F408812

General Info

Members Datasets Scaffolds Average Seq Length
327 181 654 430

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10200049|Ga0207684_102000491
Length 469
Sequence VLPESHRAIHLIMFSQLSSKLHETFKDLRGHGTISESNIDTALRQVRLALLEADVDFQVAKKFIACVKQKSLGEDVLRSITPGQQIIKIFHDELTALLGGDPVPLDLSRPGRILIVGLNGSGKTTSCAKLARLLKKQGRLPALMACDLQRPAAIEQLVTLGKQIDVPVFVPDPGEKNVQRAIAIVLAQDKQGSVGRSSSDAHLRHGLAEAEPSICIFDTAGRQEIDQPLIEELKQLKEVMQPQETLLVVDAATGQQAVSVATHFNDALQITGIILAKLDGDARGGAALSMREVTHSPIKFVGVGERLDQFELFVPERLAGRILGMGDVVTLVEKAAEVVEEEEAARLERKLRTASFDFNDFLAQFKMMQKLGPLENILGMLPGMSNLQGLSVDERQIKRTEAIVLSMTSEERTRPDILNARRRQRIARGSGSTVTEVNELLRRFDQMRKMMKSTGKMKGALKMLQKLHR

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 7.03
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10200049 3300025910 Bacteria 1723
2 CNXas_1000173 3300000545 Bacteria 10476
3 JGI25406J46586_10000033 3300003203 Bacteria 65430
4 JGI25405J52794_10000071 3300003911 Bacteria 11109
5 Ga0065712_10003023 3300005290 Bacteria 6311
6 Ga0065712_10015933 3300005290 Bacteria 2309
7 Ga0065715_10001127 3300005293 Bacteria 7677
8 Ga0065715_10005314 3300005293 Bacteria 3214
9 Ga0065715_10089774 3300005293 Bacteria 8553
10 Ga0070658_10002669 3300005327 Bacteria 14830
11 Ga0070658_10018369 3300005327 Bacteria 5598
12 Ga0070676_10015007 3300005328 Bacteria 4266
13 Ga0070676_10017544 3300005328 Bacteria 3961
14 Ga0070683_100028595 3300005329 Bacteria 5039
15 Ga0070690_100017352 3300005330 Bacteria 4326
16 Ga0070690_100120907 3300005330 Bacteria 1757
17 Ga0070670_100005129 3300005331 Bacteria 11019
18 Ga0070670_100058925 3300005331 Bacteria 3296
19 Ga0070666_10010490 3300005335 Bacteria 5796
20 Ga0068868_100036789 3300005338 Bacteria 3792
21 Ga0068868_100038531 3300005338 Unclassified 3711
22 Ga0070689_100037624 3300005340 Bacteria 3700
23 Ga0070689_100053893 3300005340 Bacteria 3113
24 Ga0070669_100018744 3300005353 Bacteria 4947
25 Ga0070675_100007201 3300005354 Bacteria 8574
26 Ga0070671_100043770 3300005355 Bacteria 3720
27 Ga0070671_100099399 3300005355 Bacteria 2440
28 Ga0070671_100101369 3300005355 Unclassified 2415
29 Ga0070673_100025643 3300005364 Bacteria 4343
30 Ga0070659_100211803 3300005366 Bacteria 1597
31 Ga0070667_100105354 3300005367 Bacteria 2440
32 Ga0070714_100096811 3300005435 Unclassified 2593
33 Ga0070713_100023430 3300005436 Bacteria 4791
34 Ga0070713_100046749 3300005436 Unclassified 3552
35 Ga0070713_100081639 3300005436 Bacteria 2759
36 Ga0070711_100059417 3300005439 Bacteria 2654
37 Ga0070711_100130528 3300005439 Bacteria 1871
38 Ga0070711_100131494 3300005439 Bacteria 1864
39 Ga0070705_100051595 3300005440 Bacteria 2399
40 Ga0070708_100024971 3300005445 Bacteria 5107
41 Ga0070708_100057737 3300005445 Bacteria 3456
42 Ga0070708_100137711 3300005445 Bacteria 2262
43 Ga0070708_100284106 3300005445 Bacteria 1558
44 Ga0070663_100045053 3300005455 Bacteria 3114
45 Ga0070678_100037047 3300005456 Bacteria 3421
46 Ga0070662_100101463 3300005457 Bacteria 2178
47 Ga0070681_10021678 3300005458 Bacteria 6442
48 Ga0068867_100030916 3300005459 Bacteria 3864
49 Ga0070706_100011687 3300005467 Bacteria 8150
50 Ga0070706_100023080 3300005467 Bacteria 5730
51 Ga0070706_100028586 3300005467 Bacteria 5134
52 Ga0070706_100042289 3300005467 Bacteria 4209
53 Ga0070707_100041382 3300005468 Bacteria 4410
54 Ga0070707_100052397 3300005468 Bacteria 3913
55 Ga0070707_100079380 3300005468 Bacteria 3167
56 Ga0070707_100119869 3300005468 Bacteria 2554
57 Ga0070698_100002787 3300005471 Bacteria 19245
58 Ga0070698_100006708 3300005471 Bacteria 12488
59 Ga0070698_100013682 3300005471 Bacteria 8590
60 Ga0070699_100024815 3300005518 Bacteria 5168
61 Ga0070699_100100740 3300005518 Unclassified 2532
62 Ga0070699_100203994 3300005518 Bacteria 1759
63 Ga0070684_100007084 3300005535 Bacteria 8714
64 Ga0070697_100003171 3300005536 Bacteria 12632
65 Ga0070697_100004757 3300005536 Bacteria 10407
66 Ga0070697_100011875 3300005536 Bacteria 6817
67 Ga0070697_100101740 3300005536 Bacteria 2387
68 Ga0070697_100104384 3300005536 Bacteria 2356
69 Ga0068853_100000066 3300005539 Bacteria 74291
70 Ga0070686_100066912 3300005544 Bacteria 2339
71 Ga0070695_100059153 3300005545 Bacteria 2480
72 Ga0070696_100102602 3300005546 Bacteria 2051
73 Ga0070665_100004925 3300005548 Bacteria 13852
74 Ga0070665_100052362 3300005548 Bacteria 4094
75 Ga0070665_100134492 3300005548 Bacteria 2474
76 Ga0070704_100118078 3300005549 Bacteria 2031
77 Ga0070704_100151494 3300005549 Bacteria 1824
78 Ga0068855_100002600 3300005563 Bacteria 22255
79 Ga0068855_100421944 3300005563 Bacteria 1459
80 Ga0070664_100018951 3300005564 Bacteria 5658
81 Ga0068856_100083204 3300005614 Bacteria 3177
82 Ga0068863_100069523 3300005841 Bacteria 3329
83 Ga0068858_100059907 3300005842 Bacteria 3519
84 Ga0068858_100183221 3300005842 Bacteria 1978
85 Ga0068860_100000183 3300005843 Bacteria 100738
86 Ga0068860_100032276 3300005843 Bacteria 5032
87 Ga0081455_10001745 3300005937 Bacteria 26278
88 Ga0081455_10002335 3300005937 Bacteria 22643
89 Ga0081455_10008963 3300005937 Bacteria 10338
90 Ga0081455_10042526 3300005937 Bacteria 3984
91 Ga0081540_1002173 3300005983 Bacteria 16238
92 Ga0081540_1004731 3300005983 Bacteria 10293
93 Ga0081540_1033697 3300005983 Bacteria 2776
94 Ga0081539_10000138 3300005985 Bacteria 170633
95 Ga0081539_10007151 3300005985 Bacteria 10298
96 Ga0081539_10017378 3300005985 Bacteria 5054
97 Ga0070717_10028359 3300006028 Bacteria 4480
98 Ga0070717_10052539 3300006028 Unclassified 3357
99 Ga0070717_10073658 3300006028 Bacteria 2855
100 Ga0075363_100010774 3300006048 Unclassified 4357
101 Ga0070712_100006267 3300006175 Bacteria 7368
102 Ga0070712_100016616 3300006175 Bacteria 4755
103 Ga0070712_100200671 3300006175 Bacteria 1567
104 Ga0097621_100042743 3300006237 Bacteria 3652
105 Ga0097621_100174424 3300006237 Bacteria 1855
106 Ga0075370_10068560 3300006353 Bacteria 2026
107 Ga0068871_100038623 3300006358 Bacteria 3814
108 Ga0068871_100050628 3300006358 Bacteria 3360
109 Ga0075428_100000133 3300006844 Bacteria 65398
110 Ga0075431_100332031 3300006847 Bacteria 1531
111 Ga0075436_100068756 3300006914 Bacteria 2447
112 Ga0075436_100112175 3300006914 Bacteria 1904
113 Ga0099794_10064145 3300007265 Bacteria 1789
114 Ga0105240_10000661 3300009093 Bacteria 63392
115 Ga0105240_10112247 3300009093 Bacteria 3296
116 Ga0111539_10000855 3300009094 Bacteria 39730
117 Ga0111539_10214405 3300009094 Bacteria 2243
118 Ga0105245_10097107 3300009098 Bacteria 2720
119 Ga0114129_10121000 3300009147 Unclassified 3603
120 Ga0105242_10022420 3300009176 Bacteria 4966
121 Ga0105242_10025578 3300009176 Bacteria 4673
122 Ga0105237_10005926 3300009545 Bacteria 13704
123 Ga0105249_10069541 3300009553 Bacteria 3249
124 Ga0157374_10000059 3300013296 Bacteria 116409
125 Ga0157374_10070022 3300013296 Bacteria 3304
126 Ga0157374_10148798 3300013296 Bacteria 2276
127 Ga0157374_10320633 3300013296 Bacteria 1535
128 Ga0157378_10006936 3300013297 Bacteria 9889
129 Ga0157378_10047364 3300013297 Bacteria 3822
130 Ga0157378_10060007 3300013297 Bacteria 3394
131 Ga0157378_10102904 3300013297 Bacteria 2609
132 Ga0163162_10051756 3300013306 Bacteria 4121
133 Ga0163162_10064484 3300013306 Bacteria 3708
134 Ga0163162_10100950 3300013306 Bacteria 2977
135 Ga0157372_10039737 3300013307 Bacteria 5193
136 Ga0157375_10003770 3300013308 Bacteria 13135
137 Ga0157375_10022047 3300013308 Bacteria 5858
138 Ga0157376_10000614 3300014969 Bacteria 23113
139 Ga0163161_10012978 3300017792 Bacteria 5789
140 Ga0213872_10001670 3300021361 Bacteria 13967
141 Ga0213872_10006805 3300021361 Bacteria 5692
142 Ga0213876_10001903 3300021384 Bacteria 12553
143 Ga0213876_10003594 3300021384 Bacteria 8820
144 Ga0213876_10004554 3300021384 Bacteria 7740
145 Ga0213876_10025291 3300021384 Bacteria 3133
146 Ga0213871_10011257 3300021441 Bacteria 2050
147 Ga0209050_1000421 3300025298 Bacteria 78277
148 Ga0207697_10001007 3300025315 Bacteria 15769
149 Ga0207697_10002439 3300025315 Bacteria 9640
150 Ga0207697_10003119 3300025315 Bacteria 8285
151 Ga0207697_10006339 3300025315 Bacteria 5366
152 Ga0207692_10040711 3300025898 Bacteria 2295
153 Ga0207688_10010957 3300025901 Bacteria 4933
154 Ga0207647_10139627 3300025904 Bacteria 1420
155 Ga0207699_10157409 3300025906 Bacteria 1509
156 Ga0207645_10004672 3300025907 Bacteria 10081
157 Ga0207645_10011792 3300025907 Bacteria 5951
158 Ga0207645_10014185 3300025907 Bacteria 5338
159 Ga0207705_10005087 3300025909 Bacteria 9858
160 Ga0207684_10005087 3300025910 Bacteria 12260
161 Ga0207684_10011432 3300025910 Bacteria 7767
162 Ga0207684_10036451 3300025910 Bacteria 4174
163 Ga0207684_10039476 3300025910 Bacteria 4004
164 Ga0207684_10051307 3300025910 Bacteria 3499
165 Ga0207684_10128494 3300025910 Bacteria 2175
166 Ga0207695_10000738 3300025913 Bacteria 63394
167 Ga0207695_10106941 3300025913 Bacteria 2783
168 Ga0207671_10016692 3300025914 Bacteria 5698
169 Ga0207693_10007146 3300025915 Bacteria 9208
170 Ga0207693_10027291 3300025915 Bacteria 4514
171 Ga0207693_10028493 3300025915 Bacteria 4412
172 Ga0207693_10047152 3300025915 Bacteria 3386
173 Ga0207693_10113290 3300025915 Bacteria 2128
174 Ga0207663_10004157 3300025916 Bacteria 7166
175 Ga0207663_10050043 3300025916 Bacteria 2595
176 Ga0207663_10092517 3300025916 Bacteria 2010
177 Ga0207660_10027842 3300025917 Bacteria 3861
178 Ga0207662_10015657 3300025918 Bacteria 4269
179 Ga0207646_10000108 3300025922 Bacteria 112950
180 Ga0207646_10025502 3300025922 Bacteria 5408
181 Ga0207646_10026757 3300025922 Bacteria 5262
182 Ga0207646_10049807 3300025922 Bacteria 3750
183 Ga0207646_10058700 3300025922 Bacteria 3437
184 Ga0207646_10107784 3300025922 Bacteria 2499
185 Ga0207646_10165476 3300025922 Bacteria 1996
186 Ga0207681_10045005 3300025923 Bacteria 2961
187 Ga0207681_10080762 3300025923 Bacteria 2294
188 Ga0207681_10146076 3300025923 Bacteria 1767
189 Ga0207650_10003918 3300025925 Bacteria 10180
190 Ga0207700_10011937 3300025928 Bacteria 5570
191 Ga0207700_10021948 3300025928 Bacteria 4372
192 Ga0207664_10063340 3300025929 Bacteria 2955
193 Ga0207644_10008548 3300025931 Bacteria 6698
194 Ga0207644_10107412 3300025931 Bacteria 2106
195 Ga0207706_10019660 3300025933 Bacteria 6075
196 Ga0207706_10053098 3300025933 Bacteria 3578
197 Ga0207706_10130234 3300025933 Bacteria 2213
198 Ga0207670_10033273 3300025936 Bacteria 3320
199 Ga0207704_10080210 3300025938 Bacteria 2106
200 Ga0207665_10007229 3300025939 Bacteria 7348
201 Ga0207665_10057953 3300025939 Unclassified 2617
202 Ga0207665_10067717 3300025939 Unclassified 2432
203 Ga0207665_10069545 3300025939 Bacteria 2401
204 Ga0207691_10003406 3300025940 Bacteria 15457
205 Ga0207691_10125797 3300025940 Unclassified 2268
206 Ga0207661_10053997 3300025944 Bacteria 3217
207 Ga0207651_10068034 3300025960 Bacteria 2509
208 Ga0207658_10053370 3300025986 Bacteria 2986
209 Ga0207677_10076857 3300026023 Bacteria 2379
210 Ga0207703_10023941 3300026035 Bacteria 4803
211 Ga0207703_10058448 3300026035 Bacteria 3148
212 Ga0207639_10000097 3300026041 Bacteria 74426
213 Ga0207678_10001436 3300026067 Bacteria 21863
214 Ga0207702_10066359 3300026078 Bacteria 3093
215 Ga0207641_10037801 3300026088 Bacteria 4034
216 Ga0207676_10103442 3300026095 Bacteria 2367
217 Ga0207683_10006765 3300026121 Bacteria 9811
218 Ga0207683_10014801 3300026121 Bacteria 6639
219 Ga0207683_10024517 3300026121 Bacteria 5197
220 Ga0207683_10056103 3300026121 Bacteria 3455
221 Ga0207428_10039526 3300027907 Bacteria 3831
222 Ga0268264_10000476 3300028381 Bacteria 53780
223 Ga0307513_10044322 3300031456 Bacteria 4874
224 Ga0373945_0018235 3300035116 Bacteria 2387
225 Ga0373943_0052184 3300035170 Bacteria 2016
226 Ga0373946_0015788 3300035171 Bacteria 2869
227 Ga0373931_0060365 3300035691 Bacteria 2041
228 Ga0373935_0009788 3300035692 Bacteria 5742
229 Ga0373935_0044051 3300035692 Bacteria 2811
230 Ga0373935_0055905 3300035692 Bacteria 2515
231 Ga0373947_0024833 3300035725 Bacteria 3495
232 Ga0373947_0057601 3300035725 Bacteria 2352
233 Ga0373937_0027029 3300036401 Bacteria 5186
234 Ga0373937_0147184 3300036401 Unclassified 2205
235 Ga0373937_0249466 3300036401 Bacteria 1673
236 Ga0395900_0002312 3300037418 Bacteria 21131
237 Ga0395900_0026872 3300037418 Bacteria 5890
238 Ga0395900_0141473 3300037418 Bacteria 2464
239 Ga0395900_0168946 3300037418 Bacteria 2228
240 Ga0395898_0027502 3300037466 Bacteria 5708
241 Ga0395905_0017241 3300037471 Bacteria 6859
242 Ga0395905_0123470 3300037471 Bacteria 2435
243 Ga0395905_0200320 3300037471 Bacteria 1872
244 Ga0436364_0882717 3300037853 Bacteria 4773
245 Ga0395901_0039869 3300038443 Bacteria 4862
246 Ga0395901_0100269 3300038443 Bacteria 3037
247 Ga0395901_0146171 3300038443 Bacteria 2485
248 Ga0436365_0195681 3300039437 Bacteria 12737
249 Ga0436365_0874983 3300039437 Bacteria 53988
250 Ga0436365_1158047 3300039437 Bacteria 1664
251 Ga0436365_1592200 3300039437 Bacteria 19337
252 Ga0436365_1667580 3300039437 Bacteria 5347
253 Ga0436365_1668063 3300039437 Bacteria 12148
254 Ga0436360_0113987 3300039438 Bacteria 5647
255 Ga0436360_0863539 3300039438 Bacteria 3302
256 Ga0436360_0953683 3300039438 Bacteria 2546
257 Ga0436361_0229480 3300039447 Bacteria 8539
258 Ga0436361_0312074 3300039447 Bacteria 5217
259 Ga0436361_0698610 3300039447 Bacteria 5025
260 Ga0436361_0727091 3300039447 Bacteria 2410
261 Ga0436361_0800822 3300039447 Bacteria 1624
262 Ga0436361_0892036 3300039447 Bacteria 2335
263 Ga0436363_0854040 3300039450 Bacteria 16936
264 Ga0436362_0356896 3300039453 Unclassified 2817
265 Ga0451577_0037098 3300042876 Bacteria 4388
266 Ga0451576_0017306 3300045051 Bacteria 7931
267 Ga0466967_0013442 3300045976 Bacteria 6326
268 Ga0495592_0022953 3300046454 Unclassified 4748
269 Ga0495592_0039292 3300046454 Bacteria 3555
270 Ga0495653_0068451 3300046463 Bacteria 2663
271 Ga0495628_0022456 3300046516 Bacteria 5182
272 Ga0495643_0000191 3300046522 Bacteria 97250
273 Ga0495652_0012541 3300046529 Bacteria 7642
274 Ga0495652_0020595 3300046529 Bacteria 5861
275 Ga0495587_0057237 3300046536 Bacteria 2292
276 Ga0495598_0003398 3300046537 Bacteria 3379
277 Ga0495645_0011316 3300046543 Bacteria 6274
278 Ga0495645_0018574 3300046543 Unclassified 4996
279 Ga0495635_0104859 3300046663 Bacteria 1932
280 Ga0495599_0007832 3300046678 Bacteria 6485
281 Ga0495623_0015384 3300046679 Bacteria 4944
282 Ga0495623_0105145 3300046679 Unclassified 1716
283 Ga0495646_0005107 3300046680 Bacteria 8275
284 Ga0495658_0085414 3300046683 Bacteria 1860
285 Ga0495604_0071177 3300047317 Bacteria 2631
286 Ga0495674_0150816 3300047319 Bacteria 1949
287 Ga0495675_0017945 3300047444 Bacteria 4487
288 Ga0495675_0018687 3300047444 Unclassified 4401
289 Ga0495684_0170645 3300047471 Unclassified 1618
290 Ga0495602_0043870 3300048088 Bacteria 4060
291 Ga0496100_0070450 3300048903 Bacteria 2332
292 Ga0496101_0043004 3300048904 Bacteria 3227
293 Ga0496101_0164383 3300048904 Bacteria 1703
294 Ga0496102_0031755 3300048905 Bacteria 4740
295 Ga0496103_0053422 3300048906 Bacteria 2504
296 Ga0496103_0098527 3300048906 Bacteria 1849
297 Ga0496104_0014922 3300048907 Bacteria 7024
298 Ga0496105_0077922 3300048908 Bacteria 2737
299 Ga0496105_0196685 3300048908 Bacteria 1647
300 Ga0496106_0119183 3300048909 Bacteria 2061
301 Ga0496106_0186733 3300048909 Bacteria 1647
302 Ga0496108_0036174 3300048911 Bacteria 4107
303 Ga0496109_0012651 3300048912 Bacteria 7290
304 Ga0496109_0065982 3300048912 Bacteria 3313
305 Ga0496110_0160354 3300048913 Bacteria 2039
306 Ga0496110_0216140 3300048913 Bacteria 1743
307 Ga0496112_0010080 3300048915 Bacteria 8557
308 Ga0496113_0075584 3300048916 Bacteria 2571
309 Ga0496114_0217837 3300048917 Bacteria 1675
310 Ga0496115_0003485 3300048918 Bacteria 11311
311 Ga0496115_0008973 3300048918 Bacteria 7412
312 Ga0496115_0021153 3300048918 Bacteria 5022
313 Ga0496115_0162675 3300048918 Bacteria 1845
314 Ga0496121_0207719 3300048924 Bacteria 1390
315 Ga0496125_0000017 3300048928 Bacteria 508217
316 Ga0501034_0237404 3300049571 Bacteria 1770
317 Ga0501080_0072804 3300049742 Bacteria 3197
318 nmdc:mga07m45_1325_c1 3300050496 Unclassified 2878
319 nmdc:mga08y16_171810_c1 3300050511 Bacteria 2251
320 nmdc:mga08y16_276273_c1 3300050511 Bacteria 1733
321 nmdc:mga08y16_7292_c1 3300050511 Bacteria 11600
322 nmdc:mga0rr50_77379_c1 3300050513 Bacteria 2556
323 nmdc:mga08x19_10477_c1 3300050514 Bacteria 5566
324 Ga0495601_0012825 3300053077 Bacteria 5030
325 Ga0500555_000660 3300053103 Bacteria 13213
326 Ga0500556_0000231 3300053104 Bacteria 45338
327 Ga0500616_0073700 3300053153 Bacteria 1732
328 Ga0207684_10200049
329 CNXas_1000173
330 JGI25406J46586_10000033
331 JGI25405J52794_10000071
332 Ga0065712_10003023
333 Ga0065712_10015933
334 Ga0065715_10001127
335 Ga0065715_10005314
336 Ga0065715_10089774
337 Ga0070658_10002669
338 Ga0070658_10018369
339 Ga0070676_10015007
340 Ga0070676_10017544
341 Ga0070683_100028595
342 Ga0070690_100017352
343 Ga0070690_100120907
344 Ga0070670_100005129
345 Ga0070670_100058925
346 Ga0070666_10010490
347 Ga0068868_100036789
348 Ga0068868_100038531
349 Ga0070689_100037624
350 Ga0070689_100053893
351 Ga0070669_100018744
352 Ga0070675_100007201
353 Ga0070671_100043770
354 Ga0070671_100099399
355 Ga0070671_100101369
356 Ga0070673_100025643
357 Ga0070659_100211803
358 Ga0070667_100105354
359 Ga0070714_100096811
360 Ga0070713_100023430
361 Ga0070713_100046749
362 Ga0070713_100081639
363 Ga0070711_100059417
364 Ga0070711_100130528
365 Ga0070711_100131494
366 Ga0070705_100051595
367 Ga0070708_100024971
368 Ga0070708_100057737
369 Ga0070708_100137711
370 Ga0070708_100284106
371 Ga0070663_100045053
372 Ga0070678_100037047
373 Ga0070662_100101463
374 Ga0070681_10021678
375 Ga0068867_100030916
376 Ga0070706_100011687
377 Ga0070706_100023080
378 Ga0070706_100028586
379 Ga0070706_100042289
380 Ga0070707_100041382
381 Ga0070707_100052397
382 Ga0070707_100079380
383 Ga0070707_100119869
384 Ga0070698_100002787
385 Ga0070698_100006708
386 Ga0070698_100013682
387 Ga0070699_100024815
388 Ga0070699_100100740
389 Ga0070699_100203994
390 Ga0070684_100007084
391 Ga0070697_100003171
392 Ga0070697_100004757
393 Ga0070697_100011875
394 Ga0070697_100101740
395 Ga0070697_100104384
396 Ga0068853_100000066
397 Ga0070686_100066912
398 Ga0070695_100059153
399 Ga0070696_100102602
400 Ga0070665_100004925
401 Ga0070665_100052362
402 Ga0070665_100134492
403 Ga0070704_100118078
404 Ga0070704_100151494
405 Ga0068855_100002600
406 Ga0068855_100421944
407 Ga0070664_100018951
408 Ga0068856_100083204
409 Ga0068863_100069523
410 Ga0068858_100059907
411 Ga0068858_100183221
412 Ga0068860_100000183
413 Ga0068860_100032276
414 Ga0081455_10001745
415 Ga0081455_10002335
416 Ga0081455_10008963
417 Ga0081455_10042526
418 Ga0081540_1002173
419 Ga0081540_1004731
420 Ga0081540_1033697
421 Ga0081539_10000138
422 Ga0081539_10007151
423 Ga0081539_10017378
424 Ga0070717_10028359
425 Ga0070717_10052539
426 Ga0070717_10073658
427 Ga0075363_100010774
428 Ga0070712_100006267
429 Ga0070712_100016616
430 Ga0070712_100200671
431 Ga0097621_100042743
432 Ga0097621_100174424
433 Ga0075370_10068560
434 Ga0068871_100038623
435 Ga0068871_100050628
436 Ga0075428_100000133
437 Ga0075431_100332031
438 Ga0075436_100068756
439 Ga0075436_100112175
440 Ga0099794_10064145
441 Ga0105240_10000661
442 Ga0105240_10112247
443 Ga0111539_10000855
444 Ga0111539_10214405
445 Ga0105245_10097107
446 Ga0114129_10121000
447 Ga0105242_10022420
448 Ga0105242_10025578
449 Ga0105237_10005926
450 Ga0105249_10069541
451 Ga0157374_10000059
452 Ga0157374_10070022
453 Ga0157374_10148798
454 Ga0157374_10320633
455 Ga0157378_10006936
456 Ga0157378_10047364
457 Ga0157378_10060007
458 Ga0157378_10102904
459 Ga0163162_10051756
460 Ga0163162_10064484
461 Ga0163162_10100950
462 Ga0157372_10039737
463 Ga0157375_10003770
464 Ga0157375_10022047
465 Ga0157376_10000614
466 Ga0163161_10012978
467 Ga0213872_10001670
468 Ga0213872_10006805
469 Ga0213876_10001903
470 Ga0213876_10003594
471 Ga0213876_10004554
472 Ga0213876_10025291
473 Ga0213871_10011257
474 Ga0209050_1000421
475 Ga0207697_10001007
476 Ga0207697_10002439
477 Ga0207697_10003119
478 Ga0207697_10006339
479 Ga0207692_10040711
480 Ga0207688_10010957
481 Ga0207647_10139627
482 Ga0207699_10157409
483 Ga0207645_10004672
484 Ga0207645_10011792
485 Ga0207645_10014185
486 Ga0207705_10005087
487 Ga0207684_10005087
488 Ga0207684_10011432
489 Ga0207684_10036451
490 Ga0207684_10039476
491 Ga0207684_10051307
492 Ga0207684_10128494
493 Ga0207695_10000738
494 Ga0207695_10106941
495 Ga0207671_10016692
496 Ga0207693_10007146
497 Ga0207693_10027291
498 Ga0207693_10028493
499 Ga0207693_10047152
500 Ga0207693_10113290
501 Ga0207663_10004157
502 Ga0207663_10050043
503 Ga0207663_10092517
504 Ga0207660_10027842
505 Ga0207662_10015657
506 Ga0207646_10000108
507 Ga0207646_10025502
508 Ga0207646_10026757
509 Ga0207646_10049807
510 Ga0207646_10058700
511 Ga0207646_10107784
512 Ga0207646_10165476
513 Ga0207681_10045005
514 Ga0207681_10080762
515 Ga0207681_10146076
516 Ga0207650_10003918
517 Ga0207700_10011937
518 Ga0207700_10021948
519 Ga0207664_10063340
520 Ga0207644_10008548
521 Ga0207644_10107412
522 Ga0207706_10019660
523 Ga0207706_10053098
524 Ga0207706_10130234
525 Ga0207670_10033273
526 Ga0207704_10080210
527 Ga0207665_10007229
528 Ga0207665_10057953
529 Ga0207665_10067717
530 Ga0207665_10069545
531 Ga0207691_10003406
532 Ga0207691_10125797
533 Ga0207661_10053997
534 Ga0207651_10068034
535 Ga0207658_10053370
536 Ga0207677_10076857
537 Ga0207703_10023941
538 Ga0207703_10058448
539 Ga0207639_10000097
540 Ga0207678_10001436
541 Ga0207702_10066359
542 Ga0207641_10037801
543 Ga0207676_10103442
544 Ga0207683_10006765
545 Ga0207683_10014801
546 Ga0207683_10024517
547 Ga0207683_10056103
548 Ga0207428_10039526
549 Ga0268264_10000476
550 Ga0307513_10044322
551 Ga0373945_0018235
552 Ga0373943_0052184
553 Ga0373946_0015788
554 Ga0373931_0060365
555 Ga0373935_0009788
556 Ga0373935_0044051
557 Ga0373935_0055905
558 Ga0373947_0024833
559 Ga0373947_0057601
560 Ga0373937_0027029
561 Ga0373937_0147184
562 Ga0373937_0249466
563 Ga0395900_0002312
564 Ga0395900_0026872
565 Ga0395900_0141473
566 Ga0395900_0168946
567 Ga0395898_0027502
568 Ga0395905_0017241
569 Ga0395905_0123470
570 Ga0395905_0200320
571 Ga0436364_0882717
572 Ga0395901_0039869
573 Ga0395901_0100269
574 Ga0395901_0146171
575 Ga0436365_0195681
576 Ga0436365_0874983
577 Ga0436365_1158047
578 Ga0436365_1592200
579 Ga0436365_1667580
580 Ga0436365_1668063
581 Ga0436360_0113987
582 Ga0436360_0863539
583 Ga0436360_0953683
584 Ga0436361_0229480
585 Ga0436361_0312074
586 Ga0436361_0698610
587 Ga0436361_0727091
588 Ga0436361_0800822
589 Ga0436361_0892036
590 Ga0436363_0854040
591 Ga0436362_0356896
592 Ga0451577_0037098
593 Ga0451576_0017306
594 Ga0466967_0013442
595 Ga0495592_0022953
596 Ga0495592_0039292
597 Ga0495653_0068451
598 Ga0495628_0022456
599 Ga0495643_0000191
600 Ga0495652_0012541
601 Ga0495652_0020595
602 Ga0495587_0057237
603 Ga0495598_0003398
604 Ga0495645_0011316
605 Ga0495645_0018574
606 Ga0495635_0104859
607 Ga0495599_0007832
608 Ga0495623_0015384
609 Ga0495623_0105145
610 Ga0495646_0005107
611 Ga0495658_0085414
612 Ga0495604_0071177
613 Ga0495674_0150816
614 Ga0495675_0017945
615 Ga0495675_0018687
616 Ga0495684_0170645
617 Ga0495602_0043870
618 Ga0496100_0070450
619 Ga0496101_0043004
620 Ga0496101_0164383
621 Ga0496102_0031755
622 Ga0496103_0053422
623 Ga0496103_0098527
624 Ga0496104_0014922
625 Ga0496105_0077922
626 Ga0496105_0196685
627 Ga0496106_0119183
628 Ga0496106_0186733
629 Ga0496108_0036174
630 Ga0496109_0012651
631 Ga0496109_0065982
632 Ga0496110_0160354
633 Ga0496110_0216140
634 Ga0496112_0010080
635 Ga0496113_0075584
636 Ga0496114_0217837
637 Ga0496115_0003485
638 Ga0496115_0008973
639 Ga0496115_0021153
640 Ga0496115_0162675
641 Ga0496121_0207719
642 Ga0496125_0000017
643 Ga0501034_0237404
644 Ga0501080_0072804
645 nmdc:mga07m45_1325_c1
646 nmdc:mga08y16_171810_c1
647 nmdc:mga08y16_276273_c1
648 nmdc:mga08y16_7292_c1
649 nmdc:mga0rr50_77379_c1
650 nmdc:mga08x19_10477_c1
651 Ga0495601_0012825
652 Ga0500555_000660
653 Ga0500556_0000231
654 Ga0500616_0073700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02881

SRP54_N

SRP54-type protein, helical bundle domain

17

94

0.97

PF02978

SRP_SPB

Signal peptide binding domain

355

451

0.94

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

113

310

0.86

PF00448

SRP54

SRP54-type protein, GTPase domain

110

324

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9f-assembly1.cif.gz_A bacillus subtilis ffh in complex with ppgpp 0.9431 2 296
2ng1-assembly1.cif.gz_A n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus 0.9402 3 294
1ls1-assembly1.cif.gz_A t. aquaticus ffh ng domain at 1.1a resolution 0.9368 1 296
1ls1-assembly1.cif.gz_A t. aquaticus ffh ng domain at 1.1a resolution 0.9337 1 296
2ng1-assembly1.cif.gz_A n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus 0.931 3 294
ID Description Score Start End Superfamily
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 89 281 3.40.50.300
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9244 89 281 3.40.50.300
af_Q4DKX0_351_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.919 97 293 3.40.50.300
af_P9WGD9_219_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9184 98 293 3.40.50.300
af_A0A0R0L4Y4_128_288_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9166 97 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D3J2N0-F1-model_v4 Signal recognition particle protein 0.9872 2 77 GO:0003924
GO:0005525
GO:0006614
GO:0048500
AF-A0A349S621-F1-model_v4 Signal recognition particle protein 0.9822 1 84 GO:0003924
GO:0005525
GO:0006614
GO:0048500
AF-A0A7V9ENQ6-F1-model_v4 Signal recognition particle receptor subunit alpha 0.9796 1 196 GO:0003924
GO:0005525
GO:0006614
GO:0048500
AF-A0A538BM37-F1-model_v4 Signal recognition particle protein 0.9783 1 84 GO:0003924
GO:0005525
GO:0006614
GO:0048500
AF-S4HZ86-F1-model_v4 deleted 0.9764 2 86

Map