F408447

General Info

Members Datasets Scaffolds Average Seq Length
326 186 652 84

Family's Representative Sequence

Representative Sequence 3300042136|Ga0450900_015774|Ga0450900_015774_39_290
Length 83
Sequence MWEARAVQDRGAELLEWARAQQLPYEPARRETFRAPQDRVLVLTWWEADSVYAELPELPEPDAGLITRPVHRWRFESVDTEAT

Samples

Sample ID Description Type Environment
1 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
15 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
16 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
17 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
20 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
26 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
31 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
32 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
33 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
34 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
35 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
36 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
37 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
160 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
161 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
162 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
163 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
164 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
165 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
166 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
167 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
168 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
169 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
170 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
171 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
172 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
173 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
174 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
175 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
176 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
177 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
178 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
179 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
180 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
181 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
182 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
183 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
184 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
185 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
186 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.8
Metatranscriptomes 0.61
Isolates 8.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0.92
Rhizoplane 1.23
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450900_015774 3300042136 Bacteria 1018
2 rootH2_10054496 3300003320 Bacteria 8936
3 rootL2_10204928 3300003322 Bacteria 1498
4 rootH1_10029791 3300003323 Bacteria 1837
5 Ga0006562J51391_1191397 3300003578 Bacteria 6697
6 Ga0006562J51391_1191398 3300003578 Bacteria 6677
7 Ga0081539_10082091 3300005985 Bacteria 1691
8 Ga0075365_10436951 3300006038 Bacteria 924
9 Ga0075368_10001517 3300006042 Bacteria 7434
10 Ga0075363_100004987 3300006048 Bacteria 5873
11 Ga0075367_10001671 3300006178 Bacteria 9681
12 Ga0182008_10000155 3300014497 Bacteria 54054
13 Ga0182006_1027772 3300015261 Bacteria 2307
14 Ga0182007_10000136 3300015262 Bacteria 51316
15 Ga0183367_1002 3300015688 Bacteria 1101531
16 Ga0207426_1026704 3300025302 Bacteria 1930
17 Ga0209282_1219871 3300027666 Bacteria 861
18 Ga0209813_10231416 3300027866 Bacteria 696
19 Ga0307515_10116531 3300028794 Bacteria 3066
20 Ga0268256_1095210 3300030500 Bacteria 536
21 Ga0307511_10018953 3300030521 Bacteria 6560
22 Ga0307511_10142181 3300030521 Bacteria 1405
23 Ga0307513_10006635 3300031456 Bacteria 15108
24 Ga0307508_10001583 3300031616 Bacteria 25403
25 Ga0307508_10076849 3300031616 Bacteria 2917
26 Ga0307514_10147125 3300031649 Bacteria 1589
27 Ga0307514_10273026 3300031649 Bacteria 976
28 Ga0307516_10006929 3300031730 Bacteria 13156
29 Ga0307516_10187351 3300031730 Bacteria 1798
30 Ga0307516_10228639 3300031730 Bacteria 1565
31 Ga0307416_100907820 3300032002 Bacteria 981
32 Ga0307510_10007777 3300033180 Bacteria 12783
33 Ga0307510_10047354 3300033180 Bacteria 4608
34 Ga0307510_10591135 3300033180 Bacteria 560
35 Ga0395900_0092197 3300037418 Bacteria 3113
36 Ga0395900_0363727 3300037418 Bacteria 1418
37 Ga0395898_0002829 3300037466 Bacteria 19865
38 Ga0395901_0053652 3300038443 Bacteria 4189
39 Ga0439436_0009947 3300041404 Bacteria 2909
40 Ga0439439_0000588 3300041406 Bacteria 6382
41 Ga0439439_0005643 3300041406 Bacteria 2866
42 Ga0451797_0516325 3300041453 Bacteria 566
43 Ga0451795_1708083 3300041456 Bacteria 531
44 Ga0439433_0016610 3300041999 Bacteria 1631
45 Ga0439433_0070019 3300041999 Bacteria 844
46 Ga0439442_010434 3300042002 Bacteria 1883
47 Ga0439442_014438 3300042002 Bacteria 1626
48 Ga0439432_082547 3300042006 Bacteria 973
49 Ga0439432_094988 3300042006 Bacteria 895
50 Ga0439449_0005931 3300042007 Bacteria 4665
51 Ga0439449_0045491 3300042007 Bacteria 1626
52 Ga0439449_0161372 3300042007 Bacteria 837
53 Ga0439457_000871 3300042014 Bacteria 9119
54 Ga0439457_001914 3300042014 Bacteria 6125
55 Ga0439462_0001654 3300042015 Bacteria 5014
56 Ga0450897_008666 3300042128 Bacteria 950
57 Ga0450894_000225 3300042131 Bacteria 10071
58 Ga0450899_003265 3300042135 Bacteria 1746
59 Ga0466969_0005182 3300044656 Bacteria 6931
60 Ga0466972_0011948 3300044658 Bacteria 4362
61 Ga0466972_0016911 3300044658 Bacteria 3648
62 Ga0466972_0035224 3300044658 Bacteria 2450
63 Ga0466965_0000653 3300044683 Bacteria 12707
64 Ga0466965_0020028 3300044683 Bacteria 3214
65 Ga0466965_0053978 3300044683 Bacteria 1998
66 Ga0466965_0082748 3300044683 Bacteria 1624
67 Ga0466965_0298595 3300044683 Bacteria 873
68 Ga0466966_0003958 3300044684 Bacteria 9789
69 Ga0466966_0011706 3300044684 Bacteria 5815
70 Ga0466961_0000611 3300044693 Bacteria 22503
71 Ga0466961_0006911 3300044693 Bacteria 7218
72 Ga0466961_0210792 3300044693 Bacteria 1199
73 Ga0466961_0486247 3300044693 Bacteria 746
74 Ga0466963_0004346 3300044694 Bacteria 8223
75 Ga0466964_0034161 3300044706 Bacteria 2028
76 Ga0466971_0000457 3300044719 Bacteria 15967
77 Ga0466971_0010926 3300044719 Bacteria 3971
78 Ga0466968_0005561 3300044735 Bacteria 4721
79 Ga0466968_0225312 3300044735 Bacteria 884
80 Ga0466970_0000694 3300044765 Bacteria 16488
81 Ga0466970_0010908 3300044765 Bacteria 4622
82 Ga0466970_0120116 3300044765 Bacteria 1439
83 Ga0466970_0189553 3300044765 Bacteria 1142
84 Ga0466957_0001205 3300044842 Bacteria 13474
85 Ga0466957_0407092 3300044842 Bacteria 931
86 Ga0466960_0062018 3300044901 Bacteria 1836
87 Ga0466960_0564176 3300044901 Bacteria 673
88 Ga0466959_0000660 3300045049 Bacteria 20099
89 Ga0466959_0907534 3300045049 Bacteria 588
90 Ga0466958_0000224 3300045836 Bacteria 21400
91 Ga0466958_0164953 3300045836 Bacteria 1401
92 Ga0466958_0239659 3300045836 Bacteria 1159
93 Ga0466967_0000183 3300045976 Bacteria 26073
94 Ga0466967_0255509 3300045976 Bacteria 1675
95 Ga0466967_0377876 3300045976 Bacteria 1375
96 Ga0466967_0698030 3300045976 Bacteria 1005
97 Ga0466967_0758952 3300045976 Bacteria 962
98 Ga0495592_0008868 3300046454 Bacteria 7552
99 Ga0495603_0179902 3300046455 Bacteria 1223
100 Ga0495603_0344634 3300046455 Bacteria 855
101 Ga0495590_0056553 3300046457 Bacteria 1371
102 Ga0495590_0127737 3300046457 Bacteria 913
103 Ga0495629_0011002 3300046459 Bacteria 6571
104 Ga0495629_0133921 3300046459 Bacteria 1725
105 Ga0495629_0709622 3300046459 Bacteria 667
106 Ga0495651_0098384 3300046462 Bacteria 2183
107 Ga0495580_0055541 3300046472 Bacteria 2790
108 Ga0495582_0180883 3300046473 Bacteria 1201
109 Ga0495605_0001076 3300046474 Bacteria 18189
110 Ga0495605_0470059 3300046474 Bacteria 516
111 Ga0495662_0003349 3300046476 Bacteria 8126
112 Ga0495662_0027245 3300046476 Bacteria 2761
113 Ga0495662_0030539 3300046476 Bacteria 2601
114 Ga0495585_0096357 3300046492 Bacteria 1587
115 Ga0495594_0004202 3300046499 Bacteria 7393
116 Ga0495594_0227182 3300046499 Bacteria 1064
117 Ga0495594_0244282 3300046499 Bacteria 1023
118 Ga0495596_0030434 3300046500 Bacteria 2161
119 Ga0495596_0186177 3300046500 Bacteria 807
120 Ga0495607_0023987 3300046501 Bacteria 3809
121 Ga0495583_0017956 3300046506 Bacteria 3739
122 Ga0495583_0027542 3300046506 Bacteria 2804
123 Ga0495606_0113477 3300046507 Bacteria 1631
124 Ga0495608_0201077 3300046511 Bacteria 1255
125 Ga0495610_0071788 3300046512 Bacteria 1613
126 Ga0495618_0159865 3300046514 Bacteria 1436
127 Ga0495618_0347653 3300046514 Bacteria 914
128 Ga0495620_0144112 3300046515 Bacteria 930
129 Ga0495628_0064575 3300046516 Bacteria 2865
130 Ga0495628_0251121 3300046516 Bacteria 1320
131 Ga0495631_0044216 3300046518 Bacteria 1963
132 Ga0495643_0006355 3300046522 Bacteria 7803
133 Ga0495648_0114363 3300046524 Bacteria 1462
134 Ga0495648_0245075 3300046524 Bacteria 868
135 Ga0495666_0213612 3300046526 Bacteria 884
136 Ga0495652_0127631 3300046529 Bacteria 2018
137 Ga0495654_0055249 3300046530 Bacteria 1923
138 Ga0495640_0044831 3300046533 Bacteria 3072
139 Ga0495640_0343260 3300046533 Bacteria 922
140 Ga0495587_0183402 3300046536 Bacteria 1186
141 Ga0495609_0077617 3300046538 Bacteria 1454
142 Ga0495597_0007958 3300046542 Bacteria 5337
143 Ga0495597_0052413 3300046542 Bacteria 1796
144 Ga0495645_0791713 3300046543 Bacteria 569
145 Ga0495622_0023051 3300046557 Bacteria 2901
146 Ga0495622_0043777 3300046557 Bacteria 2081
147 Ga0495667_0249664 3300046559 Bacteria 1129
148 Ga0495668_0020725 3300046616 Bacteria 3778
149 Ga0495668_0101393 3300046616 Bacteria 1574
150 Ga0495634_0066236 3300046642 Bacteria 2392
151 Ga0495611_0014782 3300046648 Bacteria 3336
152 Ga0495625_0033791 3300046660 Bacteria 3777
153 Ga0495625_0315078 3300046660 Bacteria 997
154 Ga0495635_0032118 3300046663 Bacteria 3643
155 Ga0495635_0275782 3300046663 Bacteria 1130
156 Ga0495661_0048912 3300046665 Bacteria 2567
157 Ga0495657_0026243 3300046675 Bacteria 4125
158 Ga0495657_0029102 3300046675 Bacteria 3877
159 Ga0495657_0157342 3300046675 Bacteria 1407
160 Ga0495657_0386265 3300046675 Bacteria 825
161 Ga0495623_0266796 3300046679 Bacteria 957
162 Ga0495646_0062819 3300046680 Bacteria 2207
163 Ga0495646_0313642 3300046680 Bacteria 827
164 Ga0495613_0006587 3300046689 Bacteria 8682
165 Ga0495613_0061693 3300046689 Bacteria 2745
166 Ga0495613_0067854 3300046689 Bacteria 2602
167 Ga0495613_0072315 3300046689 Bacteria 2513
168 Ga0495613_0872928 3300046689 Bacteria 583
169 Ga0495624_0350119 3300046690 Bacteria 888
170 Ga0495624_0941902 3300046690 Bacteria 507
171 Ga0495670_0388080 3300046691 Bacteria 754
172 Ga0495671_0074087 3300046692 Bacteria 1671
173 Ga0495649_0008347 3300046694 Bacteria 6233
174 Ga0495649_0035153 3300046694 Bacteria 2756
175 Ga0495649_0037628 3300046694 Bacteria 2655
176 Ga0495589_0021912 3300046794 Bacteria 3264
177 Ga0495589_0032344 3300046794 Bacteria 2630
178 Ga0495589_0042031 3300046794 Bacteria 2278
179 Ga0495589_0522465 3300046794 Bacteria 541
180 Ga0495600_0242860 3300046809 Bacteria 1147
181 Ga0495600_0324649 3300046809 Bacteria 967
182 Ga0495600_0341265 3300046809 Bacteria 939
183 Ga0495660_0020568 3300046810 Bacteria 3783
184 Ga0495660_0070303 3300046810 Bacteria 1858
185 Ga0495660_0091351 3300046810 Bacteria 1581
186 Ga0495660_0286020 3300046810 Bacteria 752
187 Ga0495581_0104244 3300047315 Bacteria 1648
188 Ga0495581_0105166 3300047315 Bacteria 1640
189 Ga0495604_0033560 3300047317 Bacteria 4062
190 Ga0495604_0050627 3300047317 Bacteria 3224
191 Ga0495636_0002227 3300047318 Bacteria 7443
192 Ga0495636_0266635 3300047318 Bacteria 795
193 Ga0495674_0170369 3300047319 Bacteria 1817
194 Ga0495676_0058831 3300047321 Bacteria 3021
195 Ga0495676_0088101 3300047321 Bacteria 2329
196 Ga0495676_0319467 3300047321 Bacteria 1043
197 Ga0495676_0846728 3300047321 Bacteria 587
198 Ga0495680_0052592 3300047322 Bacteria 3174
199 Ga0495683_0024768 3300047323 Bacteria 3078
200 Ga0495683_0049714 3300047323 Bacteria 2099
201 Ga0495683_0064430 3300047323 Bacteria 1809
202 Ga0495683_0084271 3300047323 Bacteria 1547
203 Ga0495683_0299696 3300047323 Bacteria 691
204 Ga0495687_002973 3300047443 Bacteria 12837
205 Ga0495687_028777 3300047443 Bacteria 2579
206 Ga0495687_120829 3300047443 Bacteria 945
207 Ga0495687_136362 3300047443 Bacteria 860
208 Ga0495687_156745 3300047443 Bacteria 771
209 Ga0495675_0031142 3300047444 Bacteria 3405
210 Ga0495675_0173541 3300047444 Bacteria 1323
211 Ga0495677_0022355 3300047445 Bacteria 2294
212 Ga0495677_0072904 3300047445 Bacteria 1281
213 Ga0495677_0247850 3300047445 Bacteria 696
214 Ga0495685_003195 3300047447 Bacteria 5203
215 Ga0495685_008860 3300047447 Bacteria 3354
216 Ga0495685_036934 3300047447 Bacteria 1676
217 Ga0495684_0732281 3300047471 Bacteria 652
218 Ga0495686_0099478 3300047472 Bacteria 1756
219 Ga0495593_0027406 3300047673 Bacteria 3137
220 Ga0495593_0040182 3300047673 Bacteria 2519
221 Ga0495602_0152283 3300048088 Bacteria 1816
222 Ga0495614_0067145 3300048089 Bacteria 1543
223 Ga0495614_0213943 3300048089 Bacteria 874
224 Ga0495626_0004502 3300048091 Bacteria 8531
225 Ga0496112_1294641 3300048915 Bacteria 645
226 Ga0495678_006981 3300049459 Bacteria 5925
227 Ga0501031_0116634 3300049568 Bacteria 1744
228 Ga0501032_0015715 3300049569 Bacteria 5336
229 Ga0501032_0290630 3300049569 Bacteria 1057
230 Ga0501033_0004081 3300049570 Bacteria 11782
231 Ga0501033_0021518 3300049570 Bacteria 4865
232 Ga0501033_0039060 3300049570 Bacteria 3546
233 Ga0501033_0348573 3300049570 Bacteria 1037
234 Ga0501034_0008719 3300049571 Bacteria 10676
235 Ga0501034_0088286 3300049571 Bacteria 3099
236 Ga0501034_0165835 3300049571 Bacteria 2177
237 Ga0501034_0325048 3300049571 Bacteria 1470
238 Ga0501036_0000494 3300049572 Bacteria 28194
239 Ga0501036_0029201 3300049572 Bacteria 4661
240 Ga0501036_0061996 3300049572 Bacteria 3167
241 Ga0501037_0026848 3300049573 Bacteria 4253
242 Ga0501038_0005220 3300049574 Bacteria 12090
243 Ga0501038_0049352 3300049574 Bacteria 3639
244 Ga0501038_0056587 3300049574 Bacteria 3368
245 Ga0501038_0101677 3300049574 Bacteria 2392
246 Ga0501038_0480724 3300049574 Bacteria 952
247 Ga0501039_0002250 3300049575 Bacteria 14310
248 Ga0501039_0395557 3300049575 Bacteria 1085
249 Ga0501039_0889450 3300049575 Bacteria 693
250 Ga0501042_0390971 3300049578 Bacteria 1007
251 Ga0501042_0589877 3300049578 Bacteria 808
252 Ga0501043_0002870 3300049579 Bacteria 14387
253 Ga0501043_0005728 3300049579 Bacteria 10009
254 Ga0501043_0501935 3300049579 Bacteria 906
255 Ga0501046_0019825 3300049580 Bacteria 5569
256 Ga0501047_0008284 3300049581 Bacteria 9813
257 Ga0501047_0021108 3300049581 Bacteria 6252
258 Ga0501047_0215945 3300049581 Bacteria 1775
259 Ga0501047_0223115 3300049581 Bacteria 1740
260 Ga0501047_0569177 3300049581 Bacteria 956
261 Ga0501048_0037095 3300049582 Bacteria 3500
262 Ga0501048_0096571 3300049582 Bacteria 2084
263 Ga0501068_0013319 3300049584 Bacteria 4677
264 Ga0501070_0000894 3300049586 Bacteria 27126
265 Ga0501070_0147475 3300049586 Bacteria 1942
266 Ga0501070_0552180 3300049586 Bacteria 922
267 Ga0501070_1098098 3300049586 Bacteria 614
268 Ga0501072_0389530 3300049588 Bacteria 1106
269 Ga0501073_0175824 3300049589 Bacteria 1482
270 Ga0501073_0584119 3300049589 Bacteria 772
271 Ga0501074_0129404 3300049590 Bacteria 1806
272 Ga0501080_0280014 3300049742 Bacteria 1516
273 Ga0501083_0231997 3300049744 Bacteria 1202
274 Ga0501035_0002481 3300049822 Bacteria 18028
275 Ga0501035_0032746 3300049822 Bacteria 4727
276 Ga0501035_0159518 3300049822 Bacteria 1953
277 Ga0501035_0803158 3300049822 Bacteria 751
278 Ga0501035_1009470 3300049822 Bacteria 654
279 Ga0501044_0001248 3300049823 Bacteria 30179
280 Ga0501044_0010700 3300049823 Bacteria 9953
281 Ga0501044_0012972 3300049823 Bacteria 9023
282 Ga0501044_0115784 3300049823 Bacteria 2686
283 Ga0501044_0291069 3300049823 Bacteria 1564
284 Ga0501044_1119280 3300049823 Bacteria 656
285 Ga0501045_0360660 3300049824 Bacteria 1082
286 Ga0501045_0596092 3300049824 Bacteria 818
287 Ga0501045_0646145 3300049824 Bacteria 782
288 nmdc:mga03n38_127130_c1 3300050490 Bacteria 1259
289 nmdc:mga03n38_297097_c1 3300050490 Bacteria 866
290 nmdc:mga0yw44_532692_c1 3300050492 Bacteria 797
291 nmdc:mga06z11_59856_c1 3300050494 Bacteria 1981
292 nmdc:mga04h51_8954_c1 3300050495 Bacteria 2693
293 nmdc:mga07m45_488041_c1 3300050496 Bacteria 713
294 nmdc:mga0sz30_231357_c1 3300050516 Bacteria 822
295 Ga0500644_0300981 3300053088 Bacteria 686
296 Ga0500628_245868 3300053129 Bacteria 525
297 Ga0466962_0000658 3300061719 Bacteria 15325
298 Ga0466962_0110694 3300061719 Bacteria 1322
299 2547411331 2547132111 Bacteria 8013147
300 2616696726 2616644814 Bacteria 11555299
301 2644439390 2643221678 Bacteria 9540101
302 2785341818 2784746763 Bacteria 9783172
303 2793985551 2791355406 Bacteria 11364898
304 2808843391 2808606359 Bacteria 9866990
305 2808912972 2808606375 Bacteria 9466072
306 2812356650 2811994879 Bacteria 9313447
307 2852642795 2852635781 Bacteria 8251373
308 2862386679 2862382967 Bacteria 10317375
309 2862511950 2862507626 Bacteria 9425308
310 2873154652 2873151551 Bacteria 8625867
311 2877679741 2877676314 Bacteria 9512378
312 2912718383 2912715099 Bacteria 9460473
313 2912730732 2912723979 Bacteria 8557534
314 2919470290 2919468124 Bacteria 9133025
315 2946069218 2946064051 Bacteria 8957905
316 2947227708 2947224130 Bacteria 9938529
317 2997601394 2997600082 Bacteria 9896405
318 3006498879 3006493962 Bacteria 8825450
319 8008566605 8008558824 Bacteria 10610750
320 8023626989 8023623736 Bacteria 8593882
321 8025532263 8025530807 Bacteria 8495698
322 8047896920 8047893842 Bacteria 11723082
323 8048362030 8048356638 Bacteria 11044339
324 8048373905 8048369669 Bacteria 11666822
325 8048384322 8048379754 Bacteria 11877923
326 8056837563 8056829672 Bacteria 9045328
327 Ga0450900_015774
328 rootH2_10054496
329 rootL2_10204928
330 rootH1_10029791
331 Ga0006562J51391_1191397
332 Ga0006562J51391_1191398
333 Ga0081539_10082091
334 Ga0075365_10436951
335 Ga0075368_10001517
336 Ga0075363_100004987
337 Ga0075367_10001671
338 Ga0182008_10000155
339 Ga0182006_1027772
340 Ga0182007_10000136
341 Ga0183367_1002
342 Ga0207426_1026704
343 Ga0209282_1219871
344 Ga0209813_10231416
345 Ga0307515_10116531
346 Ga0268256_1095210
347 Ga0307511_10018953
348 Ga0307511_10142181
349 Ga0307513_10006635
350 Ga0307508_10001583
351 Ga0307508_10076849
352 Ga0307514_10147125
353 Ga0307514_10273026
354 Ga0307516_10006929
355 Ga0307516_10187351
356 Ga0307516_10228639
357 Ga0307416_100907820
358 Ga0307510_10007777
359 Ga0307510_10047354
360 Ga0307510_10591135
361 Ga0395900_0092197
362 Ga0395900_0363727
363 Ga0395898_0002829
364 Ga0395901_0053652
365 Ga0439436_0009947
366 Ga0439439_0000588
367 Ga0439439_0005643
368 Ga0451797_0516325
369 Ga0451795_1708083
370 Ga0439433_0016610
371 Ga0439433_0070019
372 Ga0439442_010434
373 Ga0439442_014438
374 Ga0439432_082547
375 Ga0439432_094988
376 Ga0439449_0005931
377 Ga0439449_0045491
378 Ga0439449_0161372
379 Ga0439457_000871
380 Ga0439457_001914
381 Ga0439462_0001654
382 Ga0450897_008666
383 Ga0450894_000225
384 Ga0450899_003265
385 Ga0466969_0005182
386 Ga0466972_0011948
387 Ga0466972_0016911
388 Ga0466972_0035224
389 Ga0466965_0000653
390 Ga0466965_0020028
391 Ga0466965_0053978
392 Ga0466965_0082748
393 Ga0466965_0298595
394 Ga0466966_0003958
395 Ga0466966_0011706
396 Ga0466961_0000611
397 Ga0466961_0006911
398 Ga0466961_0210792
399 Ga0466961_0486247
400 Ga0466963_0004346
401 Ga0466964_0034161
402 Ga0466971_0000457
403 Ga0466971_0010926
404 Ga0466968_0005561
405 Ga0466968_0225312
406 Ga0466970_0000694
407 Ga0466970_0010908
408 Ga0466970_0120116
409 Ga0466970_0189553
410 Ga0466957_0001205
411 Ga0466957_0407092
412 Ga0466960_0062018
413 Ga0466960_0564176
414 Ga0466959_0000660
415 Ga0466959_0907534
416 Ga0466958_0000224
417 Ga0466958_0164953
418 Ga0466958_0239659
419 Ga0466967_0000183
420 Ga0466967_0255509
421 Ga0466967_0377876
422 Ga0466967_0698030
423 Ga0466967_0758952
424 Ga0495592_0008868
425 Ga0495603_0179902
426 Ga0495603_0344634
427 Ga0495590_0056553
428 Ga0495590_0127737
429 Ga0495629_0011002
430 Ga0495629_0133921
431 Ga0495629_0709622
432 Ga0495651_0098384
433 Ga0495580_0055541
434 Ga0495582_0180883
435 Ga0495605_0001076
436 Ga0495605_0470059
437 Ga0495662_0003349
438 Ga0495662_0027245
439 Ga0495662_0030539
440 Ga0495585_0096357
441 Ga0495594_0004202
442 Ga0495594_0227182
443 Ga0495594_0244282
444 Ga0495596_0030434
445 Ga0495596_0186177
446 Ga0495607_0023987
447 Ga0495583_0017956
448 Ga0495583_0027542
449 Ga0495606_0113477
450 Ga0495608_0201077
451 Ga0495610_0071788
452 Ga0495618_0159865
453 Ga0495618_0347653
454 Ga0495620_0144112
455 Ga0495628_0064575
456 Ga0495628_0251121
457 Ga0495631_0044216
458 Ga0495643_0006355
459 Ga0495648_0114363
460 Ga0495648_0245075
461 Ga0495666_0213612
462 Ga0495652_0127631
463 Ga0495654_0055249
464 Ga0495640_0044831
465 Ga0495640_0343260
466 Ga0495587_0183402
467 Ga0495609_0077617
468 Ga0495597_0007958
469 Ga0495597_0052413
470 Ga0495645_0791713
471 Ga0495622_0023051
472 Ga0495622_0043777
473 Ga0495667_0249664
474 Ga0495668_0020725
475 Ga0495668_0101393
476 Ga0495634_0066236
477 Ga0495611_0014782
478 Ga0495625_0033791
479 Ga0495625_0315078
480 Ga0495635_0032118
481 Ga0495635_0275782
482 Ga0495661_0048912
483 Ga0495657_0026243
484 Ga0495657_0029102
485 Ga0495657_0157342
486 Ga0495657_0386265
487 Ga0495623_0266796
488 Ga0495646_0062819
489 Ga0495646_0313642
490 Ga0495613_0006587
491 Ga0495613_0061693
492 Ga0495613_0067854
493 Ga0495613_0072315
494 Ga0495613_0872928
495 Ga0495624_0350119
496 Ga0495624_0941902
497 Ga0495670_0388080
498 Ga0495671_0074087
499 Ga0495649_0008347
500 Ga0495649_0035153
501 Ga0495649_0037628
502 Ga0495589_0021912
503 Ga0495589_0032344
504 Ga0495589_0042031
505 Ga0495589_0522465
506 Ga0495600_0242860
507 Ga0495600_0324649
508 Ga0495600_0341265
509 Ga0495660_0020568
510 Ga0495660_0070303
511 Ga0495660_0091351
512 Ga0495660_0286020
513 Ga0495581_0104244
514 Ga0495581_0105166
515 Ga0495604_0033560
516 Ga0495604_0050627
517 Ga0495636_0002227
518 Ga0495636_0266635
519 Ga0495674_0170369
520 Ga0495676_0058831
521 Ga0495676_0088101
522 Ga0495676_0319467
523 Ga0495676_0846728
524 Ga0495680_0052592
525 Ga0495683_0024768
526 Ga0495683_0049714
527 Ga0495683_0064430
528 Ga0495683_0084271
529 Ga0495683_0299696
530 Ga0495687_002973
531 Ga0495687_028777
532 Ga0495687_120829
533 Ga0495687_136362
534 Ga0495687_156745
535 Ga0495675_0031142
536 Ga0495675_0173541
537 Ga0495677_0022355
538 Ga0495677_0072904
539 Ga0495677_0247850
540 Ga0495685_003195
541 Ga0495685_008860
542 Ga0495685_036934
543 Ga0495684_0732281
544 Ga0495686_0099478
545 Ga0495593_0027406
546 Ga0495593_0040182
547 Ga0495602_0152283
548 Ga0495614_0067145
549 Ga0495614_0213943
550 Ga0495626_0004502
551 Ga0496112_1294641
552 Ga0495678_006981
553 Ga0501031_0116634
554 Ga0501032_0015715
555 Ga0501032_0290630
556 Ga0501033_0004081
557 Ga0501033_0021518
558 Ga0501033_0039060
559 Ga0501033_0348573
560 Ga0501034_0008719
561 Ga0501034_0088286
562 Ga0501034_0165835
563 Ga0501034_0325048
564 Ga0501036_0000494
565 Ga0501036_0029201
566 Ga0501036_0061996
567 Ga0501037_0026848
568 Ga0501038_0005220
569 Ga0501038_0049352
570 Ga0501038_0056587
571 Ga0501038_0101677
572 Ga0501038_0480724
573 Ga0501039_0002250
574 Ga0501039_0395557
575 Ga0501039_0889450
576 Ga0501042_0390971
577 Ga0501042_0589877
578 Ga0501043_0002870
579 Ga0501043_0005728
580 Ga0501043_0501935
581 Ga0501046_0019825
582 Ga0501047_0008284
583 Ga0501047_0021108
584 Ga0501047_0215945
585 Ga0501047_0223115
586 Ga0501047_0569177
587 Ga0501048_0037095
588 Ga0501048_0096571
589 Ga0501068_0013319
590 Ga0501070_0000894
591 Ga0501070_0147475
592 Ga0501070_0552180
593 Ga0501070_1098098
594 Ga0501072_0389530
595 Ga0501073_0175824
596 Ga0501073_0584119
597 Ga0501074_0129404
598 Ga0501080_0280014
599 Ga0501083_0231997
600 Ga0501035_0002481
601 Ga0501035_0032746
602 Ga0501035_0159518
603 Ga0501035_0803158
604 Ga0501035_1009470
605 Ga0501044_0001248
606 Ga0501044_0010700
607 Ga0501044_0012972
608 Ga0501044_0115784
609 Ga0501044_0291069
610 Ga0501044_1119280
611 Ga0501045_0360660
612 Ga0501045_0596092
613 Ga0501045_0646145
614 nmdc:mga03n38_127130_c1
615 nmdc:mga03n38_297097_c1
616 nmdc:mga0yw44_532692_c1
617 nmdc:mga06z11_59856_c1
618 nmdc:mga04h51_8954_c1
619 nmdc:mga07m45_488041_c1
620 nmdc:mga0sz30_231357_c1
621 Ga0500644_0300981
622 Ga0500628_245868
623 Ga0466962_0000658
624 Ga0466962_0110694
625 2547411331
626 2616696726
627 2644439390
628 2785341818
629 2793985551
630 2808843391
631 2808912972
632 2812356650
633 2852642795
634 2862386679
635 2862511950
636 2873154652
637 2877679741
638 2912718383
639 2912730732
640 2919470290
641 2946069218
642 2947227708
643 2997601394
644 3006498879
645 8008566605
646 8023626989
647 8025532263
648 8047896920
649 8048362030
650 8048373905
651 8048384322
652 8056837563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fxd-assembly1.cif.gz_A-2 crystal structure of mupz from pseudomonas fluorescens 0.7308 2 51
3bkf-assembly1.cif.gz_A zinc-bound c-terminal domain of nikr 0.7126 1 51
2pgc-assembly1.cif.gz_C crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution 0.6966 1 53
1q5v-assembly1.cif.gz_A apo-nikr 0.6955 1 51
8tp8-assembly2.cif.gz_C structure of the c. crescentus wyl-activator, drid, bound to ssdna and cognate dna 0.6896 2 53
ID Description Score Start End Superfamily
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7946 2 53 3.30.70.100
2e1bA02 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7478 31 52 3.30.980.10
af_Q2G1Q7_1_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6974 3 57 3.30.70.100
af_Q54DN5_1_81_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6875 26 53 2.60.40.790
af_M9MMF9_1079_1181_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6862 27 50 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7M2T1A6-F1-model_v4 Uncharacterized protein 0.9992 1 83
AF-A0A5N8X2K2-F1-model_v4 ABM domain-containing protein 0.9971 1 83
AF-A0A429U281-F1-model_v4 Uncharacterized protein 0.996 2 83
AF-A0A4R7AZZ5-F1-model_v4 deleted 0.9951 1 83
AF-A0A6G3CZC2-F1-model_v4 Uncharacterized protein 0.9935 1 83

Map