0068865_1000794893 266
209 3300006881 Ga0068865_100151435 Ga0068865_1001514351 266
210 3300009093 Ga0105240_10148130 Ga0105240_101481303 266
211 3300009093 Ga0105240_10206642 Ga0105240_102066422 266
212 3300009093 Ga0105240_10234348 Ga0105240_102343482 266
213 3300009093 Ga0105240_10239666 Ga0105240_102396661 266
214 3300009093 Ga0105240_10270712 Ga0105240_102707121 266
215 3300009098 Ga0105245_10077869 Ga0105245_100778692 266
216 3300009148 Ga0105243_10003266 Ga0105243_100032666 266
217 3300009174 Ga0105241_10012391 Ga0105241_100123915 266
218 3300009174 Ga0105241_10439939 Ga0105241_104399392 266
219 3300009177 Ga0105248_10030181 Ga0105248_100301814 266
220 3300009177 Ga0105248_10240051 Ga0105248_102400512 266
221 3300009545 Ga0105237_10044881 Ga0105237_100448813 266
222 3300009545 Ga0105237_10123972 Ga0105237_101239723 266
223 3300009551 Ga0105238_10033513 Ga0105238_100335132 266
224 3300009551 Ga0105238_10044290 Ga0105238_100442903 266
225 3300009551 Ga0105238_10713926 Ga0105238_107139261 266
226 3300010375 Ga0105239_10058604 Ga0105239_100586046 266
227 3300010375 Ga0105239_10097850 Ga0105239_100978503 266
228 3300010375 Ga0105239_10270660 Ga0105239_102706602 266
229 3300011119 Ga0105246_10014991 Ga0105246_100149913 266
230 3300011119 Ga0105246_10031519 Ga0105246_100315193 266
231 3300013104 Ga0157370_10029941 Ga0157370_100299412 266
232 3300013104 Ga0157370_10101915 Ga0157370_101019153 266
233 3300013105 Ga0157369_10100612 Ga0157369_101006123 266
234 3300013297 Ga0157378_10007224 Ga0157378_100072245 266
235 3300013297 Ga0157378_10052517 Ga0157378_100525173 266
236 3300013306 Ga0163162_10084614 Ga0163162_100846143 266
237 3300014325 Ga0163163_10000111 Ga0163163_1000011147 266
238 3300014325 Ga0163163_10011217 Ga0163163_100112177 266
239 3300014325 Ga0163163_10132798 Ga0163163_101327983 266
240 3300014968 Ga0157379_10017776 Ga0157379_100177767 266
241 3300014968 Ga0157379_10024393 Ga0157379_100243933 266
242 3300014968 Ga0157379_10076267 Ga0157379_100762672 266
243 3300014968 Ga0157379_10145311 Ga0157379_101453112 266
244 3300025261 Ga0209233_1000013 Ga0209233_1000013250 266
245 3300025297 Ga0209758_1000036 Ga0209758_1000036218 266
246 3300025899 Ga0207642_10060373 Ga0207642_100603732 266
247 3300025903 Ga0207680_10134231 Ga0207680_101342311 266
248 3300025907 Ga0207645_10256725 Ga0207645_102567251 266
249 3300025909 Ga0207705_10001483 Ga0207705_1000148316 266
250 3300025911 Ga0207654_10028410 Ga0207654_100284101 266
251 3300025912 Ga0207707_10147227 Ga0207707_101472272 266
252 3300025912 Ga0207707_10162608 Ga0207707_101626082 266
253 3300025913 Ga0207695_10077258 Ga0207695_100772583 266
254 3300025913 Ga0207695_10316648 Ga0207695_103166482 266
255 3300025914 Ga0207671_10083607 Ga0207671_100836072 266
256 3300025914 Ga0207671_10122458 Ga0207671_101224581 266
257 3300025917 Ga0207660_10262077 Ga0207660_102620772 266
258 3300025919 Ga0207657_10031080 Ga0207657_100310805 266
259 3300025920 Ga0207649_10179402 Ga0207649_101794022 266
260 3300025921 Ga0207652_10005445 Ga0207652_100054456 266
261 3300025924 Ga0207694_10410120 Ga0207694_104101201 266
262 3300025926 Ga0207659_10019312 Ga0207659_100193123 266
263 3300025927 Ga0207687_10029495 Ga0207687_100294954 266
264 3300025927 Ga0207687_10062983 Ga0207687_100629832 266
265 3300025931 Ga0207644_10156048 Ga0207644_101560482 266
266 3300025932 Ga0207690_10049646 Ga0207690_100496463 266
267 3300025934 Ga0207686_10116738 Ga0207686_101167382 266
268 3300025934 Ga0207686_10286731 Ga0207686_102867312 266
269 3300025935 Ga0207709_10002218 Ga0207709_100022187 266
270 3300025938 Ga0207704_10500778 Ga0207704_105007781 266
271 3300025940 Ga0207691_10037819 Ga0207691_100378193 266
272 3300025941 Ga0207711_10049962 Ga0207711_100499623 266
273 3300025942 Ga0207689_10069946 Ga0207689_100699463 266
274 3300025949 Ga0207667_10051833 Ga0207667_100518333 266
275 3300025949 Ga0207667_10076553 Ga0207667_100765533 266
276 3300025960 Ga0207651_10064612 Ga0207651_100646123 266
277 3300025961 Ga0207712_10055505 Ga0207712_100555051 266
278 3300026023 Ga0207677_10073918 Ga0207677_100739181 266
279 3300026023 Ga0207677_10155776 Ga0207677_101557762 266
280 3300026035 Ga0207703_10002958 Ga0207703_1000295811 266
281 3300026035 Ga0207703_10177537 Ga0207703_101775372 266
282 3300026078 Ga0207702_10046001 Ga0207702_100460011 266
283 3300026078 Ga0207702_10314861 Ga0207702_103148612 266
284 3300026089 Ga0207648_10026224 Ga0207648_100262248 266
285 3300026089 Ga0207648_10108325 Ga0207648_101083253 266
286 3300026089 Ga0207648_10146630 Ga0207648_101466302 266
287 3300026095 Ga0207676_10126093 Ga0207676_101260933 266
288 3300026095 Ga0207676_10644006 Ga0207676_106440061 266
289 3300026116 Ga0207674_10088583 Ga0207674_100885832 266
290 3300026116 Ga0207674_10286064 Ga0207674_102860641 266
291 3300026121 Ga0207683_10021308 Ga0207683_100213082 266
292 3300026142 Ga0207698_10437513 Ga0207698_104375132 266
293 3300028379 Ga0268266_10002680 Ga0268266_1000268013 266
294 3300028379 Ga0268266_10005907 Ga0268266_100059076 266
295 3300028379 Ga0268266_10023201 Ga0268266_100232014 266
296 3300028379 Ga0268266_10227263 Ga0268266_102272632 266
297 3300028380 Ga0268265_10715405 Ga0268265_107154051 266
298 3300028381 Ga0268264_10095289 Ga0268264_100952893 266
299 3300028800 Ga0265338_10003602 Ga0265338_1000360210 266
300 3300031238 Ga0265332_10044686 Ga0265332_100446862 266
301 3300031247 Ga0265340_10085525 Ga0265340_100855252 266
302 3300031595 Ga0265313_10091230 Ga0265313_100912301 266
303 3300037418 Ga0395900_0022307 Ga0395900_0022307_4041_4859 266
304 3300046529 Ga0495652_0376903 Ga0495652_0376903_143_958 266
305 3300046538 Ga0495609_0055358 Ga0495609_0055358_799_1608 266
306 3300048907 Ga0496104_0355330 Ga0496104_0355330_91_924 266
307 3300048929 Ga0496126_0305111 Ga0496126_0305111_336_1142 266
308 3300049570 Ga0501033_0015038 Ga0501033_0015038_3190_3996 266
309 3300049570 Ga0501033_0090547 Ga0501033_0090547_1327_2139 266
310 3300049570 Ga0501033_0105952 Ga0501033_0105952_821_1678 266
311 3300049574 Ga0501038_0276858 Ga0501038_0276858_336_1142 266
312 3300049579 Ga0501043_0184515 Ga0501043_0184515_651_1484 266
313 3300049579 Ga0501043_0230965 Ga0501043_0230965_409_1215 266
314 3300049580 Ga0501046_0034820 Ga0501046_0034820_258_1115 266
315 3300049581 Ga0501047_0003221 Ga0501047_0003221_8278_9135 266
316 3300049581 Ga0501047_0026719 Ga0501047_0026719_2138_2944 266
317 3300049581 Ga0501047_0221337 Ga0501047_0221337_720_1553 266
318 3300049822 Ga0501035_0158373 Ga0501035_0158373_858_1664 266
319 3300049823 Ga0501044_0005359 Ga0501044_0005359_38_895 266
320 3300049823 Ga0501044_0008325 Ga0501044_0008325_5311_6117 266
321 3300049823 Ga0501044_0225819 Ga0501044_0225819_751_1563 266
322 3300053090 Ga0500646_0018302 Ga0500646_0018302_251_1075 266
323 3300053119 Ga0500595_001130 Ga0500595_001130_9029_9844 266
324 3300053139 Ga0500568_0016389 Ga0500568_0016389_1723_2529 266
325 3300053139 Ga0500568_0101364 Ga0500568_0101364_160_984 266
326 3300053140 Ga0500573_0000003 Ga0500573_0000003_152426_153241 266
327 3300053151 Ga0500604_0105290 Ga0500604_0105290_19_843 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

42

292

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ae0-assembly2.cif.gz_B crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate 0.8372 1 263
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.8338 1 263
3adz-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp 0.8302 4 263
4ea1-assembly1.cif.gz_A co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109 0.83 1 263
3ae0-assembly2.cif.gz_B crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate 0.8258 1 263
ID Description Score Start End Superfamily
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8768 2 242 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8728 6 257 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.863 6 257 1.10.600.10
af_B4FPS7_5_269_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8589 4 246 1.10.600.10
af_Q54E48_68_332_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8474 2 257 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7V9S8R0-F1-model_v4 Squalene/phytoene synthase family protein 0.9974 1 266 GO:0005737
GO:0009058
GO:0043231
AF-A0A1M3A8J6-F1-model_v4 deleted 0.9472 1 266
AF-A0A433PF69-F1-model_v4 Squalene/phytoene synthase-domain-containing protein 0.9441 9 184 GO:0005743
GO:0009058
AF-A0A1M3A8J6-F1-model_v4 deleted 0.9437 1 266
AF-A0A1A8SNG7-F1-model_v4 NADH dehydrogenase (Ubiquinone) complex I, assembly factor 6 0.939 23 167 GO:0005743
GO:0009058

Feature Viewer

pLDDT pTM Quality
96.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map