F408831

General Info

Members Datasets Scaffolds Average Seq Length
327 205 654 291

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10043777|Ga0207683_100437774
Length 323
Sequence MTTQSNAFSETSIDSHVVAPAATRPLFWSVRRELWENYSIYLAPLIVAGIILFGSLVSASHLPARRQNAMLLDPVHRRAAIEMPYDIAAVMIIFTVFIVGVFYCLDALHGERRERSILFWKSLPVSDLTTVLSKVIIALVVLPLVSFTIXVVTHFIMMLISAVALLPSGLAATTWANFNLIRESLVLLYGLTAILLWHAPIYAWALLISGWARRATFLWASVPLLAISFFEKITFDTSHFAAMLKARVIGFAAEAFAFHAHSIDSVTLTPARYLASAGLWVGLALAVAFIAAAVRLRRMVRVGREPGVGARRPGQVDHVPLRQ

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.28
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 12.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10043777 3300026121 Bacteria 3912
2 CNXas_1000038 3300000545 Bacteria 27945
3 Ga0065703_1019241 3300005272 Bacteria 3431
4 Ga0070676_10004699 3300005328 Bacteria 7219
5 Ga0070676_10033463 3300005328 Unclassified 2949
6 Ga0070676_10173375 3300005328 Bacteria 1397
7 Ga0070676_10264864 3300005328 Bacteria 1152
8 Ga0070690_100012328 3300005330 Bacteria 5028
9 Ga0070670_100004937 3300005331 Bacteria 11223
10 Ga0070670_100240369 3300005331 Unclassified 1576
11 Ga0070670_100267626 3300005331 Unclassified 1491
12 Ga0068869_100043258 3300005334 Bacteria 3234
13 Ga0070666_10001477 3300005335 Bacteria 14269
14 Ga0070666_10199775 3300005335 Unclassified 1406
15 Ga0070682_100000004 3300005337 Bacteria 388780
16 Ga0068868_100030976 3300005338 Bacteria 4105
17 Ga0070689_100001687 3300005340 Bacteria 14090
18 Ga0070661_100032737 3300005344 Bacteria 3764
19 Ga0070661_100122237 3300005344 Unclassified 1951
20 Ga0070661_100159771 3300005344 Bacteria 1706
21 Ga0070668_100078183 3300005347 Unclassified 2587
22 Ga0070668_100361078 3300005347 Unclassified 1231
23 Ga0070669_100001451 3300005353 Bacteria 17173
24 Ga0070675_100000020 3300005354 Bacteria 168778
25 Ga0070675_100003098 3300005354 Bacteria 12569
26 Ga0070675_100059644 3300005354 Unclassified 3148
27 Ga0070675_100303795 3300005354 Unclassified 1406
28 Ga0070671_100005200 3300005355 Bacteria 10368
29 Ga0070671_100017481 3300005355 Bacteria 5810
30 Ga0070671_100081574 3300005355 Unclassified 2704
31 Ga0070674_100000429 3300005356 Bacteria 21244
32 Ga0070674_100025782 3300005356 Bacteria 3831
33 Ga0070674_100457770 3300005356 Unclassified 1054
34 Ga0070673_100000578 3300005364 Bacteria 19856
35 Ga0070688_100001332 3300005365 Bacteria 12243
36 Ga0070688_100124643 3300005365 Unclassified 1730
37 Ga0070667_100001714 3300005367 Bacteria 19592
38 Ga0070667_100023200 3300005367 Bacteria 5148
39 Ga0070709_10285720 3300005434 Unclassified 1200
40 Ga0070714_100026388 3300005435 Bacteria 4801
41 Ga0070713_100018867 3300005436 Bacteria 5251
42 Ga0070701_10013825 3300005438 Bacteria 3683
43 Ga0070711_100040968 3300005439 Bacteria 3126
44 Ga0070711_100157576 3300005439 Bacteria 1718
45 Ga0070705_100049875 3300005440 Bacteria 2432
46 Ga0070700_100000017 3300005441 Bacteria 144824
47 Ga0070708_100025216 3300005445 Bacteria 5081
48 Ga0070708_100032267 3300005445 Bacteria 4541
49 Ga0070708_100038631 3300005445 Bacteria 4171
50 Ga0070708_100252487 3300005445 Bacteria 1657
51 Ga0070708_100303001 3300005445 Bacteria 1505
52 Ga0070708_100371430 3300005445 Unclassified 1348
53 Ga0070678_100000659 3300005456 Bacteria 16931
54 Ga0070678_100077364 3300005456 Bacteria 2510
55 Ga0070678_100091693 3300005456 Bacteria 2332
56 Ga0070662_100000144 3300005457 Bacteria 40518
57 Ga0070662_100029669 3300005457 Bacteria 3819
58 Ga0070685_10046268 3300005466 Bacteria 2497
59 Ga0070685_10136860 3300005466 Bacteria 1538
60 Ga0070706_100039823 3300005467 Bacteria 4337
61 Ga0070706_100115786 3300005467 Bacteria 2496
62 Ga0070706_100158438 3300005467 Bacteria 2113
63 Ga0070707_100013869 3300005468 Bacteria 7546
64 Ga0070707_100019853 3300005468 Bacteria 6334
65 Ga0070707_100028659 3300005468 Bacteria 5299
66 Ga0070707_100031435 3300005468 Bacteria 5057
67 Ga0070707_100357676 3300005468 Unclassified 1418
68 Ga0070698_100000117 3300005471 Bacteria 67940
69 Ga0070698_100075310 3300005471 Bacteria 3379
70 Ga0070699_100073513 3300005518 Bacteria 2974
71 Ga0070699_100092598 3300005518 Bacteria 2644
72 Ga0070699_100303564 3300005518 Bacteria 1432
73 Ga0070684_100042873 3300005535 Bacteria 3907
74 Ga0070684_100370901 3300005535 Bacteria 1318
75 Ga0070697_100000044 3300005536 Bacteria 92712
76 Ga0070697_100006303 3300005536 Bacteria 9179
77 Ga0070697_100015913 3300005536 Bacteria 5910
78 Ga0070697_100083721 3300005536 Bacteria 2630
79 Ga0070697_100113000 3300005536 Bacteria 2265
80 Ga0068853_100223957 3300005539 Bacteria 1719
81 Ga0070672_100059437 3300005543 Bacteria 3007
82 Ga0070695_100178001 3300005545 Bacteria 1505
83 Ga0070696_100039437 3300005546 Bacteria 3261
84 Ga0070693_100000231 3300005547 Bacteria 26063
85 Ga0070665_100003328 3300005548 Bacteria 17217
86 Ga0070665_100206520 3300005548 Bacteria 1965
87 Ga0070704_100035701 3300005549 Bacteria 3382
88 Ga0070704_100055637 3300005549 Bacteria 2806
89 Ga0070704_100101846 3300005549 Bacteria 2165
90 Ga0070664_100603612 3300005564 Bacteria 1018
91 Ga0070702_100000836 3300005615 Bacteria 11841
92 Ga0068852_100311534 3300005616 Unclassified 1526
93 Ga0068859_100000187 3300005617 Bacteria 60143
94 Ga0068864_100238951 3300005618 Bacteria 1683
95 Ga0068866_10001021 3300005718 Bacteria 12314
96 Ga0068866_10013543 3300005718 Unclassified 3582
97 Ga0068866_10142148 3300005718 Unclassified 1379
98 Ga0068866_10215778 3300005718 Bacteria 1154
99 Ga0068860_100143633 3300005843 Bacteria 2295
100 Ga0068860_100703180 3300005843 Bacteria 1020
101 Ga0081455_10001366 3300005937 Bacteria 30129
102 Ga0081540_1000225 3300005983 Bacteria 59402
103 Ga0070717_10034267 3300006028 Bacteria 4104
104 Ga0070717_10090704 3300006028 Bacteria 2579
105 Ga0070717_10473815 3300006028 Bacteria 1130
106 Ga0070716_100150975 3300006173 Unclassified 1494
107 Ga0070716_100197685 3300006173 Bacteria 1334
108 Ga0070712_100258879 3300006175 Bacteria 1393
109 Ga0097621_100003927 3300006237 Bacteria 10297
110 Ga0097621_100020595 3300006237 Bacteria 5083
111 Ga0097621_100030252 3300006237 Bacteria 4285
112 Ga0068871_100003837 3300006358 Bacteria 10358
113 Ga0068871_100016703 3300006358 Bacteria 5537
114 Ga0068871_100048815 3300006358 Bacteria 3418
115 Ga0068871_100207495 3300006358 Bacteria 1694
116 Ga0075428_100078048 3300006844 Bacteria 3615
117 Ga0075431_100089636 3300006847 Bacteria 3174
118 Ga0068865_100010769 3300006881 Bacteria 5702
119 Ga0068865_100391687 3300006881 Unclassified 1136
120 Ga0097620_100000187 3300006931 Bacteria 60143
121 Ga0075435_100042879 3300007076 Bacteria 3620
122 Ga0075435_100054028 3300007076 Bacteria 3241
123 Ga0099794_10042268 3300007265 Bacteria 2173
124 Ga0105244_10019284 3300009036 Bacteria 3813
125 Ga0105240_10105118 3300009093 Bacteria 3428
126 Ga0111539_10265224 3300009094 Bacteria 1999
127 Ga0105245_10000206 3300009098 Bacteria 56107
128 Ga0105245_10004819 3300009098 Bacteria 11898
129 Ga0105245_10517118 3300009098 Bacteria 1212
130 Ga0114129_10191643 3300009147 Bacteria 2776
131 Ga0105243_10135460 3300009148 Bacteria 2095
132 Ga0105243_10160329 3300009148 Bacteria 1939
133 Ga0105241_10006949 3300009174 Bacteria 8330
134 Ga0105242_10070566 3300009176 Bacteria 2897
135 Ga0105242_10071670 3300009176 Unclassified 2876
136 Ga0105248_10011034 3300009177 Bacteria 9965
137 Ga0105248_10239676 3300009177 Bacteria 2041
138 Ga0105248_10300849 3300009177 Bacteria 1806
139 Ga0105237_10048230 3300009545 Bacteria 4281
140 Ga0105238_10000013 3300009551 Bacteria 257248
141 Ga0105239_10035428 3300010375 Bacteria 5481
142 Ga0105246_10002443 3300011119 Bacteria 11213
143 Ga0105246_10032525 3300011119 Bacteria 3460
144 Ga0157371_10146507 3300013102 Bacteria 1683
145 Ga0157369_10030316 3300013105 Bacteria 5966
146 Ga0157369_10264679 3300013105 Bacteria 1793
147 Ga0157374_10000797 3300013296 Bacteria 27660
148 Ga0157378_10013528 3300013297 Bacteria 7137
149 Ga0157378_10017417 3300013297 Bacteria 6305
150 Ga0157378_10251171 3300013297 Bacteria 1693
151 Ga0157378_10575961 3300013297 Unclassified 1134
152 Ga0163162_10000863 3300013306 Bacteria 28273
153 Ga0163162_10013175 3300013306 Bacteria 8076
154 Ga0163162_10014853 3300013306 Bacteria 7605
155 Ga0163162_10047289 3300013306 Bacteria 4312
156 Ga0163162_10889187 3300013306 Bacteria 1004
157 Ga0157375_10004442 3300013308 Bacteria 12183
158 Ga0157375_10011259 3300013308 Bacteria 7894
159 Ga0157375_10020865 3300013308 Bacteria 5996
160 Ga0157375_10253003 3300013308 Bacteria 1922
161 Ga0157375_10338257 3300013308 Bacteria 1670
162 Ga0163163_10205976 3300014325 Bacteria 2015
163 Ga0163163_10216342 3300014325 Bacteria 1965
164 Ga0157379_10215698 3300014968 Bacteria 1738
165 Ga0157376_10001720 3300014969 Bacteria 14553
166 Ga0157376_10036963 3300014969 Unclassified 3959
167 Ga0157376_10415963 3300014969 Bacteria 1303
168 Ga0163161_10311399 3300017792 Unclassified 1242
169 Ga0207697_10000177 3300025315 Bacteria 32688
170 Ga0207697_10002950 3300025315 Bacteria 8588
171 Ga0207655_1017814 3300025728 Bacteria 3813
172 Ga0207653_10056743 3300025885 Bacteria 1314
173 Ga0207682_10062378 3300025893 Bacteria 1563
174 Ga0207642_10057807 3300025899 Bacteria 1786
175 Ga0207642_10083716 3300025899 Bacteria 1556
176 Ga0207688_10001227 3300025901 Bacteria 13288
177 Ga0207680_10118554 3300025903 Unclassified 1727
178 Ga0207645_10005756 3300025907 Bacteria 8943
179 Ga0207645_10008582 3300025907 Bacteria 7119
180 Ga0207645_10131843 3300025907 Bacteria 1627
181 Ga0207645_10191299 3300025907 Bacteria 1345
182 Ga0207684_10003100 3300025910 Bacteria 16404
183 Ga0207684_10013804 3300025910 Bacteria 6977
184 Ga0207684_10125148 3300025910 Bacteria 2205
185 Ga0207707_10049525 3300025912 Bacteria 3660
186 Ga0207693_10003735 3300025915 Bacteria 12985
187 Ga0207693_10042088 3300025915 Bacteria 3596
188 Ga0207663_10007359 3300025916 Bacteria 5705
189 Ga0207657_10005116 3300025919 Bacteria 13739
190 Ga0207649_10219507 3300025920 Unclassified 1353
191 Ga0207646_10002707 3300025922 Bacteria 20775
192 Ga0207646_10019513 3300025922 Bacteria 6299
193 Ga0207646_10029451 3300025922 Bacteria 4990
194 Ga0207646_10054505 3300025922 Bacteria 3576
195 Ga0207646_10074682 3300025922 Bacteria 3028
196 Ga0207646_10274420 3300025922 Unclassified 1524
197 Ga0207681_10012958 3300025923 Bacteria 5153
198 Ga0207694_10000026 3300025924 Bacteria 257192
199 Ga0207694_10049873 3300025924 Bacteria 3240
200 Ga0207659_10000035 3300025926 Bacteria 104092
201 Ga0207659_10048809 3300025926 Bacteria 3000
202 Ga0207687_10001152 3300025927 Bacteria 18011
203 Ga0207700_10004080 3300025928 Bacteria 8561
204 Ga0207664_10000730 3300025929 Bacteria 22354
205 Ga0207644_10001769 3300025931 Bacteria 13998
206 Ga0207644_10114265 3300025931 Bacteria 2045
207 Ga0207706_10000277 3300025933 Bacteria 55794
208 Ga0207706_10005815 3300025933 Bacteria 11472
209 Ga0207706_10028980 3300025933 Bacteria 4943
210 Ga0207706_10236562 3300025933 Bacteria 1597
211 Ga0207686_10000541 3300025934 Bacteria 24459
212 Ga0207670_10140841 3300025936 Bacteria 1778
213 Ga0207670_10167635 3300025936 Unclassified 1644
214 Ga0207669_10013654 3300025937 Bacteria 4044
215 Ga0207669_10201162 3300025937 Bacteria 1446
216 Ga0207669_10386985 3300025937 Unclassified 1091
217 Ga0207704_10009575 3300025938 Bacteria 4681
218 Ga0207665_10062919 3300025939 Bacteria 2519
219 Ga0207665_10122561 3300025939 Bacteria 1838
220 Ga0207691_10000682 3300025940 Bacteria 33522
221 Ga0207711_10058425 3300025941 Bacteria 3319
222 Ga0207711_10199863 3300025941 Bacteria 1824
223 Ga0207689_10056264 3300025942 Bacteria 3236
224 Ga0207679_10100622 3300025945 Bacteria 2259
225 Ga0207667_10173336 3300025949 Bacteria 2217
226 Ga0207651_10005098 3300025960 Bacteria 6706
227 Ga0207651_10060807 3300025960 Bacteria 2624
228 Ga0207668_10004714 3300025972 Bacteria 8021
229 Ga0207668_10524023 3300025972 Unclassified 1023
230 Ga0207658_10009939 3300025986 Bacteria 6463
231 Ga0207658_10250077 3300025986 Bacteria 1506
232 Ga0207677_10015470 3300026023 Bacteria 4490
233 Ga0207703_10485844 3300026035 Bacteria 1158
234 Ga0207678_10044917 3300026067 Bacteria 3821
235 Ga0207708_10000053 3300026075 Bacteria 104395
236 Ga0207702_10070925 3300026078 Bacteria 2998
237 Ga0207648_10002471 3300026089 Bacteria 19862
238 Ga0207648_10072421 3300026089 Bacteria 3003
239 Ga0207648_10168699 3300026089 Bacteria 1934
240 Ga0207674_10023742 3300026116 Bacteria 6563
241 Ga0207683_10000249 3300026121 Bacteria 48074
242 Ga0207683_10085628 3300026121 Bacteria 2801
243 Ga0207698_10023792 3300026142 Bacteria 4287
244 Ga0209968_1000365 3300027526 Bacteria 7479
245 Ga0209970_1000402 3300027614 Bacteria 7334
246 Ga0209983_1000217 3300027665 Bacteria 11496
247 Ga0209588_1030508 3300027671 Bacteria 1722
248 Ga0209971_1000093 3300027682 Bacteria 27033
249 Ga0209974_10003052 3300027876 Bacteria 6058
250 Ga0209974_10036918 3300027876 Bacteria 1622
251 Ga0268266_10054478 3300028379 Bacteria 3436
252 Ga0268266_10099536 3300028379 Unclassified 2559
253 Ga0268266_10327624 3300028379 Unclassified 1435
254 Ga0268264_10007042 3300028381 Bacteria 9432
255 Ga0265760_10008170 3300031090 Bacteria 2990
256 Ga0265330_10014245 3300031235 Bacteria 3692
257 Ga0265325_10003459 3300031241 Bacteria 10306
258 Ga0265331_10028119 3300031250 Bacteria 2813
259 Ga0265316_10008420 3300031344 Bacteria 9578
260 Ga0307408_100059480 3300031548 Bacteria 2781
261 Ga0265313_10014635 3300031595 Bacteria 4623
262 Ga0307410_10006106 3300031852 Bacteria 6464
263 Ga0307409_100013146 3300031995 Bacteria 5312
264 Ga0307414_10311649 3300032004 Bacteria 1336
265 Ga0307411_10192389 3300032005 Bacteria 1559
266 Ga0373945_0026761 3300035116 Bacteria 2010
267 Ga0373943_0035948 3300035170 Bacteria 2370
268 Ga0373961_0000533 3300035241 Bacteria 14489
269 Ga0373947_0236655 3300035725 Bacteria 1204
270 Ga0373937_0114768 3300036401 Bacteria 2507
271 Ga0373937_0312222 3300036401 Unclassified 1487
272 Ga0373925_0093115 3300037068 Bacteria 2306
273 Ga0395899_0114894 3300037312 Bacteria 1932
274 Ga0395901_0047194 3300038443 Bacteria 4472
275 Ga0436365_1210582 3300039437 Bacteria 3238
276 Ga0436363_1226659 3300039450 Bacteria 1554
277 Ga0451839_0484724 3300041496 Bacteria 1037
278 Ga0453683_0037027 3300044673 Bacteria 3069
279 Ga0451576_0016219 3300045051 Bacteria 8228
280 Ga0495629_0033310 3300046459 Bacteria 3644
281 Ga0495582_0017145 3300046473 Bacteria 3963
282 Ga0495639_0011365 3300046475 Bacteria 3838
283 Ga0495594_0013765 3300046499 Bacteria 4228
284 Ga0495594_0050954 3300046499 Bacteria 2278
285 Ga0495620_0002856 3300046515 Bacteria 9924
286 Ga0495642_0161296 3300046528 Unclassified 972
287 Ga0495665_0028983 3300046531 Bacteria 2966
288 Ga0495621_0013139 3300046539 Bacteria 2597
289 Ga0495645_0197337 3300046543 Bacteria 1367
290 Ga0495667_0188760 3300046559 Bacteria 1321
291 Ga0495668_0223576 3300046616 Unclassified 1031
292 Ga0495634_0052030 3300046642 Bacteria 2747
293 Ga0495635_0015956 3300046663 Bacteria 5246
294 Ga0495647_0011593 3300046681 Bacteria 3021
295 Ga0495613_0008185 3300046689 Bacteria 7771
296 Ga0495600_0020104 3300046809 Bacteria 4271
297 Ga0495581_0013371 3300047315 Bacteria 4759
298 Ga0495604_0287082 3300047317 Unclassified 1109
299 Ga0495684_0013401 3300047471 Bacteria 6310
300 Ga0496100_0150150 3300048903 Unclassified 1661
301 Ga0496101_0088692 3300048904 Unclassified 2298
302 Ga0496102_0079980 3300048905 Bacteria 3011
303 Ga0496104_0006921 3300048907 Bacteria 10003
304 Ga0496104_0048827 3300048907 Bacteria 3990
305 Ga0496109_0308428 3300048912 Unclassified 1493
306 Ga0496110_0022443 3300048913 Bacteria 5360
307 Ga0496110_0126960 3300048913 Bacteria 2302
308 Ga0496111_0001040 3300048914 Bacteria 15261
309 Ga0496112_0018854 3300048915 Bacteria 6500
310 Ga0496112_0109516 3300048915 Bacteria 2732
311 Ga0496112_0342576 3300048915 Unclassified 1438
312 Ga0496114_0010012 3300048917 Bacteria 7537
313 Ga0496115_0000936 3300048918 Bacteria 21169
314 Ga0501040_0199669 3300049576 Bacteria 1420
315 Ga0501073_0004844 3300049589 Bacteria 10102
316 Ga0501076_0249389 3300049592 Bacteria 1452
317 Ga0501079_0122622 3300049741 Bacteria 2021
318 Ga0501080_0010820 3300049742 Bacteria 8346
319 Ga0501080_0400381 3300049742 Bacteria 1235
320 Ga0501045_0333113 3300049824 Bacteria 1129
321 nmdc:mga05p37_150287_c1 3300050507 Bacteria 2849
322 nmdc:mga06r32_74659_c1 3300050510 Bacteria 3288
323 nmdc:mga0rr50_64588_c1 3300050513 Bacteria 2769
324 Ga0495655_0000061 3300053083 Bacteria 21970
325 Ga0495619_0047220 3300053085 Bacteria 2835
326 Ga0501084_0244934 3300054114 Bacteria 1513
327 Ga0530510_0362869 3300061734 Bacteria 1089
328 Ga0207683_10043777
329 CNXas_1000038
330 Ga0065703_1019241
331 Ga0070676_10004699
332 Ga0070676_10033463
333 Ga0070676_10173375
334 Ga0070676_10264864
335 Ga0070690_100012328
336 Ga0070670_100004937
337 Ga0070670_100240369
338 Ga0070670_100267626
339 Ga0068869_100043258
340 Ga0070666_10001477
341 Ga0070666_10199775
342 Ga0070682_100000004
343 Ga0068868_100030976
344 Ga0070689_100001687
345 Ga0070661_100032737
346 Ga0070661_100122237
347 Ga0070661_100159771
348 Ga0070668_100078183
349 Ga0070668_100361078
350 Ga0070669_100001451
351 Ga0070675_100000020
352 Ga0070675_100003098
353 Ga0070675_100059644
354 Ga0070675_100303795
355 Ga0070671_100005200
356 Ga0070671_100017481
357 Ga0070671_100081574
358 Ga0070674_100000429
359 Ga0070674_100025782
360 Ga0070674_100457770
361 Ga0070673_100000578
362 Ga0070688_100001332
363 Ga0070688_100124643
364 Ga0070667_100001714
365 Ga0070667_100023200
366 Ga0070709_10285720
367 Ga0070714_100026388
368 Ga0070713_100018867
369 Ga0070701_10013825
370 Ga0070711_100040968
371 Ga0070711_100157576
372 Ga0070705_100049875
373 Ga0070700_100000017
374 Ga0070708_100025216
375 Ga0070708_100032267
376 Ga0070708_100038631
377 Ga0070708_100252487
378 Ga0070708_100303001
379 Ga0070708_100371430
380 Ga0070678_100000659
381 Ga0070678_100077364
382 Ga0070678_100091693
383 Ga0070662_100000144
384 Ga0070662_100029669
385 Ga0070685_10046268
386 Ga0070685_10136860
387 Ga0070706_100039823
388 Ga0070706_100115786
389 Ga0070706_100158438
390 Ga0070707_100013869
391 Ga0070707_100019853
392 Ga0070707_100028659
393 Ga0070707_100031435
394 Ga0070707_100357676
395 Ga0070698_100000117
396 Ga0070698_100075310
397 Ga0070699_100073513
398 Ga0070699_100092598
399 Ga0070699_100303564
400 Ga0070684_100042873
401 Ga0070684_100370901
402 Ga0070697_100000044
403 Ga0070697_100006303
404 Ga0070697_100015913
405 Ga0070697_100083721
406 Ga0070697_100113000
407 Ga0068853_100223957
408 Ga0070672_100059437
409 Ga0070695_100178001
410 Ga0070696_100039437
411 Ga0070693_100000231
412 Ga0070665_100003328
413 Ga0070665_100206520
414 Ga0070704_100035701
415 Ga0070704_100055637
416 Ga0070704_100101846
417 Ga0070664_100603612
418 Ga0070702_100000836
419 Ga0068852_100311534
420 Ga0068859_100000187
421 Ga0068864_100238951
422 Ga0068866_10001021
423 Ga0068866_10013543
424 Ga0068866_10142148
425 Ga0068866_10215778
426 Ga0068860_100143633
427 Ga0068860_100703180
428 Ga0081455_10001366
429 Ga0081540_1000225
430 Ga0070717_10034267
431 Ga0070717_10090704
432 Ga0070717_10473815
433 Ga0070716_100150975
434 Ga0070716_100197685
435 Ga0070712_100258879
436 Ga0097621_100003927
437 Ga0097621_100020595
438 Ga0097621_100030252
439 Ga0068871_100003837
440 Ga0068871_100016703
441 Ga0068871_100048815
442 Ga0068871_100207495
443 Ga0075428_100078048
444 Ga0075431_100089636
445 Ga0068865_100010769
446 Ga0068865_100391687
447 Ga0097620_100000187
448 Ga0075435_100042879
449 Ga0075435_100054028
450 Ga0099794_10042268
451 Ga0105244_10019284
452 Ga0105240_10105118
453 Ga0111539_10265224
454 Ga0105245_10000206
455 Ga0105245_10004819
456 Ga0105245_10517118
457 Ga0114129_10191643
458 Ga0105243_10135460
459 Ga0105243_10160329
460 Ga0105241_10006949
461 Ga0105242_10070566
462 Ga0105242_10071670
463 Ga0105248_10011034
464 Ga0105248_10239676
465 Ga0105248_10300849
466 Ga0105237_10048230
467 Ga0105238_10000013
468 Ga0105239_10035428
469 Ga0105246_10002443
470 Ga0105246_10032525
471 Ga0157371_10146507
472 Ga0157369_10030316
473 Ga0157369_10264679
474 Ga0157374_10000797
475 Ga0157378_10013528
476 Ga0157378_10017417
477 Ga0157378_10251171
478 Ga0157378_10575961
479 Ga0163162_10000863
480 Ga0163162_10013175
481 Ga0163162_10014853
482 Ga0163162_10047289
483 Ga0163162_10889187
484 Ga0157375_10004442
485 Ga0157375_10011259
486 Ga0157375_10020865
487 Ga0157375_10253003
488 Ga0157375_10338257
489 Ga0163163_10205976
490 Ga0163163_10216342
491 Ga0157379_10215698
492 Ga0157376_10001720
493 Ga0157376_10036963
494 Ga0157376_10415963
495 Ga0163161_10311399
496 Ga0207697_10000177
497 Ga0207697_10002950
498 Ga0207655_1017814
499 Ga0207653_10056743
500 Ga0207682_10062378
501 Ga0207642_10057807
502 Ga0207642_10083716
503 Ga0207688_10001227
504 Ga0207680_10118554
505 Ga0207645_10005756
506 Ga0207645_10008582
507 Ga0207645_10131843
508 Ga0207645_10191299
509 Ga0207684_10003100
510 Ga0207684_10013804
511 Ga0207684_10125148
512 Ga0207707_10049525
513 Ga0207693_10003735
514 Ga0207693_10042088
515 Ga0207663_10007359
516 Ga0207657_10005116
517 Ga0207649_10219507
518 Ga0207646_10002707
519 Ga0207646_10019513
520 Ga0207646_10029451
521 Ga0207646_10054505
522 Ga0207646_10074682
523 Ga0207646_10274420
524 Ga0207681_10012958
525 Ga0207694_10000026
526 Ga0207694_10049873
527 Ga0207659_10000035
528 Ga0207659_10048809
529 Ga0207687_10001152
530 Ga0207700_10004080
531 Ga0207664_10000730
532 Ga0207644_10001769
533 Ga0207644_10114265
534 Ga0207706_10000277
535 Ga0207706_10005815
536 Ga0207706_10028980
537 Ga0207706_10236562
538 Ga0207686_10000541
539 Ga0207670_10140841
540 Ga0207670_10167635
541 Ga0207669_10013654
542 Ga0207669_10201162
543 Ga0207669_10386985
544 Ga0207704_10009575
545 Ga0207665_10062919
546 Ga0207665_10122561
547 Ga0207691_10000682
548 Ga0207711_10058425
549 Ga0207711_10199863
550 Ga0207689_10056264
551 Ga0207679_10100622
552 Ga0207667_10173336
553 Ga0207651_10005098
554 Ga0207651_10060807
555 Ga0207668_10004714
556 Ga0207668_10524023
557 Ga0207658_10009939
558 Ga0207658_10250077
559 Ga0207677_10015470
560 Ga0207703_10485844
561 Ga0207678_10044917
562 Ga0207708_10000053
563 Ga0207702_10070925
564 Ga0207648_10002471
565 Ga0207648_10072421
566 Ga0207648_10168699
567 Ga0207674_10023742
568 Ga0207683_10000249
569 Ga0207683_10085628
570 Ga0207698_10023792
571 Ga0209968_1000365
572 Ga0209970_1000402
573 Ga0209983_1000217
574 Ga0209588_1030508
575 Ga0209971_1000093
576 Ga0209974_10003052
577 Ga0209974_10036918
578 Ga0268266_10054478
579 Ga0268266_10099536
580 Ga0268266_10327624
581 Ga0268264_10007042
582 Ga0265760_10008170
583 Ga0265330_10014245
584 Ga0265325_10003459
585 Ga0265331_10028119
586 Ga0265316_10008420
587 Ga0307408_100059480
588 Ga0265313_10014635
589 Ga0307410_10006106
590 Ga0307409_100013146
591 Ga0307414_10311649
592 Ga0307411_10192389
593 Ga0373945_0026761
594 Ga0373943_0035948
595 Ga0373961_0000533
596 Ga0373947_0236655
597 Ga0373937_0114768
598 Ga0373937_0312222
599 Ga0373925_0093115
600 Ga0395899_0114894
601 Ga0395901_0047194
602 Ga0436365_1210582
603 Ga0436363_1226659
604 Ga0451839_0484724
605 Ga0453683_0037027
606 Ga0451576_0016219
607 Ga0495629_0033310
608 Ga0495582_0017145
609 Ga0495639_0011365
610 Ga0495594_0013765
611 Ga0495594_0050954
612 Ga0495620_0002856
613 Ga0495642_0161296
614 Ga0495665_0028983
615 Ga0495621_0013139
616 Ga0495645_0197337
617 Ga0495667_0188760
618 Ga0495668_0223576
619 Ga0495634_0052030
620 Ga0495635_0015956
621 Ga0495647_0011593
622 Ga0495613_0008185
623 Ga0495600_0020104
624 Ga0495581_0013371
625 Ga0495604_0287082
626 Ga0495684_0013401
627 Ga0496100_0150150
628 Ga0496101_0088692
629 Ga0496102_0079980
630 Ga0496104_0006921
631 Ga0496104_0048827
632 Ga0496109_0308428
633 Ga0496110_0022443
634 Ga0496110_0126960
635 Ga0496111_0001040
636 Ga0496112_0018854
637 Ga0496112_0109516
638 Ga0496112_0342576
639 Ga0496114_0010012
640 Ga0496115_0000936
641 Ga0501040_0199669
642 Ga0501073_0004844
643 Ga0501076_0249389
644 Ga0501079_0122622
645 Ga0501080_0010820
646 Ga0501080_0400381
647 Ga0501045_0333113
648 nmdc:mga05p37_150287_c1
649 nmdc:mga06r32_74659_c1
650 nmdc:mga0rr50_64588_c1
651 Ga0495655_0000061
652 Ga0495619_0047220
653 Ga0501084_0244934
654 Ga0530510_0362869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.4862 27 310
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.4791 27 310
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.4778 27 311
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.4707 27 311
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.4608 29 311
ID Description Score Start End Superfamily
af_Q55F06_951_1146_1.10.357.50 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2; 0.3575 27 198 1.10.357.50
af_Q55F06_951_1146_1.10.357.50 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2; 0.3299 27 198 1.10.357.50
af_P0AAG5_6_324_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2883 24 312 1.20.1560.10
af_A0A1D8PGJ1_83_331_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.2843 47 168 1.20.58.70
af_Q651I6_271_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2828 28 193 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7XPZ4-F1-model_v4 ABC transporter permease 0.9594 30 313 GO:0016020
AF-A0A2V7XPZ4-F1-model_v4 ABC transporter permease 0.9527 30 313 GO:0016020
AF-A0A538TYP4-F1-model_v4 ABC transporter permease 0.9349 26 313 GO:0016020
AF-A0A525KDW9-F1-model_v4 ABC transporter permease 0.9338 15 313 GO:0016020
AF-A0A2V7X5R0-F1-model_v4 ABC transporter permease 0.9266 30 313 GO:0016020

Map