F408810

General Info

Members Datasets Scaffolds Average Seq Length
327 196 654 122

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10480177|Ga0207645_104801771
Length 141
Sequence MPCVGDDADDFDWIAGAANQYLAACGMRDPERAAGKRLVLALEQDAHVDQLHACGGNARCTTCRVEFIEGEPTRMTVAEKQVLQAKGAIGVRLSCQIVCDHDMKVRAISRLAGSGRPDPGPTXXXHVTPPVEWSEPHITDR

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 5.81
Rhizosphere 91.13
Stem 0
Stem Tuber 0
Unclassified 25.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10480177 3300025907 Bacteria 840
2 Ga0065704_10100878 3300005289 Bacteria 2258
3 Ga0065715_10006396 3300005293 Bacteria 3126
4 Ga0065715_10007211 3300005293 Bacteria 5190
5 Ga0065715_10116683 3300005293 Bacteria 2371
6 Ga0065715_10342979 3300005293 Bacteria 964
7 Ga0065715_10389082 3300005293 Bacteria 896
8 Ga0065707_10090217 3300005295 Bacteria 4177
9 Ga0070658_11415086 3300005327 Unclassified 603
10 Ga0070683_100005931 3300005329 Bacteria 10225
11 Ga0070690_100428834 3300005330 Unclassified 976
12 Ga0070670_100029679 3300005331 Bacteria 4709
13 Ga0070670_100427662 3300005331 Unclassified 1171
14 Ga0070666_10225980 3300005335 Bacteria 1321
15 Ga0070666_11281933 3300005335 Bacteria 546
16 Ga0070680_100167881 3300005336 Unclassified 1846
17 Ga0070660_100289991 3300005339 Bacteria 1340
18 Ga0070689_100128815 3300005340 Bacteria 2028
19 Ga0070689_100512249 3300005340 Bacteria 1029
20 Ga0070687_100856514 3300005343 Unclassified 648
21 Ga0070661_100297885 3300005344 Bacteria 1255
22 Ga0070661_100472418 3300005344 Bacteria 1000
23 Ga0070668_100732491 3300005347 Unclassified 874
24 Ga0070669_100009340 3300005353 Bacteria 6983
25 Ga0070675_100057290 3300005354 Bacteria 3212
26 Ga0070675_100437919 3300005354 Bacteria 1171
27 Ga0070675_100981661 3300005354 Unclassified 775
28 Ga0070671_100653753 3300005355 Unclassified 910
29 Ga0070671_102046251 3300005355 Unclassified 510
30 Ga0070688_100648936 3300005365 Unclassified 812
31 Ga0070659_100488085 3300005366 Bacteria 1049
32 Ga0070667_100132328 3300005367 Bacteria 2178
33 Ga0070667_100493192 3300005367 Unclassified 1122
34 Ga0070667_100961597 3300005367 Bacteria 796
35 Ga0070711_100398936 3300005439 Unclassified 1116
36 Ga0070700_100746468 3300005441 Bacteria 783
37 Ga0070694_100579096 3300005444 Bacteria 902
38 Ga0070708_100548064 3300005445 Bacteria 1091
39 Ga0070663_100044271 3300005455 Bacteria 3137
40 Ga0070678_101010434 3300005456 Bacteria 765
41 Ga0070662_100186713 3300005457 Bacteria 1637
42 Ga0070681_11383541 3300005458 Bacteria 627
43 Ga0070706_100772484 3300005467 Bacteria 890
44 Ga0070679_100667467 3300005530 Bacteria 982
45 Ga0070684_100000624 3300005535 Bacteria 24433
46 Ga0070672_100014749 3300005543 Bacteria 5544
47 Ga0070672_100220476 3300005543 Bacteria 1591
48 Ga0070672_101792423 3300005543 Unclassified 552
49 Ga0070686_100495884 3300005544 Bacteria 947
50 Ga0070695_100017082 3300005545 Bacteria 4400
51 Ga0070696_100213193 3300005546 Bacteria 1446
52 Ga0070693_100094600 3300005547 Bacteria 1808
53 Ga0070693_101208245 3300005547 Bacteria 581
54 Ga0070665_100189975 3300005548 Bacteria 2055
55 Ga0070665_100598044 3300005548 Bacteria 1116
56 Ga0070704_100221033 3300005549 Bacteria 1540
57 Ga0068855_100162110 3300005563 Bacteria 2537
58 Ga0070664_100004674 3300005564 Bacteria 10987
59 Ga0070664_100348817 3300005564 Bacteria 1346
60 Ga0070664_101252216 3300005564 Bacteria 700
61 Ga0068857_100787125 3300005577 Unclassified 908
62 Ga0070702_100459399 3300005615 Bacteria 926
63 Ga0068852_100265729 3300005616 Bacteria 1649
64 Ga0068864_100084688 3300005618 Bacteria 2786
65 Ga0068864_100559985 3300005618 Bacteria 1106
66 Ga0068861_101901718 3300005719 Unclassified 592
67 Ga0068870_10620093 3300005840 Unclassified 737
68 Ga0068863_101252145 3300005841 Unclassified 748
69 Ga0075364_10044223 3300006051 Bacteria 2896
70 Ga0075367_10014867 3300006178 Bacteria 4217
71 Ga0075366_10097190 3300006195 Unclassified 1766
72 Ga0097621_100086667 3300006237 Unclassified 2614
73 Ga0097621_100383868 3300006237 Bacteria 1255
74 Ga0075370_10183458 3300006353 Unclassified 1232
75 Ga0068871_100124648 3300006358 Bacteria 2179
76 Ga0068871_100369551 3300006358 Bacteria 1272
77 Ga0068871_100749280 3300006358 Bacteria 898
78 Ga0075428_100011582 3300006844 Bacteria 9812
79 Ga0075428_100315563 3300006844 Bacteria 1680
80 Ga0075428_100658275 3300006844 Bacteria 1117
81 Ga0075431_100007187 3300006847 Bacteria 11072
82 Ga0075431_100308734 3300006847 Bacteria 1597
83 Ga0075431_101141299 3300006847 Bacteria 743
84 Ga0075434_100116811 3300006871 Bacteria 2681
85 Ga0075434_100172101 3300006871 Unclassified 2186
86 Ga0075434_100860024 3300006871 Unclassified 922
87 Ga0075429_100022337 3300006880 Bacteria 5486
88 Ga0075435_100138588 3300007076 Unclassified 2039
89 Ga0075435_101593298 3300007076 Unclassified 573
90 Ga0105240_10677591 3300009093 Bacteria 1128
91 Ga0111539_10000210 3300009094 Bacteria 69456
92 Ga0111539_10030108 3300009094 Bacteria 6601
93 Ga0111539_10268907 3300009094 Unclassified 1984
94 Ga0111539_10269384 3300009094 Bacteria 1983
95 Ga0111539_10872162 3300009094 Unclassified 1047
96 Ga0105245_10662719 3300009098 Unclassified 1074
97 Ga0114129_10049716 3300009147 Bacteria 5890
98 Ga0114129_10109444 3300009147 Bacteria 3814
99 Ga0114129_11026239 3300009147 Bacteria 1037
100 Ga0105242_10822751 3300009176 Bacteria 921
101 Ga0105242_11393631 3300009176 Unclassified 728
102 Ga0105242_11672438 3300009176 Unclassified 672
103 Ga0105248_10017669 3300009177 Bacteria 7866
104 Ga0105248_10070113 3300009177 Bacteria 3936
105 Ga0105248_10180319 3300009177 Bacteria 2380
106 Ga0105248_10424236 3300009177 Unclassified 1498
107 Ga0105248_11797693 3300009177 Bacteria 695
108 Ga0105249_10191180 3300009553 Unclassified 1998
109 Ga0105249_10422810 3300009553 Unclassified 1367
110 Ga0105249_12492286 3300009553 Bacteria 590
111 Ga0105246_11744158 3300011119 Unclassified 593
112 Ga0157370_10042351 3300013104 Bacteria 4388
113 Ga0157374_10119392 3300013296 Bacteria 2543
114 Ga0157378_10022752 3300013297 Bacteria 5515
115 Ga0157378_10152475 3300013297 Bacteria 2154
116 Ga0157378_11961919 3300013297 Bacteria 635
117 Ga0157378_13129139 3300013297 Bacteria 514
118 Ga0157375_10178527 3300013308 Bacteria 2274
119 Ga0163163_10126435 3300014325 Bacteria 2594
120 Ga0163163_11018996 3300014325 Unclassified 891
121 Ga0157380_10620147 3300014326 Bacteria 1073
122 Ga0157380_11683638 3300014326 Bacteria 691
123 Ga0157380_13209477 3300014326 Unclassified 522
124 Ga0157377_10069399 3300014745 Unclassified 2034
125 Ga0157379_10672143 3300014968 Bacteria 971
126 Ga0157376_10226140 3300014969 Bacteria 1736
127 Ga0163161_10771131 3300017792 Bacteria 806
128 Ga0207697_10122620 3300025315 Bacteria 1119
129 Ga0207642_10865458 3300025899 Unclassified 578
130 Ga0207688_10090545 3300025901 Bacteria 1756
131 Ga0207688_10103300 3300025901 Bacteria 1648
132 Ga0207680_10361614 3300025903 Unclassified 1021
133 Ga0207645_10238572 3300025907 Bacteria 1201
134 Ga0207643_10036860 3300025908 Bacteria 2743
135 Ga0207684_10782890 3300025910 Bacteria 807
136 Ga0207663_10247804 3300025916 Bacteria 1309
137 Ga0207660_10101874 3300025917 Unclassified 2146
138 Ga0207657_10260330 3300025919 Bacteria 1381
139 Ga0207649_10021496 3300025920 Bacteria 3716
140 Ga0207649_10352746 3300025920 Bacteria 1089
141 Ga0207652_10467827 3300025921 Bacteria 1136
142 Ga0207681_10184527 3300025923 Unclassified 1591
143 Ga0207681_10279483 3300025923 Bacteria 1314
144 Ga0207650_10042419 3300025925 Bacteria 3338
145 Ga0207650_10051948 3300025925 Bacteria 3035
146 Ga0207650_11249741 3300025925 Bacteria 632
147 Ga0207659_10086348 3300025926 Bacteria 2333
148 Ga0207659_10312818 3300025926 Bacteria 1294
149 Ga0207659_10741959 3300025926 Bacteria 842
150 Ga0207644_10062512 3300025931 Bacteria 2701
151 Ga0207644_10572802 3300025931 Bacteria 936
152 Ga0207644_11506978 3300025931 Unclassified 564
153 Ga0207706_10103846 3300025933 Bacteria 2500
154 Ga0207670_10833544 3300025936 Unclassified 770
155 Ga0207670_11306405 3300025936 Unclassified 615
156 Ga0207691_10128207 3300025940 Unclassified 2243
157 Ga0207691_10502140 3300025940 Bacteria 1030
158 Ga0207711_10090881 3300025941 Bacteria 2685
159 Ga0207711_10116637 3300025941 Bacteria 2381
160 Ga0207711_10282738 3300025941 Unclassified 1528
161 Ga0207711_10461441 3300025941 Bacteria 1183
162 Ga0207661_10007184 3300025944 Bacteria 7912
163 Ga0207679_10004954 3300025945 Bacteria 8308
164 Ga0207712_10121847 3300025961 Unclassified 1974
165 Ga0207712_10402557 3300025961 Unclassified 1151
166 Ga0207658_10853542 3300025986 Bacteria 828
167 Ga0207677_10298891 3300026023 Bacteria 1329
168 Ga0207678_10063550 3300026067 Bacteria 3172
169 Ga0207708_10467645 3300026075 Bacteria 1052
170 Ga0207708_11159591 3300026075 Unclassified 675
171 Ga0207641_10864118 3300026088 Unclassified 897
172 Ga0207641_11209189 3300026088 Unclassified 755
173 Ga0207676_10065412 3300026095 Bacteria 2895
174 Ga0207676_10407539 3300026095 Bacteria 1272
175 Ga0207675_102137456 3300026118 Unclassified 576
176 Ga0207683_10024063 3300026121 Bacteria 5241
177 Ga0207683_11045636 3300026121 Bacteria 758
178 Ga0209971_1012231 3300027682 Bacteria 2030
179 Ga0207428_10002224 3300027907 Bacteria 19470
180 Ga0207428_10028345 3300027907 Bacteria 4653
181 Ga0207428_10964098 3300027907 Unclassified 600
182 Ga0207428_11170188 3300027907 Unclassified 536
183 Ga0268266_10788225 3300028379 Bacteria 918
184 Ga0268265_10004053 3300028380 Bacteria 10305
185 Ga0307408_100186394 3300031548 Unclassified 1668
186 Ga0307408_100230445 3300031548 Bacteria 1517
187 Ga0307408_101641499 3300031548 Bacteria 611
188 Ga0307405_10014323 3300031731 Unclassified 4260
189 Ga0307413_10102081 3300031824 Unclassified 1898
190 Ga0307410_10042155 3300031852 Unclassified 3015
191 Ga0307406_10846275 3300031901 Unclassified 775
192 Ga0307407_10091975 3300031903 Bacteria 1862
193 Ga0307412_11246946 3300031911 Unclassified 667
194 Ga0307409_100025443 3300031995 Unclassified 4152
195 Ga0307416_100091954 3300032002 Bacteria 2607
196 Ga0307416_100104632 3300032002 Bacteria 2475
197 Ga0307414_10768317 3300032004 Bacteria 877
198 Ga0307411_10213275 3300032005 Unclassified 1492
199 Ga0307415_100125708 3300032126 Bacteria 1932
200 Ga0373962_0396407 3300035242 Bacteria 507
201 Ga0439450_201156 3300042008 Unclassified 533
202 Ga0450923_092435 3300042125 Bacteria 691
203 Ga0439434_0286301 3300042435 Bacteria 568
204 Ga0451576_0064225 3300045051 Bacteria 3824
205 Ga0495629_0053954 3300046459 Bacteria 2811
206 Ga0495638_0165101 3300046460 Bacteria 1274
207 Ga0495651_0660851 3300046462 Unclassified 654
208 Ga0495653_0038709 3300046463 Bacteria 3742
209 Ga0495585_0210163 3300046492 Bacteria 987
210 Ga0495628_0912344 3300046516 Unclassified 609
211 Ga0495663_0358084 3300046525 Unclassified 532
212 Ga0495645_0613170 3300046543 Bacteria 668
213 Ga0495656_0236660 3300046615 Bacteria 918
214 Ga0495659_0003428 3300046664 Bacteria 5065
215 Ga0495661_0450212 3300046665 Unclassified 620
216 Ga0495588_0126350 3300046674 Unclassified 1349
217 Ga0495658_0039133 3300046683 Bacteria 2630
218 Ga0495658_0130020 3300046683 Unclassified 1532
219 Ga0495600_0579807 3300046809 Bacteria 683
220 Ga0495672_0028911 3300047320 Bacteria 3499
221 Ga0495676_0104553 3300047321 Bacteria 2089
222 Ga0496101_0927493 3300048904 Unclassified 685
223 Ga0496102_0217321 3300048905 Bacteria 1802
224 Ga0496102_0365920 3300048905 Bacteria 1357
225 Ga0496102_1319820 3300048905 Bacteria 641
226 Ga0496103_0130891 3300048906 Bacteria 1602
227 Ga0496104_0009782 3300048907 Bacteria 8548
228 Ga0496104_0798104 3300048907 Unclassified 850
229 Ga0496105_0030398 3300048908 Bacteria 4426
230 Ga0496106_0041839 3300048909 Unclassified 3435
231 Ga0496107_1208911 3300048910 Unclassified 543
232 Ga0496108_0003810 3300048911 Bacteria 12077
233 Ga0496108_0626726 3300048911 Bacteria 936
234 Ga0496110_0002227 3300048913 Bacteria 14491
235 Ga0496110_0079279 3300048913 Bacteria 2924
236 Ga0496112_0001195 3300048915 Bacteria 19467
237 Ga0496112_0157587 3300048915 Bacteria 2237
238 Ga0496113_0029014 3300048916 Bacteria 3989
239 Ga0496113_0253115 3300048916 Bacteria 1406
240 Ga0496114_1601985 3300048917 Unclassified 539
241 Ga0501032_0559589 3300049569 Bacteria 729
242 Ga0501036_0070984 3300049572 Bacteria 2945
243 Ga0501036_0102283 3300049572 Bacteria 2424
244 Ga0501036_0262659 3300049572 Bacteria 1446
245 Ga0501038_0343726 3300049574 Bacteria 1163
246 Ga0501039_0136210 3300049575 Bacteria 1928
247 Ga0501039_0288031 3300049575 Bacteria 1291
248 Ga0501040_0086620 3300049576 Bacteria 2175
249 Ga0501041_0040308 3300049577 Bacteria 2835
250 Ga0501041_0047578 3300049577 Bacteria 2611
251 Ga0501041_0086569 3300049577 Bacteria 1933
252 Ga0501041_0785776 3300049577 Bacteria 610
253 Ga0501042_0013461 3300049578 Bacteria 5567
254 Ga0501042_0191191 3300049578 Bacteria 1476
255 Ga0501043_0173304 3300049579 Bacteria 1683
256 Ga0501043_0469752 3300049579 Bacteria 943
257 Ga0501046_0056825 3300049580 Bacteria 3070
258 Ga0501048_0061622 3300049582 Bacteria 2656
259 Ga0501067_0041215 3300049583 Bacteria 2564
260 Ga0501070_0212951 3300049586 Bacteria 1586
261 Ga0501071_0008578 3300049587 Bacteria 6757
262 Ga0501071_0072275 3300049587 Bacteria 2516
263 Ga0501071_0541538 3300049587 Bacteria 894
264 Ga0501071_1016615 3300049587 Bacteria 640
265 Ga0501072_0029538 3300049588 Bacteria 4283
266 Ga0501072_0136903 3300049588 Bacteria 1952
267 Ga0501074_0073355 3300049590 Bacteria 2459
268 Ga0501074_0098694 3300049590 Unclassified 2091
269 Ga0501074_0202371 3300049590 Bacteria 1415
270 Ga0501075_0019047 3300049591 Bacteria 4977
271 Ga0501075_0121596 3300049591 Unclassified 1987
272 Ga0501075_0201737 3300049591 Bacteria 1517
273 Ga0501075_0515061 3300049591 Bacteria 913
274 Ga0501075_0595836 3300049591 Bacteria 843
275 Ga0501076_0095422 3300049592 Bacteria 2395
276 Ga0501076_0100664 3300049592 Bacteria 2328
277 Ga0501076_0658769 3300049592 Bacteria 864
278 Ga0501077_0106893 3300049593 Bacteria 1773
279 Ga0501079_0021886 3300049741 Bacteria 4896
280 Ga0501079_0106838 3300049741 Bacteria 2172
281 Ga0501079_0372035 3300049741 Bacteria 1120
282 Ga0501079_1637953 3300049741 Bacteria 506
283 Ga0501080_0668443 3300049742 Unclassified 918
284 Ga0501081_0386853 3300049743 Bacteria 1034
285 Ga0501083_0344867 3300049744 Unclassified 968
286 Ga0501044_0719810 3300049823 Bacteria 882
287 Ga0501045_0046026 3300049824 Bacteria 3177
288 Ga0501045_0207150 3300049824 Bacteria 1461
289 Ga0501045_0210626 3300049824 Bacteria 1448
290 Ga0501045_1225993 3300049824 Bacteria 547
291 nmdc:mga03n38_243927_c1 3300050490 Bacteria 946
292 nmdc:mga00v17_67859_c1 3300050491 Bacteria 2204
293 nmdc:mga0yw44_371185_c1 3300050492 Bacteria 965
294 nmdc:mga06z11_6571_c1 3300050494 Bacteria 4744
295 nmdc:mga07m45_340556_c1 3300050496 Unclassified 871
296 nmdc:mga05p37_196767_c1 3300050507 Bacteria 2444
297 nmdc:mga05p37_39737_c2 3300050507 Bacteria 3754
298 nmdc:mga05p37_520571_c1 3300050507 Bacteria 1361
299 nmdc:mga09592_15780_c1 3300050508 Bacteria 6171
300 nmdc:mga09592_577114_c1 3300050508 Bacteria 965
301 nmdc:mga06r32_1893079_c1 3300050510 Bacteria 531
302 nmdc:mga06r32_59295_c1 3300050510 Bacteria 3680
303 nmdc:mga06r32_771209_c1 3300050510 Bacteria 924
304 nmdc:mga06r32_96388_c1 3300050510 Bacteria 2897
305 nmdc:mga08y16_125122_c1 3300050511 Bacteria 2674
306 nmdc:mga08y16_1334_c1 3300050511 Bacteria 24594
307 nmdc:mga08y16_19091_c1 3300050511 Bacteria 7223
308 nmdc:mga08y16_2127665_c1 3300050511 Unclassified 508
309 nmdc:mga08y16_40291_c1 3300050511 Bacteria 4897
310 nmdc:mga08y16_446666_c1 3300050511 Bacteria 1319
311 nmdc:mga0n895_1587594_c1 3300050512 Unclassified 619
312 nmdc:mga0n895_168049_c1 3300050512 Unclassified 2225
313 nmdc:mga0n895_1719415_c1 3300050512 Unclassified 589
314 nmdc:mga0rr50_19579_c1 3300050513 Bacteria 4573
315 nmdc:mga0rr50_293476_c1 3300050513 Unclassified 1359
316 nmdc:mga0a205_45187_c1 3300050515 Bacteria 4246
317 Ga0500645_000654 3300053730 Bacteria 21848
318 Ga0501084_0078390 3300054114 Bacteria 2769
319 Ga0501084_0108078 3300054114 Bacteria 2337
320 Ga0501084_0260878 3300054114 Bacteria 1463
321 Ga0501084_0949122 3300054114 Bacteria 723
322 Ga0501082_0159037 3300060353 Bacteria 1963
323 Ga0501082_0220055 3300060353 Bacteria 1652
324 Ga0501082_0850686 3300060353 Bacteria 798
325 Ga0530510_0011624 3300061734 Bacteria 6177
326 Ga0530510_0493274 3300061734 Bacteria 928
327 Ga0530510_0737161 3300061734 Bacteria 751
328 Ga0207645_10480177
329 Ga0065704_10100878
330 Ga0065715_10006396
331 Ga0065715_10007211
332 Ga0065715_10116683
333 Ga0065715_10342979
334 Ga0065715_10389082
335 Ga0065707_10090217
336 Ga0070658_11415086
337 Ga0070683_100005931
338 Ga0070690_100428834
339 Ga0070670_100029679
340 Ga0070670_100427662
341 Ga0070666_10225980
342 Ga0070666_11281933
343 Ga0070680_100167881
344 Ga0070660_100289991
345 Ga0070689_100128815
346 Ga0070689_100512249
347 Ga0070687_100856514
348 Ga0070661_100297885
349 Ga0070661_100472418
350 Ga0070668_100732491
351 Ga0070669_100009340
352 Ga0070675_100057290
353 Ga0070675_100437919
354 Ga0070675_100981661
355 Ga0070671_100653753
356 Ga0070671_102046251
357 Ga0070688_100648936
358 Ga0070659_100488085
359 Ga0070667_100132328
360 Ga0070667_100493192
361 Ga0070667_100961597
362 Ga0070711_100398936
363 Ga0070700_100746468
364 Ga0070694_100579096
365 Ga0070708_100548064
366 Ga0070663_100044271
367 Ga0070678_101010434
368 Ga0070662_100186713
369 Ga0070681_11383541
370 Ga0070706_100772484
371 Ga0070679_100667467
372 Ga0070684_100000624
373 Ga0070672_100014749
374 Ga0070672_100220476
375 Ga0070672_101792423
376 Ga0070686_100495884
377 Ga0070695_100017082
378 Ga0070696_100213193
379 Ga0070693_100094600
380 Ga0070693_101208245
381 Ga0070665_100189975
382 Ga0070665_100598044
383 Ga0070704_100221033
384 Ga0068855_100162110
385 Ga0070664_100004674
386 Ga0070664_100348817
387 Ga0070664_101252216
388 Ga0068857_100787125
389 Ga0070702_100459399
390 Ga0068852_100265729
391 Ga0068864_100084688
392 Ga0068864_100559985
393 Ga0068861_101901718
394 Ga0068870_10620093
395 Ga0068863_101252145
396 Ga0075364_10044223
397 Ga0075367_10014867
398 Ga0075366_10097190
399 Ga0097621_100086667
400 Ga0097621_100383868
401 Ga0075370_10183458
402 Ga0068871_100124648
403 Ga0068871_100369551
404 Ga0068871_100749280
405 Ga0075428_100011582
406 Ga0075428_100315563
407 Ga0075428_100658275
408 Ga0075431_100007187
409 Ga0075431_100308734
410 Ga0075431_101141299
411 Ga0075434_100116811
412 Ga0075434_100172101
413 Ga0075434_100860024
414 Ga0075429_100022337
415 Ga0075435_100138588
416 Ga0075435_101593298
417 Ga0105240_10677591
418 Ga0111539_10000210
419 Ga0111539_10030108
420 Ga0111539_10268907
421 Ga0111539_10269384
422 Ga0111539_10872162
423 Ga0105245_10662719
424 Ga0114129_10049716
425 Ga0114129_10109444
426 Ga0114129_11026239
427 Ga0105242_10822751
428 Ga0105242_11393631
429 Ga0105242_11672438
430 Ga0105248_10017669
431 Ga0105248_10070113
432 Ga0105248_10180319
433 Ga0105248_10424236
434 Ga0105248_11797693
435 Ga0105249_10191180
436 Ga0105249_10422810
437 Ga0105249_12492286
438 Ga0105246_11744158
439 Ga0157370_10042351
440 Ga0157374_10119392
441 Ga0157378_10022752
442 Ga0157378_10152475
443 Ga0157378_11961919
444 Ga0157378_13129139
445 Ga0157375_10178527
446 Ga0163163_10126435
447 Ga0163163_11018996
448 Ga0157380_10620147
449 Ga0157380_11683638
450 Ga0157380_13209477
451 Ga0157377_10069399
452 Ga0157379_10672143
453 Ga0157376_10226140
454 Ga0163161_10771131
455 Ga0207697_10122620
456 Ga0207642_10865458
457 Ga0207688_10090545
458 Ga0207688_10103300
459 Ga0207680_10361614
460 Ga0207645_10238572
461 Ga0207643_10036860
462 Ga0207684_10782890
463 Ga0207663_10247804
464 Ga0207660_10101874
465 Ga0207657_10260330
466 Ga0207649_10021496
467 Ga0207649_10352746
468 Ga0207652_10467827
469 Ga0207681_10184527
470 Ga0207681_10279483
471 Ga0207650_10042419
472 Ga0207650_10051948
473 Ga0207650_11249741
474 Ga0207659_10086348
475 Ga0207659_10312818
476 Ga0207659_10741959
477 Ga0207644_10062512
478 Ga0207644_10572802
479 Ga0207644_11506978
480 Ga0207706_10103846
481 Ga0207670_10833544
482 Ga0207670_11306405
483 Ga0207691_10128207
484 Ga0207691_10502140
485 Ga0207711_10090881
486 Ga0207711_10116637
487 Ga0207711_10282738
488 Ga0207711_10461441
489 Ga0207661_10007184
490 Ga0207679_10004954
491 Ga0207712_10121847
492 Ga0207712_10402557
493 Ga0207658_10853542
494 Ga0207677_10298891
495 Ga0207678_10063550
496 Ga0207708_10467645
497 Ga0207708_11159591
498 Ga0207641_10864118
499 Ga0207641_11209189
500 Ga0207676_10065412
501 Ga0207676_10407539
502 Ga0207675_102137456
503 Ga0207683_10024063
504 Ga0207683_11045636
505 Ga0209971_1012231
506 Ga0207428_10002224
507 Ga0207428_10028345
508 Ga0207428_10964098
509 Ga0207428_11170188
510 Ga0268266_10788225
511 Ga0268265_10004053
512 Ga0307408_100186394
513 Ga0307408_100230445
514 Ga0307408_101641499
515 Ga0307405_10014323
516 Ga0307413_10102081
517 Ga0307410_10042155
518 Ga0307406_10846275
519 Ga0307407_10091975
520 Ga0307412_11246946
521 Ga0307409_100025443
522 Ga0307416_100091954
523 Ga0307416_100104632
524 Ga0307414_10768317
525 Ga0307411_10213275
526 Ga0307415_100125708
527 Ga0373962_0396407
528 Ga0439450_201156
529 Ga0450923_092435
530 Ga0439434_0286301
531 Ga0451576_0064225
532 Ga0495629_0053954
533 Ga0495638_0165101
534 Ga0495651_0660851
535 Ga0495653_0038709
536 Ga0495585_0210163
537 Ga0495628_0912344
538 Ga0495663_0358084
539 Ga0495645_0613170
540 Ga0495656_0236660
541 Ga0495659_0003428
542 Ga0495661_0450212
543 Ga0495588_0126350
544 Ga0495658_0039133
545 Ga0495658_0130020
546 Ga0495600_0579807
547 Ga0495672_0028911
548 Ga0495676_0104553
549 Ga0496101_0927493
550 Ga0496102_0217321
551 Ga0496102_0365920
552 Ga0496102_1319820
553 Ga0496103_0130891
554 Ga0496104_0009782
555 Ga0496104_0798104
556 Ga0496105_0030398
557 Ga0496106_0041839
558 Ga0496107_1208911
559 Ga0496108_0003810
560 Ga0496108_0626726
561 Ga0496110_0002227
562 Ga0496110_0079279
563 Ga0496112_0001195
564 Ga0496112_0157587
565 Ga0496113_0029014
566 Ga0496113_0253115
567 Ga0496114_1601985
568 Ga0501032_0559589
569 Ga0501036_0070984
570 Ga0501036_0102283
571 Ga0501036_0262659
572 Ga0501038_0343726
573 Ga0501039_0136210
574 Ga0501039_0288031
575 Ga0501040_0086620
576 Ga0501041_0040308
577 Ga0501041_0047578
578 Ga0501041_0086569
579 Ga0501041_0785776
580 Ga0501042_0013461
581 Ga0501042_0191191
582 Ga0501043_0173304
583 Ga0501043_0469752
584 Ga0501046_0056825
585 Ga0501048_0061622
586 Ga0501067_0041215
587 Ga0501070_0212951
588 Ga0501071_0008578
589 Ga0501071_0072275
590 Ga0501071_0541538
591 Ga0501071_1016615
592 Ga0501072_0029538
593 Ga0501072_0136903
594 Ga0501074_0073355
595 Ga0501074_0098694
596 Ga0501074_0202371
597 Ga0501075_0019047
598 Ga0501075_0121596
599 Ga0501075_0201737
600 Ga0501075_0515061
601 Ga0501075_0595836
602 Ga0501076_0095422
603 Ga0501076_0100664
604 Ga0501076_0658769
605 Ga0501077_0106893
606 Ga0501079_0021886
607 Ga0501079_0106838
608 Ga0501079_0372035
609 Ga0501079_1637953
610 Ga0501080_0668443
611 Ga0501081_0386853
612 Ga0501083_0344867
613 Ga0501044_0719810
614 Ga0501045_0046026
615 Ga0501045_0207150
616 Ga0501045_0210626
617 Ga0501045_1225993
618 nmdc:mga03n38_243927_c1
619 nmdc:mga00v17_67859_c1
620 nmdc:mga0yw44_371185_c1
621 nmdc:mga06z11_6571_c1
622 nmdc:mga07m45_340556_c1
623 nmdc:mga05p37_196767_c1
624 nmdc:mga05p37_39737_c2
625 nmdc:mga05p37_520571_c1
626 nmdc:mga09592_15780_c1
627 nmdc:mga09592_577114_c1
628 nmdc:mga06r32_1893079_c1
629 nmdc:mga06r32_59295_c1
630 nmdc:mga06r32_771209_c1
631 nmdc:mga06r32_96388_c1
632 nmdc:mga08y16_125122_c1
633 nmdc:mga08y16_1334_c1
634 nmdc:mga08y16_19091_c1
635 nmdc:mga08y16_2127665_c1
636 nmdc:mga08y16_40291_c1
637 nmdc:mga08y16_446666_c1
638 nmdc:mga0n895_1587594_c1
639 nmdc:mga0n895_168049_c1
640 nmdc:mga0n895_1719415_c1
641 nmdc:mga0rr50_19579_c1
642 nmdc:mga0rr50_293476_c1
643 nmdc:mga0a205_45187_c1
644 Ga0500645_000654
645 Ga0501084_0078390
646 Ga0501084_0108078
647 Ga0501084_0260878
648 Ga0501084_0949122
649 Ga0501082_0159037
650 Ga0501082_0220055
651 Ga0501082_0850686
652 Ga0530510_0011624
653 Ga0530510_0493274
654 Ga0530510_0737161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

29

100

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a1x-assembly1.cif.gz_F sodium pumping nadh-quinone oxidoreductase with inhibitor dqa 0.773 2 95
3zyy-assembly1.cif.gz_X reductive activator for corrinoid,iron-sulfur protein 0.772 1 93
1l5p-assembly3.cif.gz_C crystal structure of trichomonas vaginalis ferredoxin 0.764 3 88
6yj4-assembly1.cif.gz_G structure of yarrowia lipolytica complex i at 2.7 a 0.7389 2 88
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.7295 3 92
ID Description Score Start End Superfamily
3zyyX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.772 1 93 3.10.20.30
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7697 2 91 3.10.20.30
3zyyX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7649 1 93 3.10.20.30
1l5pC00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.764 3 88 3.10.20.30
af_A0A0R0GLS0_46_147_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7527 4 90 3.10.20.30
ID Description Score Start End GO Terms
AF-I0I186-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9632 1 114 GO:0051536
AF-A0A7Y3K740-F1-model_v4 (2Fe-2S)-binding protein 0.9539 1 97 GO:0009055
GO:0051537
GO:0140647
AF-A0A2E5K6L8-F1-model_v4 deleted 0.9398 1 114
AF-A0A3M1G828-F1-model_v4 (2Fe-2S)-binding protein 0.9387 17 116 GO:0051536
AF-A0A0P9CK91-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9344 1 115 GO:0051536

Map