F408680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 167 | 654 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100066382|Ga0070679_1000663823 |
| Length | 367 |
| Sequence | VAGVEVRTLTDGGQPAEETAHALADFFAAAKQTLEIAVYDYRLPPELDETVRGALVDAQKRGVAIRLAYNLDHAKEVPVPPPPSTNPDAIEADPFPTAAIPGVPDLMHHKYVVRDSASVWTGSLNWTADSWTREENVVITVDSPAVAARYLGDFEQLWTTRDVARTGKVDTAPVDGMRAWFCPGRGEKLAHRIAKAIGAAQHRIRIASPVISSAPILATLAQVACDGKVDLAGVVDATQVAEVFEQWRENGNVEWKSPLLRTTLTRAQFSGKQSTPYTPDSVHDYMHAKVTVADDTVFVGSFNLSHSGEMNAENVLELRDPQIAEQCAAFIDQIRARYPAVHVDPQPSPVRGIPADTKHIPPSHPDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 36 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 60 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 61 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 62 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 63 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 64 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 68 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 69 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 70 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 71 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 72 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 73 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 74 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 75 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 76 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 77 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 79 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 84 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 85 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 86 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 87 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 88 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 89 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 90 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 91 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 92 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 93 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.23 |
| Rhizosphere | 87.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100066382 | 3300005530 | Bacteria | 3596 |
| 2 | Ga0070658_10009724 | 3300005327 | Bacteria | 7722 |
| 3 | Ga0070658_10028957 | 3300005327 | Bacteria | 4447 |
| 4 | Ga0070683_100003709 | 3300005329 | Bacteria | 12455 |
| 5 | Ga0070683_100036304 | 3300005329 | Bacteria | 4509 |
| 6 | Ga0070680_100023199 | 3300005336 | Bacteria | 4947 |
| 7 | Ga0070682_100087590 | 3300005337 | Bacteria | 2030 |
| 8 | Ga0070660_100004514 | 3300005339 | Bacteria | 9621 |
| 9 | Ga0070660_100006012 | 3300005339 | Bacteria | 8392 |
| 10 | Ga0070660_100239403 | 3300005339 | Bacteria | 1478 |
| 11 | Ga0070661_100009316 | 3300005344 | Bacteria | 6792 |
| 12 | Ga0070661_100032396 | 3300005344 | Bacteria | 3784 |
| 13 | Ga0070659_100041343 | 3300005366 | Bacteria | 3603 |
| 14 | Ga0070709_10071835 | 3300005434 | Bacteria | 2235 |
| 15 | Ga0070714_100008742 | 3300005435 | Bacteria | 7916 |
| 16 | Ga0070714_100008924 | 3300005435 | Bacteria | 7844 |
| 17 | Ga0070714_100009242 | 3300005435 | Bacteria | 7744 |
| 18 | Ga0070714_100011979 | 3300005435 | Bacteria | 6899 |
| 19 | Ga0070714_100015766 | 3300005435 | Bacteria | 6088 |
| 20 | Ga0070714_100231458 | 3300005435 | Unclassified | 1702 |
| 21 | Ga0070713_100009866 | 3300005436 | Bacteria | 6868 |
| 22 | Ga0070713_100305146 | 3300005436 | Unclassified | 1466 |
| 23 | Ga0070710_10002442 | 3300005437 | Bacteria | 8801 |
| 24 | Ga0070710_10051274 | 3300005437 | Bacteria | 2316 |
| 25 | Ga0070711_100017456 | 3300005439 | Bacteria | 4570 |
| 26 | Ga0070711_100038457 | 3300005439 | Bacteria | 3218 |
| 27 | Ga0070681_10018803 | 3300005458 | Bacteria | 6914 |
| 28 | Ga0070681_10216385 | 3300005458 | Bacteria | 1831 |
| 29 | Ga0070707_100000126 | 3300005468 | Bacteria | 71727 |
| 30 | Ga0070679_100051507 | 3300005530 | Bacteria | 4101 |
| 31 | Ga0070695_100000007 | 3300005545 | Bacteria | 89343 |
| 32 | Ga0070693_100171859 | 3300005547 | Bacteria | 1389 |
| 33 | Ga0068855_100195575 | 3300005563 | Bacteria | 2278 |
| 34 | Ga0068855_100285493 | 3300005563 | Bacteria | 1831 |
| 35 | Ga0068856_100123521 | 3300005614 | Bacteria | 2591 |
| 36 | Ga0070702_100019005 | 3300005615 | Bacteria | 3574 |
| 37 | Ga0070717_10002719 | 3300006028 | Bacteria | 12482 |
| 38 | Ga0070717_10011145 | 3300006028 | Bacteria | 6814 |
| 39 | Ga0070717_10012491 | 3300006028 | Bacteria | 6478 |
| 40 | Ga0070717_10042555 | 3300006028 | Bacteria | 3704 |
| 41 | Ga0070717_10081937 | 3300006028 | Bacteria | 2710 |
| 42 | Ga0070715_10000373 | 3300006163 | Bacteria | 11247 |
| 43 | Ga0070716_100016167 | 3300006173 | Bacteria | 3846 |
| 44 | Ga0070712_100033469 | 3300006175 | Bacteria | 3478 |
| 45 | Ga0070712_100138936 | 3300006175 | Unclassified | 1851 |
| 46 | Ga0070712_100194358 | 3300006175 | Unclassified | 1590 |
| 47 | Ga0105240_10012976 | 3300009093 | Bacteria | 11477 |
| 48 | Ga0105240_10052457 | 3300009093 | Bacteria | 5126 |
| 49 | Ga0105245_10017615 | 3300009098 | Bacteria | 6236 |
| 50 | Ga0105241_10103161 | 3300009174 | Bacteria | 2271 |
| 51 | Ga0105242_10041083 | 3300009176 | Bacteria | 3728 |
| 52 | Ga0105237_10230430 | 3300009545 | Bacteria | 1853 |
| 53 | Ga0157373_10024932 | 3300013100 | Bacteria | 4330 |
| 54 | Ga0157370_10185825 | 3300013104 | Bacteria | 1929 |
| 55 | Ga0157369_10006113 | 3300013105 | Bacteria | 13972 |
| 56 | Ga0157369_10016236 | 3300013105 | Bacteria | 8379 |
| 57 | Ga0157369_10076645 | 3300013105 | Bacteria | 3584 |
| 58 | Ga0157369_10361443 | 3300013105 | Bacteria | 1507 |
| 59 | Ga0157374_10004392 | 3300013296 | Bacteria | 11864 |
| 60 | Ga0157374_10469090 | 3300013296 | Bacteria | 1261 |
| 61 | Ga0157372_10007031 | 3300013307 | Bacteria | 11985 |
| 62 | Ga0182008_10007920 | 3300014497 | Bacteria | 5830 |
| 63 | Ga0182007_10012677 | 3300015262 | Bacteria | 3236 |
| 64 | Ga0206354_10721576 | 3300020081 | Bacteria | 1990 |
| 65 | Ga0207692_10115898 | 3300025898 | Unclassified | 1493 |
| 66 | Ga0207685_10009048 | 3300025905 | Bacteria | 2874 |
| 67 | Ga0207699_10004512 | 3300025906 | Bacteria | 6650 |
| 68 | Ga0207705_10044476 | 3300025909 | Bacteria | 3191 |
| 69 | Ga0207705_10080504 | 3300025909 | Bacteria | 2373 |
| 70 | Ga0207707_10013381 | 3300025912 | Bacteria | 7153 |
| 71 | Ga0207707_10047404 | 3300025912 | Bacteria | 3742 |
| 72 | Ga0207707_10170678 | 3300025912 | Bacteria | 1901 |
| 73 | Ga0207695_10152773 | 3300025913 | Bacteria | 2246 |
| 74 | Ga0207693_10012083 | 3300025915 | Bacteria | 6980 |
| 75 | Ga0207693_10029889 | 3300025915 | Bacteria | 4300 |
| 76 | Ga0207693_10200111 | 3300025915 | Bacteria | 1571 |
| 77 | Ga0207663_10001261 | 3300025916 | Bacteria | 11736 |
| 78 | Ga0207663_10117919 | 3300025916 | Bacteria | 1812 |
| 79 | Ga0207660_10110081 | 3300025917 | Bacteria | 2071 |
| 80 | Ga0207657_10001428 | 3300025919 | Bacteria | 25498 |
| 81 | Ga0207657_10010121 | 3300025919 | Bacteria | 9425 |
| 82 | Ga0207649_10124768 | 3300025920 | Bacteria | 1741 |
| 83 | Ga0207652_10136023 | 3300025921 | Unclassified | 2194 |
| 84 | Ga0207652_10171242 | 3300025921 | Bacteria | 1948 |
| 85 | Ga0207646_10000967 | 3300025922 | Bacteria | 37060 |
| 86 | Ga0207694_10252010 | 3300025924 | Bacteria | 1445 |
| 87 | Ga0207687_10002235 | 3300025927 | Bacteria | 13185 |
| 88 | Ga0207700_10007340 | 3300025928 | Bacteria | 6730 |
| 89 | Ga0207664_10008909 | 3300025929 | Bacteria | 7026 |
| 90 | Ga0207664_10015367 | 3300025929 | Bacteria | 5553 |
| 91 | Ga0207690_10024175 | 3300025932 | Bacteria | 3802 |
| 92 | Ga0207665_10000096 | 3300025939 | Bacteria | 57067 |
| 93 | Ga0207661_10001989 | 3300025944 | Bacteria | 14064 |
| 94 | Ga0207667_10032348 | 3300025949 | Bacteria | 5638 |
| 95 | Ga0265318_10074825 | 3300028577 | Bacteria | 1253 |
| 96 | Ga0265336_10003377 | 3300028666 | Bacteria | 6273 |
| 97 | Ga0265336_10048990 | 3300028666 | Bacteria | 1280 |
| 98 | Ga0265338_10001704 | 3300028800 | Bacteria | 34899 |
| 99 | Ga0265338_10005197 | 3300028800 | Bacteria | 17092 |
| 100 | Ga0265338_10019197 | 3300028800 | Bacteria | 7273 |
| 101 | Ga0265320_10042773 | 3300031240 | Unclassified | 2245 |
| 102 | Ga0265329_10023081 | 3300031242 | Unclassified | 2075 |
| 103 | Ga0265331_10107902 | 3300031250 | Bacteria | 1278 |
| 104 | Ga0265316_10024865 | 3300031344 | Bacteria | 5005 |
| 105 | Ga0265316_10124362 | 3300031344 | Bacteria | 1946 |
| 106 | Ga0265314_10017024 | 3300031711 | Bacteria | 5717 |
| 107 | Ga0265314_10046088 | 3300031711 | Bacteria | 3078 |
| 108 | Ga0265342_10137548 | 3300031712 | Bacteria | 1365 |
| 109 | Ga0307416_100215555 | 3300032002 | Bacteria | 1836 |
| 110 | Ga0373936_0039945 | 3300035113 | Bacteria | 1879 |
| 111 | Ga0373956_0082574 | 3300035119 | Unclassified | 1476 |
| 112 | Ga0373943_0000547 | 3300035170 | Bacteria | 16253 |
| 113 | Ga0373931_0028154 | 3300035691 | Bacteria | 2874 |
| 114 | Ga0373927_0024581 | 3300035695 | Bacteria | 3939 |
| 115 | Ga0373933_0063354 | 3300035724 | Bacteria | 2235 |
| 116 | Ga0373947_0005246 | 3300035725 | Bacteria | 7573 |
| 117 | Ga0373937_0001741 | 3300036401 | Bacteria | 18316 |
| 118 | Ga0373925_0009055 | 3300037068 | Bacteria | 7245 |
| 119 | Ga0395899_0065513 | 3300037312 | Bacteria | 2670 |
| 120 | Ga0395900_0034689 | 3300037418 | Bacteria | 5197 |
| 121 | Ga0395900_0071526 | 3300037418 | Bacteria | 3566 |
| 122 | Ga0395898_0024640 | 3300037466 | Bacteria | 6069 |
| 123 | Ga0395905_0126964 | 3300037471 | Bacteria | 2398 |
| 124 | Ga0395905_0180989 | 3300037471 | Unclassified | 1979 |
| 125 | Ga0395901_0309216 | 3300038443 | Bacteria | 1637 |
| 126 | Ga0466969_0002096 | 3300044656 | Bacteria | 10636 |
| 127 | Ga0466966_0170494 | 3300044684 | Bacteria | 1323 |
| 128 | Ga0466961_0014219 | 3300044693 | Bacteria | 5109 |
| 129 | Ga0466963_0002075 | 3300044694 | Bacteria | 11063 |
| 130 | Ga0466963_0002166 | 3300044694 | Bacteria | 10850 |
| 131 | Ga0466963_0005735 | 3300044694 | Bacteria | 7303 |
| 132 | Ga0466963_0006336 | 3300044694 | Bacteria | 6996 |
| 133 | Ga0466963_0011652 | 3300044694 | Bacteria | 5356 |
| 134 | Ga0466963_0012421 | 3300044694 | Bacteria | 5213 |
| 135 | Ga0466963_0018693 | 3300044694 | Bacteria | 4337 |
| 136 | Ga0466963_0022230 | 3300044694 | Bacteria | 4014 |
| 137 | Ga0466963_0035890 | 3300044694 | Bacteria | 3230 |
| 138 | Ga0466963_0106506 | 3300044694 | Unclassified | 1922 |
| 139 | Ga0466964_0000945 | 3300044706 | Bacteria | 9605 |
| 140 | Ga0466964_0001659 | 3300044706 | Bacteria | 7692 |
| 141 | Ga0466964_0009010 | 3300044706 | Bacteria | 3756 |
| 142 | Ga0466964_0016898 | 3300044706 | Bacteria | 2790 |
| 143 | Ga0466964_0064309 | 3300044706 | Bacteria | 1534 |
| 144 | Ga0466971_0003205 | 3300044719 | Bacteria | 6977 |
| 145 | Ga0466971_0014505 | 3300044719 | Bacteria | 3468 |
| 146 | Ga0466971_0024407 | 3300044719 | Bacteria | 2698 |
| 147 | Ga0466971_0041342 | 3300044719 | Bacteria | 2070 |
| 148 | Ga0466968_0001888 | 3300044735 | Bacteria | 7574 |
| 149 | Ga0466968_0011633 | 3300044735 | Bacteria | 3432 |
| 150 | Ga0466968_0017232 | 3300044735 | Bacteria | 2885 |
| 151 | Ga0466968_0030057 | 3300044735 | Bacteria | 2249 |
| 152 | Ga0466957_0001738 | 3300044842 | Bacteria | 11469 |
| 153 | Ga0466957_0030237 | 3300044842 | Bacteria | 3233 |
| 154 | Ga0466957_0033586 | 3300044842 | Bacteria | 3078 |
| 155 | Ga0466957_0053496 | 3300044842 | Bacteria | 2461 |
| 156 | Ga0466957_0066115 | 3300044842 | Bacteria | 2228 |
| 157 | Ga0466957_0071751 | 3300044842 | Unclassified | 2142 |
| 158 | Ga0466957_0094165 | 3300044842 | Unclassified | 1880 |
| 159 | Ga0466957_0144958 | 3300044842 | Bacteria | 1532 |
| 160 | Ga0466960_0051691 | 3300044901 | Bacteria | 1986 |
| 161 | Ga0466959_0155880 | 3300045049 | Bacteria | 1607 |
| 162 | Ga0466959_0166446 | 3300045049 | Bacteria | 1548 |
| 163 | Ga0466958_0001472 | 3300045836 | Bacteria | 11216 |
| 164 | Ga0466958_0004536 | 3300045836 | Bacteria | 7343 |
| 165 | Ga0466958_0013544 | 3300045836 | Bacteria | 4645 |
| 166 | Ga0466958_0026319 | 3300045836 | Bacteria | 3437 |
| 167 | Ga0466958_0037176 | 3300045836 | Bacteria | 2916 |
| 168 | Ga0466967_0001581 | 3300045976 | Bacteria | 13379 |
| 169 | Ga0466967_0005799 | 3300045976 | Bacteria | 8638 |
| 170 | Ga0466967_0005936 | 3300045976 | Bacteria | 8567 |
| 171 | Ga0466967_0006315 | 3300045976 | Bacteria | 8367 |
| 172 | Ga0466967_0010155 | 3300045976 | Bacteria | 7040 |
| 173 | Ga0466967_0010768 | 3300045976 | Bacteria | 6877 |
| 174 | Ga0466967_0012296 | 3300045976 | Bacteria | 6539 |
| 175 | Ga0466967_0015883 | 3300045976 | Bacteria | 5917 |
| 176 | Ga0466967_0020070 | 3300045976 | Bacteria | 5390 |
| 177 | Ga0466967_0042627 | 3300045976 | Bacteria | 3923 |
| 178 | Ga0466967_0054937 | 3300045976 | Bacteria | 3507 |
| 179 | Ga0466967_0056725 | 3300045976 | Bacteria | 3455 |
| 180 | Ga0466967_0096691 | 3300045976 | Bacteria | 2694 |
| 181 | Ga0466967_0098176 | 3300045976 | Bacteria | 2674 |
| 182 | Ga0466967_0202672 | 3300045976 | Bacteria | 1879 |
| 183 | Ga0466967_0314051 | 3300045976 | Bacteria | 1510 |
| 184 | Ga0495592_0000168 | 3300046454 | Bacteria | 58320 |
| 185 | Ga0495592_0003762 | 3300046454 | Bacteria | 10953 |
| 186 | Ga0495592_0075183 | 3300046454 | Bacteria | 2453 |
| 187 | Ga0495603_0015242 | 3300046455 | Bacteria | 4651 |
| 188 | Ga0495629_0006592 | 3300046459 | Bacteria | 8598 |
| 189 | Ga0495641_0009209 | 3300046461 | Bacteria | 5897 |
| 190 | Ga0495641_0036112 | 3300046461 | Bacteria | 2325 |
| 191 | Ga0495651_0000011 | 3300046462 | Bacteria | 147193 |
| 192 | Ga0495653_0002290 | 3300046463 | Bacteria | 15175 |
| 193 | Ga0495653_0010788 | 3300046463 | Bacteria | 7481 |
| 194 | Ga0495653_0016818 | 3300046463 | Bacteria | 5951 |
| 195 | Ga0495653_0033341 | 3300046463 | Bacteria | 4081 |
| 196 | Ga0495580_0010576 | 3300046472 | Bacteria | 7181 |
| 197 | Ga0495582_0003690 | 3300046473 | Bacteria | 8624 |
| 198 | Ga0495582_0044982 | 3300046473 | Bacteria | 2431 |
| 199 | Ga0495582_0054587 | 3300046473 | Bacteria | 2203 |
| 200 | Ga0495582_0123597 | 3300046473 | Unclassified | 1459 |
| 201 | Ga0495639_0002070 | 3300046475 | Bacteria | 8883 |
| 202 | Ga0495662_0001057 | 3300046476 | Bacteria | 13514 |
| 203 | Ga0495664_0007091 | 3300046477 | Bacteria | 6209 |
| 204 | Ga0495664_0022213 | 3300046477 | Bacteria | 3675 |
| 205 | Ga0495664_0039936 | 3300046477 | Bacteria | 2773 |
| 206 | Ga0495664_0148748 | 3300046477 | Bacteria | 1420 |
| 207 | Ga0495607_0039084 | 3300046501 | Bacteria | 2836 |
| 208 | Ga0495608_0002777 | 3300046511 | Bacteria | 12561 |
| 209 | Ga0495608_0026569 | 3300046511 | Bacteria | 3944 |
| 210 | Ga0495618_0003147 | 3300046514 | Bacteria | 10371 |
| 211 | Ga0495618_0010250 | 3300046514 | Bacteria | 5669 |
| 212 | Ga0495618_0016666 | 3300046514 | Bacteria | 4500 |
| 213 | Ga0495618_0173147 | 3300046514 | Bacteria | 1373 |
| 214 | Ga0495628_0000024 | 3300046516 | Bacteria | 130196 |
| 215 | Ga0495628_0046536 | 3300046516 | Bacteria | 3445 |
| 216 | Ga0495630_0078360 | 3300046517 | Bacteria | 2491 |
| 217 | Ga0495666_0000373 | 3300046526 | Bacteria | 19679 |
| 218 | Ga0495652_0000050 | 3300046529 | Bacteria | 120480 |
| 219 | Ga0495652_0010725 | 3300046529 | Bacteria | 8304 |
| 220 | Ga0495652_0018312 | 3300046529 | Bacteria | 6246 |
| 221 | Ga0495652_0049286 | 3300046529 | Bacteria | 3606 |
| 222 | Ga0495665_0000715 | 3300046531 | Bacteria | 17128 |
| 223 | Ga0495640_0011393 | 3300046533 | Bacteria | 6842 |
| 224 | Ga0495640_0190189 | 3300046533 | Bacteria | 1305 |
| 225 | Ga0495587_0000353 | 3300046536 | Bacteria | 32872 |
| 226 | Ga0495587_0128720 | 3300046536 | Unclassified | 1448 |
| 227 | Ga0495645_0000376 | 3300046543 | Bacteria | 31025 |
| 228 | Ga0495645_0016026 | 3300046543 | Bacteria | 5342 |
| 229 | Ga0495645_0023761 | 3300046543 | Bacteria | 4442 |
| 230 | Ga0495667_0008996 | 3300046559 | Bacteria | 6786 |
| 231 | Ga0495667_0018815 | 3300046559 | Bacteria | 4664 |
| 232 | Ga0495656_0034578 | 3300046615 | Bacteria | 2070 |
| 233 | Ga0495634_0012647 | 3300046642 | Bacteria | 6109 |
| 234 | Ga0495634_0115816 | 3300046642 | Unclassified | 1720 |
| 235 | Ga0495635_0005318 | 3300046663 | Bacteria | 8961 |
| 236 | Ga0495657_0016058 | 3300046675 | Bacteria | 5461 |
| 237 | Ga0495657_0047942 | 3300046675 | Bacteria | 2885 |
| 238 | Ga0495657_0103093 | 3300046675 | Unclassified | 1815 |
| 239 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 240 | Ga0495599_0004409 | 3300046678 | Bacteria | 8325 |
| 241 | Ga0495599_0132391 | 3300046678 | Bacteria | 1548 |
| 242 | Ga0495623_0000039 | 3300046679 | Bacteria | 80360 |
| 243 | Ga0495623_0108051 | 3300046679 | Bacteria | 1689 |
| 244 | Ga0495646_0011647 | 3300046680 | Bacteria | 5588 |
| 245 | Ga0495647_0000440 | 3300046681 | Bacteria | 11924 |
| 246 | Ga0495647_0119216 | 3300046681 | Unclassified | 1108 |
| 247 | Ga0495658_0001069 | 3300046683 | Bacteria | 14452 |
| 248 | Ga0495613_0004122 | 3300046689 | Bacteria | 10872 |
| 249 | Ga0495613_0019982 | 3300046689 | Bacteria | 4991 |
| 250 | Ga0495624_0005741 | 3300046690 | Bacteria | 8899 |
| 251 | Ga0495600_0040669 | 3300046809 | Bacteria | 3029 |
| 252 | Ga0495581_0007153 | 3300047315 | Bacteria | 6462 |
| 253 | Ga0495604_0000183 | 3300047317 | Bacteria | 55826 |
| 254 | Ga0495604_0072046 | 3300047317 | Unclassified | 2612 |
| 255 | Ga0495674_0102678 | 3300047319 | Bacteria | 2431 |
| 256 | Ga0495676_0108266 | 3300047321 | Bacteria | 2044 |
| 257 | Ga0495676_0159322 | 3300047321 | Bacteria | 1598 |
| 258 | Ga0495680_0031803 | 3300047322 | Bacteria | 4290 |
| 259 | Ga0495680_0055362 | 3300047322 | Bacteria | 3077 |
| 260 | Ga0495675_0000167 | 3300047444 | Bacteria | 47216 |
| 261 | Ga0495684_0021934 | 3300047471 | Bacteria | 4916 |
| 262 | Ga0495602_0000477 | 3300048088 | Bacteria | 37020 |
| 263 | Ga0495614_0004754 | 3300048089 | Bacteria | 6127 |
| 264 | Ga0496100_0093661 | 3300048903 | Unclassified | 2056 |
| 265 | Ga0496100_0119244 | 3300048903 | Unclassified | 1843 |
| 266 | Ga0496101_0021315 | 3300048904 | Bacteria | 4452 |
| 267 | Ga0496101_0050214 | 3300048904 | Unclassified | 3001 |
| 268 | Ga0496102_0045980 | 3300048905 | Bacteria | 3964 |
| 269 | Ga0496102_0052515 | 3300048905 | Bacteria | 3714 |
| 270 | Ga0496102_0133637 | 3300048905 | Bacteria | 2324 |
| 271 | Ga0496102_0276516 | 3300048905 | Bacteria | 1583 |
| 272 | Ga0496104_0034790 | 3300048907 | Bacteria | 4699 |
| 273 | Ga0496104_0066886 | 3300048907 | Bacteria | 3412 |
| 274 | Ga0496104_0105931 | 3300048907 | Bacteria | 2694 |
| 275 | Ga0496104_0311243 | 3300048907 | Unclassified | 1488 |
| 276 | Ga0496105_0013488 | 3300048908 | Bacteria | 6488 |
| 277 | Ga0496105_0066059 | 3300048908 | Bacteria | 2985 |
| 278 | Ga0496105_0084887 | 3300048908 | Bacteria | 2616 |
| 279 | Ga0496105_0099333 | 3300048908 | Bacteria | 2403 |
| 280 | Ga0496106_0044161 | 3300048909 | Bacteria | 3345 |
| 281 | Ga0496107_0012340 | 3300048910 | Bacteria | 5966 |
| 282 | Ga0496107_0020524 | 3300048910 | Bacteria | 4667 |
| 283 | Ga0496108_0003729 | 3300048911 | Bacteria | 12215 |
| 284 | Ga0496108_0014840 | 3300048911 | Bacteria | 6356 |
| 285 | Ga0496108_0050870 | 3300048911 | Bacteria | 3470 |
| 286 | Ga0496108_0098076 | 3300048911 | Bacteria | 2497 |
| 287 | Ga0496109_0032817 | 3300048912 | Bacteria | 4669 |
| 288 | Ga0496109_0133944 | 3300048912 | Unclassified | 2314 |
| 289 | Ga0496110_0321226 | 3300048913 | Unclassified | 1410 |
| 290 | Ga0496111_0049566 | 3300048914 | Unclassified | 3028 |
| 291 | Ga0496111_0235986 | 3300048914 | Bacteria | 1358 |
| 292 | Ga0496112_0075359 | 3300048915 | Bacteria | 3336 |
| 293 | Ga0496112_0101867 | 3300048915 | Bacteria | 2841 |
| 294 | Ga0496112_0139783 | 3300048915 | Bacteria | 2391 |
| 295 | Ga0496112_0153901 | 3300048915 | Bacteria | 2267 |
| 296 | Ga0496113_0054057 | 3300048916 | Bacteria | 3004 |
| 297 | Ga0496113_0097216 | 3300048916 | Unclassified | 2278 |
| 298 | Ga0496113_0365594 | 3300048916 | Bacteria | 1158 |
| 299 | Ga0496114_0005231 | 3300048917 | Bacteria | 10139 |
| 300 | Ga0496114_0069271 | 3300048917 | Unclassified | 2962 |
| 301 | Ga0496114_0070642 | 3300048917 | Bacteria | 2933 |
| 302 | Ga0496115_0011169 | 3300048918 | Bacteria | 6727 |
| 303 | Ga0496115_0014777 | 3300048918 | Bacteria | 5919 |
| 304 | Ga0501034_0032876 | 3300049571 | Bacteria | 5267 |
| 305 | Ga0501067_0028546 | 3300049583 | Bacteria | 3092 |
| 306 | Ga0501067_0032444 | 3300049583 | Bacteria | 2899 |
| 307 | Ga0501070_0005687 | 3300049586 | Bacteria | 10629 |
| 308 | Ga0501070_0013065 | 3300049586 | Bacteria | 6999 |
| 309 | Ga0501072_0048775 | 3300049588 | Bacteria | 3333 |
| 310 | Ga0501073_0024814 | 3300049589 | Bacteria | 4303 |
| 311 | Ga0501073_0071785 | 3300049589 | Bacteria | 2411 |
| 312 | Ga0501074_0007988 | 3300049590 | Bacteria | 7661 |
| 313 | Ga0501074_0086027 | 3300049590 | Bacteria | 2252 |
| 314 | Ga0501079_0046440 | 3300049741 | Bacteria | 3351 |
| 315 | Ga0501080_0039084 | 3300049742 | Bacteria | 4428 |
| 316 | Ga0501080_0113189 | 3300049742 | Bacteria | 2515 |
| 317 | Ga0501083_0001008 | 3300049744 | Bacteria | 18770 |
| 318 | Ga0495601_0000094 | 3300053077 | Bacteria | 48572 |
| 319 | Ga0495601_0022922 | 3300053077 | Bacteria | 3836 |
| 320 | Ga0495612_0002293 | 3300053078 | Bacteria | 7882 |
| 321 | Ga0495612_0015596 | 3300053078 | Bacteria | 3046 |
| 322 | Ga0495619_0048790 | 3300053085 | Unclassified | 2790 |
| 323 | Ga0495619_0155505 | 3300053085 | Bacteria | 1578 |
| 324 | Ga0501082_0309704 | 3300060353 | Bacteria | 1375 |
| 325 | Ga0466962_0003164 | 3300061719 | Bacteria | 7822 |
| 326 | Ga0466962_0005023 | 3300061719 | Bacteria | 6363 |
| 327 | Ga0466962_0006458 | 3300061719 | Bacteria | 5628 |
| 328 | Ga0070679_100066382 | |||
| 329 | Ga0070658_10009724 | |||
| 330 | Ga0070658_10028957 | |||
| 331 | Ga0070683_100003709 | |||
| 332 | Ga0070683_100036304 | |||
| 333 | Ga0070680_100023199 | |||
| 334 | Ga0070682_100087590 | |||
| 335 | Ga0070660_100004514 | |||
| 336 | Ga0070660_100006012 | |||
| 337 | Ga0070660_100239403 | |||
| 338 | Ga0070661_100009316 | |||
| 339 | Ga0070661_100032396 | |||
| 340 | Ga0070659_100041343 | |||
| 341 | Ga0070709_10071835 | |||
| 342 | Ga0070714_100008742 | |||
| 343 | Ga0070714_100008924 | |||
| 344 | Ga0070714_100009242 | |||
| 345 | Ga0070714_100011979 | |||
| 346 | Ga0070714_100015766 | |||
| 347 | Ga0070714_100231458 | |||
| 348 | Ga0070713_100009866 | |||
| 349 | Ga0070713_100305146 | |||
| 350 | Ga0070710_10002442 | |||
| 351 | Ga0070710_10051274 | |||
| 352 | Ga0070711_100017456 | |||
| 353 | Ga0070711_100038457 | |||
| 354 | Ga0070681_10018803 | |||
| 355 | Ga0070681_10216385 | |||
| 356 | Ga0070707_100000126 | |||
| 357 | Ga0070679_100051507 | |||
| 358 | Ga0070695_100000007 | |||
| 359 | Ga0070693_100171859 | |||
| 360 | Ga0068855_100195575 | |||
| 361 | Ga0068855_100285493 | |||
| 362 | Ga0068856_100123521 | |||
| 363 | Ga0070702_100019005 | |||
| 364 | Ga0070717_10002719 | |||
| 365 | Ga0070717_10011145 | |||
| 366 | Ga0070717_10012491 | |||
| 367 | Ga0070717_10042555 | |||
| 368 | Ga0070717_10081937 | |||
| 369 | Ga0070715_10000373 | |||
| 370 | Ga0070716_100016167 | |||
| 371 | Ga0070712_100033469 | |||
| 372 | Ga0070712_100138936 | |||
| 373 | Ga0070712_100194358 | |||
| 374 | Ga0105240_10012976 | |||
| 375 | Ga0105240_10052457 | |||
| 376 | Ga0105245_10017615 | |||
| 377 | Ga0105241_10103161 | |||
| 378 | Ga0105242_10041083 | |||
| 379 | Ga0105237_10230430 | |||
| 380 | Ga0157373_10024932 | |||
| 381 | Ga0157370_10185825 | |||
| 382 | Ga0157369_10006113 | |||
| 383 | Ga0157369_10016236 | |||
| 384 | Ga0157369_10076645 | |||
| 385 | Ga0157369_10361443 | |||
| 386 | Ga0157374_10004392 | |||
| 387 | Ga0157374_10469090 | |||
| 388 | Ga0157372_10007031 | |||
| 389 | Ga0182008_10007920 | |||
| 390 | Ga0182007_10012677 | |||
| 391 | Ga0206354_10721576 | |||
| 392 | Ga0207692_10115898 | |||
| 393 | Ga0207685_10009048 | |||
| 394 | Ga0207699_10004512 | |||
| 395 | Ga0207705_10044476 | |||
| 396 | Ga0207705_10080504 | |||
| 397 | Ga0207707_10013381 | |||
| 398 | Ga0207707_10047404 | |||
| 399 | Ga0207707_10170678 | |||
| 400 | Ga0207695_10152773 | |||
| 401 | Ga0207693_10012083 | |||
| 402 | Ga0207693_10029889 | |||
| 403 | Ga0207693_10200111 | |||
| 404 | Ga0207663_10001261 | |||
| 405 | Ga0207663_10117919 | |||
| 406 | Ga0207660_10110081 | |||
| 407 | Ga0207657_10001428 | |||
| 408 | Ga0207657_10010121 | |||
| 409 | Ga0207649_10124768 | |||
| 410 | Ga0207652_10136023 | |||
| 411 | Ga0207652_10171242 | |||
| 412 | Ga0207646_10000967 | |||
| 413 | Ga0207694_10252010 | |||
| 414 | Ga0207687_10002235 | |||
| 415 | Ga0207700_10007340 | |||
| 416 | Ga0207664_10008909 | |||
| 417 | Ga0207664_10015367 | |||
| 418 | Ga0207690_10024175 | |||
| 419 | Ga0207665_10000096 | |||
| 420 | Ga0207661_10001989 | |||
| 421 | Ga0207667_10032348 | |||
| 422 | Ga0265318_10074825 | |||
| 423 | Ga0265336_10003377 | |||
| 424 | Ga0265336_10048990 | |||
| 425 | Ga0265338_10001704 | |||
| 426 | Ga0265338_10005197 | |||
| 427 | Ga0265338_10019197 | |||
| 428 | Ga0265320_10042773 | |||
| 429 | Ga0265329_10023081 | |||
| 430 | Ga0265331_10107902 | |||
| 431 | Ga0265316_10024865 | |||
| 432 | Ga0265316_10124362 | |||
| 433 | Ga0265314_10017024 | |||
| 434 | Ga0265314_10046088 | |||
| 435 | Ga0265342_10137548 | |||
| 436 | Ga0307416_100215555 | |||
| 437 | Ga0373936_0039945 | |||
| 438 | Ga0373956_0082574 | |||
| 439 | Ga0373943_0000547 | |||
| 440 | Ga0373931_0028154 | |||
| 441 | Ga0373927_0024581 | |||
| 442 | Ga0373933_0063354 | |||
| 443 | Ga0373947_0005246 | |||
| 444 | Ga0373937_0001741 | |||
| 445 | Ga0373925_0009055 | |||
| 446 | Ga0395899_0065513 | |||
| 447 | Ga0395900_0034689 | |||
| 448 | Ga0395900_0071526 | |||
| 449 | Ga0395898_0024640 | |||
| 450 | Ga0395905_0126964 | |||
| 451 | Ga0395905_0180989 | |||
| 452 | Ga0395901_0309216 | |||
| 453 | Ga0466969_0002096 | |||
| 454 | Ga0466966_0170494 | |||
| 455 | Ga0466961_0014219 | |||
| 456 | Ga0466963_0002075 | |||
| 457 | Ga0466963_0002166 | |||
| 458 | Ga0466963_0005735 | |||
| 459 | Ga0466963_0006336 | |||
| 460 | Ga0466963_0011652 | |||
| 461 | Ga0466963_0012421 | |||
| 462 | Ga0466963_0018693 | |||
| 463 | Ga0466963_0022230 | |||
| 464 | Ga0466963_0035890 | |||
| 465 | Ga0466963_0106506 | |||
| 466 | Ga0466964_0000945 | |||
| 467 | Ga0466964_0001659 | |||
| 468 | Ga0466964_0009010 | |||
| 469 | Ga0466964_0016898 | |||
| 470 | Ga0466964_0064309 | |||
| 471 | Ga0466971_0003205 | |||
| 472 | Ga0466971_0014505 | |||
| 473 | Ga0466971_0024407 | |||
| 474 | Ga0466971_0041342 | |||
| 475 | Ga0466968_0001888 | |||
| 476 | Ga0466968_0011633 | |||
| 477 | Ga0466968_0017232 | |||
| 478 | Ga0466968_0030057 | |||
| 479 | Ga0466957_0001738 | |||
| 480 | Ga0466957_0030237 | |||
| 481 | Ga0466957_0033586 | |||
| 482 | Ga0466957_0053496 | |||
| 483 | Ga0466957_0066115 | |||
| 484 | Ga0466957_0071751 | |||
| 485 | Ga0466957_0094165 | |||
| 486 | Ga0466957_0144958 | |||
| 487 | Ga0466960_0051691 | |||
| 488 | Ga0466959_0155880 | |||
| 489 | Ga0466959_0166446 | |||
| 490 | Ga0466958_0001472 | |||
| 491 | Ga0466958_0004536 | |||
| 492 | Ga0466958_0013544 | |||
| 493 | Ga0466958_0026319 | |||
| 494 | Ga0466958_0037176 | |||
| 495 | Ga0466967_0001581 | |||
| 496 | Ga0466967_0005799 | |||
| 497 | Ga0466967_0005936 | |||
| 498 | Ga0466967_0006315 | |||
| 499 | Ga0466967_0010155 | |||
| 500 | Ga0466967_0010768 | |||
| 501 | Ga0466967_0012296 | |||
| 502 | Ga0466967_0015883 | |||
| 503 | Ga0466967_0020070 | |||
| 504 | Ga0466967_0042627 | |||
| 505 | Ga0466967_0054937 | |||
| 506 | Ga0466967_0056725 | |||
| 507 | Ga0466967_0096691 | |||
| 508 | Ga0466967_0098176 | |||
| 509 | Ga0466967_0202672 | |||
| 510 | Ga0466967_0314051 | |||
| 511 | Ga0495592_0000168 | |||
| 512 | Ga0495592_0003762 | |||
| 513 | Ga0495592_0075183 | |||
| 514 | Ga0495603_0015242 | |||
| 515 | Ga0495629_0006592 | |||
| 516 | Ga0495641_0009209 | |||
| 517 | Ga0495641_0036112 | |||
| 518 | Ga0495651_0000011 | |||
| 519 | Ga0495653_0002290 | |||
| 520 | Ga0495653_0010788 | |||
| 521 | Ga0495653_0016818 | |||
| 522 | Ga0495653_0033341 | |||
| 523 | Ga0495580_0010576 | |||
| 524 | Ga0495582_0003690 | |||
| 525 | Ga0495582_0044982 | |||
| 526 | Ga0495582_0054587 | |||
| 527 | Ga0495582_0123597 | |||
| 528 | Ga0495639_0002070 | |||
| 529 | Ga0495662_0001057 | |||
| 530 | Ga0495664_0007091 | |||
| 531 | Ga0495664_0022213 | |||
| 532 | Ga0495664_0039936 | |||
| 533 | Ga0495664_0148748 | |||
| 534 | Ga0495607_0039084 | |||
| 535 | Ga0495608_0002777 | |||
| 536 | Ga0495608_0026569 | |||
| 537 | Ga0495618_0003147 | |||
| 538 | Ga0495618_0010250 | |||
| 539 | Ga0495618_0016666 | |||
| 540 | Ga0495618_0173147 | |||
| 541 | Ga0495628_0000024 | |||
| 542 | Ga0495628_0046536 | |||
| 543 | Ga0495630_0078360 | |||
| 544 | Ga0495666_0000373 | |||
| 545 | Ga0495652_0000050 | |||
| 546 | Ga0495652_0010725 | |||
| 547 | Ga0495652_0018312 | |||
| 548 | Ga0495652_0049286 | |||
| 549 | Ga0495665_0000715 | |||
| 550 | Ga0495640_0011393 | |||
| 551 | Ga0495640_0190189 | |||
| 552 | Ga0495587_0000353 | |||
| 553 | Ga0495587_0128720 | |||
| 554 | Ga0495645_0000376 | |||
| 555 | Ga0495645_0016026 | |||
| 556 | Ga0495645_0023761 | |||
| 557 | Ga0495667_0008996 | |||
| 558 | Ga0495667_0018815 | |||
| 559 | Ga0495656_0034578 | |||
| 560 | Ga0495634_0012647 | |||
| 561 | Ga0495634_0115816 | |||
| 562 | Ga0495635_0005318 | |||
| 563 | Ga0495657_0016058 | |||
| 564 | Ga0495657_0047942 | |||
| 565 | Ga0495657_0103093 | |||
| 566 | Ga0495599_0000009 | |||
| 567 | Ga0495599_0004409 | |||
| 568 | Ga0495599_0132391 | |||
| 569 | Ga0495623_0000039 | |||
| 570 | Ga0495623_0108051 | |||
| 571 | Ga0495646_0011647 | |||
| 572 | Ga0495647_0000440 | |||
| 573 | Ga0495647_0119216 | |||
| 574 | Ga0495658_0001069 | |||
| 575 | Ga0495613_0004122 | |||
| 576 | Ga0495613_0019982 | |||
| 577 | Ga0495624_0005741 | |||
| 578 | Ga0495600_0040669 | |||
| 579 | Ga0495581_0007153 | |||
| 580 | Ga0495604_0000183 | |||
| 581 | Ga0495604_0072046 | |||
| 582 | Ga0495674_0102678 | |||
| 583 | Ga0495676_0108266 | |||
| 584 | Ga0495676_0159322 | |||
| 585 | Ga0495680_0031803 | |||
| 586 | Ga0495680_0055362 | |||
| 587 | Ga0495675_0000167 | |||
| 588 | Ga0495684_0021934 | |||
| 589 | Ga0495602_0000477 | |||
| 590 | Ga0495614_0004754 | |||
| 591 | Ga0496100_0093661 | |||
| 592 | Ga0496100_0119244 | |||
| 593 | Ga0496101_0021315 | |||
| 594 | Ga0496101_0050214 | |||
| 595 | Ga0496102_0045980 | |||
| 596 | Ga0496102_0052515 | |||
| 597 | Ga0496102_0133637 | |||
| 598 | Ga0496102_0276516 | |||
| 599 | Ga0496104_0034790 | |||
| 600 | Ga0496104_0066886 | |||
| 601 | Ga0496104_0105931 | |||
| 602 | Ga0496104_0311243 | |||
| 603 | Ga0496105_0013488 | |||
| 604 | Ga0496105_0066059 | |||
| 605 | Ga0496105_0084887 | |||
| 606 | Ga0496105_0099333 | |||
| 607 | Ga0496106_0044161 | |||
| 608 | Ga0496107_0012340 | |||
| 609 | Ga0496107_0020524 | |||
| 610 | Ga0496108_0003729 | |||
| 611 | Ga0496108_0014840 | |||
| 612 | Ga0496108_0050870 | |||
| 613 | Ga0496108_0098076 | |||
| 614 | Ga0496109_0032817 | |||
| 615 | Ga0496109_0133944 | |||
| 616 | Ga0496110_0321226 | |||
| 617 | Ga0496111_0049566 | |||
| 618 | Ga0496111_0235986 | |||
| 619 | Ga0496112_0075359 | |||
| 620 | Ga0496112_0101867 | |||
| 621 | Ga0496112_0139783 | |||
| 622 | Ga0496112_0153901 | |||
| 623 | Ga0496113_0054057 | |||
| 624 | Ga0496113_0097216 | |||
| 625 | Ga0496113_0365594 | |||
| 626 | Ga0496114_0005231 | |||
| 627 | Ga0496114_0069271 | |||
| 628 | Ga0496114_0070642 | |||
| 629 | Ga0496115_0011169 | |||
| 630 | Ga0496115_0014777 | |||
| 631 | Ga0501034_0032876 | |||
| 632 | Ga0501067_0028546 | |||
| 633 | Ga0501067_0032444 | |||
| 634 | Ga0501070_0005687 | |||
| 635 | Ga0501070_0013065 | |||
| 636 | Ga0501072_0048775 | |||
| 637 | Ga0501073_0024814 | |||
| 638 | Ga0501073_0071785 | |||
| 639 | Ga0501074_0007988 | |||
| 640 | Ga0501074_0086027 | |||
| 641 | Ga0501079_0046440 | |||
| 642 | Ga0501080_0039084 | |||
| 643 | Ga0501080_0113189 | |||
| 644 | Ga0501083_0001008 | |||
| 645 | Ga0495601_0000094 | |||
| 646 | Ga0495601_0022922 | |||
| 647 | Ga0495612_0002293 | |||
| 648 | Ga0495612_0015596 | |||
| 649 | Ga0495619_0048790 | |||
| 650 | Ga0495619_0155505 | |||
| 651 | Ga0501082_0309704 | |||
| 652 | Ga0466962_0003164 | |||
| 653 | Ga0466962_0005023 | |||
| 654 | Ga0466962_0006458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1byr-assembly1.cif.gz_A | crystal structure of a phospholipase d family member, nuc from salmonella typhimurium | 0.8028 | 2 | 158 |
| 1byr-assembly1.cif.gz_A | crystal structure of a phospholipase d family member, nuc from salmonella typhimurium | 0.7644 | 2 | 158 |
| 4gel-assembly1.cif.gz_A | crystal structure of zucchini | 0.7481 | 1 | 158 |
| 5qhm-assembly1.cif.gz_A | pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of human fam83b in complex with ox-145 | 0.748 | 176 | 344 |
| 4gel-assembly1.cif.gz_B | crystal structure of zucchini | 0.7296 | 1 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8N2A8_32_212_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.8484 | 21 | 158 | 3.30.870.10 |
| 1bysA00 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.8011 | 2 | 158 | 3.30.870.10 |
| af_E9QJQ5_383_539_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.7943 | 19 | 160 | 3.30.870.10 |
| af_A0A2R8QAT2_122_259_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.7924 | 18 | 160 | 3.30.870.10 |
| af_Q8I4C7_77_238_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.7906 | 18 | 157 | 3.30.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LRG7-F1-model_v4 | phospholipase D (EC 3.1.4.4) | 0.978 | 119 | 342 |
GO:0006793
GO:0016042 GO:0016891 |
| AF-A0A538FLP0-F1-model_v4 | PLD phosphodiesterase domain-containing protein | 0.9758 | 191 | 344 |
GO:0003824
GO:0006793 |
| AF-A0A537TK82-F1-model_v4 | phospholipase D (EC 3.1.4.4) | 0.9723 | 3 | 342 |
GO:0006793
GO:0016042 GO:0016891 |
| AF-A0A538LXP8-F1-model_v4 | PLD phosphodiesterase domain-containing protein | 0.9712 | 189 | 341 |
GO:0003824
GO:0006793 |
| AF-A0A538H468-F1-model_v4 | phospholipase D (EC 3.1.4.4) | 0.9707 | 3 | 343 |
GO:0006793
GO:0016042 GO:0016891 |