F408358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 218 | 652 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10238780|Ga0207652_102387802 |
| Length | 396 |
| Sequence | MRTPDDNRITRRGLLQRALGTFASAGGVSLFPSAEPAYRSSRSAEVRPKSAPLRGKIALEEHFVIPETLAASYGAAGGPEFQRRLEDIGSARIAEMDRGGLDVCILSLVGDGIQAIPDVSEAIRIARRANDHLAEQIARNPGRFKGFAALPLQDPQAAAQELTRCIGELGFSGALVNGYSQIGTADRIVFYDLPQYRDFWATVQQLDVPFYLHPRSAPAHLPAYEGHAWLTGSVWGFASETAIHALRLMGSGLFDDYPKLKVILGHLGEGLPCGIWRIDNRVSRTLGAKPRARLPIGHYLRENFYITTSGNFHTPTLTEVMTEVGADRILYSVDYPFEDVAIASDWFDHAAISDADRTRIARSNAERLFRIQVGVNRRTSSLPLVNTAPGSAQRLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 89 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 91 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 93 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 95 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 97 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 99 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 100 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 108 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 109 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 110 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 168 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 169 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 170 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 171 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 172 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 173 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 174 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 175 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 176 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 177 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 178 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 179 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 180 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 181 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 182 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 183 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 184 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 185 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 186 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 187 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 188 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 189 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 190 | 2791355199 | |||
| 191 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 192 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 193 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 194 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 195 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 196 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 197 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 198 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 199 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 200 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 201 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 202 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 203 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 204 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 205 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 206 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 207 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 208 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 209 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 210 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 211 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 212 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 213 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 214 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 215 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 216 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 217 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 218 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.77 |
| Metatranscriptomes | 0.62 |
| Isolates | 12.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.44 |
| Nodule | 10.43 |
| Rhizoplane | 7.67 |
| Rhizosphere | 71.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207652_10238780 | 3300025921 | Bacteria | 1638 |
| 2 | JGI25406J46586_10002267 | 3300003203 | Bacteria | 9066 |
| 3 | JGI25153J46596_10003474 | 3300003215 | Bacteria | 8818 |
| 4 | Ga0070683_100005880 | 3300005329 | Bacteria | 10266 |
| 5 | Ga0070666_10073173 | 3300005335 | Bacteria | 2334 |
| 6 | Ga0070666_10212405 | 3300005335 | Bacteria | 1363 |
| 7 | Ga0070680_100029475 | 3300005336 | Unclassified | 4409 |
| 8 | Ga0070682_100073214 | 3300005337 | Bacteria | 2197 |
| 9 | Ga0070660_100216132 | 3300005339 | Bacteria | 1557 |
| 10 | Ga0070691_10052902 | 3300005341 | Bacteria | 1942 |
| 11 | Ga0070671_100049051 | 3300005355 | Bacteria | 3512 |
| 12 | Ga0070667_100078224 | 3300005367 | Bacteria | 2825 |
| 13 | Ga0070709_10000149 | 3300005434 | Bacteria | 45901 |
| 14 | Ga0070709_10024720 | 3300005434 | Bacteria | 3539 |
| 15 | Ga0070709_10114514 | 3300005434 | Bacteria | 1818 |
| 16 | Ga0070714_100065504 | 3300005435 | Bacteria | 3129 |
| 17 | Ga0070714_100220031 | 3300005435 | Bacteria | 1745 |
| 18 | Ga0070714_100244084 | 3300005435 | Bacteria | 1658 |
| 19 | Ga0070713_100000326 | 3300005436 | Bacteria | 31172 |
| 20 | Ga0070713_100001227 | 3300005436 | Bacteria | 16384 |
| 21 | Ga0070713_100008702 | 3300005436 | Bacteria | 7218 |
| 22 | Ga0070713_100008740 | 3300005436 | Bacteria | 7204 |
| 23 | Ga0070713_100057752 | 3300005436 | Bacteria | 3233 |
| 24 | Ga0070713_100058741 | 3300005436 | Bacteria | 3209 |
| 25 | Ga0070713_100084847 | 3300005436 | Bacteria | 2711 |
| 26 | Ga0070713_100162032 | 3300005436 | Bacteria | 1997 |
| 27 | Ga0070713_100273133 | 3300005436 | Unclassified | 1549 |
| 28 | Ga0070710_10017620 | 3300005437 | Bacteria | 3660 |
| 29 | Ga0070710_10049416 | 3300005437 | Bacteria | 2353 |
| 30 | Ga0070710_10082794 | 3300005437 | Bacteria | 1877 |
| 31 | Ga0070710_10138502 | 3300005437 | Bacteria | 1490 |
| 32 | Ga0070710_10174893 | 3300005437 | Bacteria | 1340 |
| 33 | Ga0070711_100003112 | 3300005439 | Bacteria | 9604 |
| 34 | Ga0070711_100020189 | 3300005439 | Bacteria | 4290 |
| 35 | Ga0070711_100071957 | 3300005439 | Bacteria | 2438 |
| 36 | Ga0070711_100143566 | 3300005439 | Bacteria | 1792 |
| 37 | Ga0070708_100198398 | 3300005445 | Bacteria | 1878 |
| 38 | Ga0070708_100334894 | 3300005445 | Bacteria | 1426 |
| 39 | Ga0070678_100147700 | 3300005456 | Bacteria | 1890 |
| 40 | Ga0070662_100233093 | 3300005457 | Bacteria | 1473 |
| 41 | Ga0070681_10052401 | 3300005458 | Unclassified | 4069 |
| 42 | Ga0070679_100007682 | 3300005530 | Bacteria | 10095 |
| 43 | Ga0070679_100028661 | 3300005530 | Bacteria | 5491 |
| 44 | Ga0070679_100261650 | 3300005530 | Bacteria | 1685 |
| 45 | Ga0070684_100081838 | 3300005535 | Bacteria | 2858 |
| 46 | Ga0068855_100288337 | 3300005563 | Bacteria | 1820 |
| 47 | Ga0070664_100141019 | 3300005564 | Bacteria | 2122 |
| 48 | Ga0070664_100340179 | 3300005564 | Bacteria | 1363 |
| 49 | Ga0068854_100032515 | 3300005578 | Bacteria | 3631 |
| 50 | Ga0068856_100131870 | 3300005614 | Bacteria | 2504 |
| 51 | Ga0068859_100386042 | 3300005617 | Bacteria | 1496 |
| 52 | Ga0081455_10002927 | 3300005937 | Bacteria | 20020 |
| 53 | Ga0081538_10076330 | 3300005981 | Bacteria | 1812 |
| 54 | Ga0081540_1029012 | 3300005983 | Bacteria | 3092 |
| 55 | Ga0081539_10000150 | 3300005985 | Bacteria | 161260 |
| 56 | Ga0070717_10055401 | 3300006028 | Bacteria | 3271 |
| 57 | Ga0070717_10055657 | 3300006028 | Bacteria | 3264 |
| 58 | Ga0070717_10095221 | 3300006028 | Bacteria | 2520 |
| 59 | Ga0070717_10145521 | 3300006028 | Bacteria | 2047 |
| 60 | Ga0075365_10008883 | 3300006038 | Bacteria | 5735 |
| 61 | Ga0075365_10013242 | 3300006038 | Bacteria | 4922 |
| 62 | Ga0075368_10063762 | 3300006042 | Bacteria | 1479 |
| 63 | Ga0070716_100001705 | 3300006173 | Bacteria | 9909 |
| 64 | Ga0070716_100048758 | 3300006173 | Bacteria | 2396 |
| 65 | Ga0070716_100091814 | 3300006173 | Unclassified | 1839 |
| 66 | Ga0070712_100000424 | 3300006175 | Bacteria | 24251 |
| 67 | Ga0070712_100001825 | 3300006175 | Bacteria | 12969 |
| 68 | Ga0070712_100013856 | 3300006175 | Bacteria | 5161 |
| 69 | Ga0070712_100058291 | 3300006175 | Unclassified | 2716 |
| 70 | Ga0070712_100070353 | 3300006175 | Bacteria | 2500 |
| 71 | Ga0070712_100071326 | 3300006175 | Bacteria | 2485 |
| 72 | Ga0070712_100090009 | 3300006175 | Unclassified | 2246 |
| 73 | Ga0070712_100131372 | 3300006175 | Bacteria | 1898 |
| 74 | Ga0097621_100069125 | 3300006237 | Bacteria | 2915 |
| 75 | Ga0097621_100160868 | 3300006237 | Bacteria | 1930 |
| 76 | Ga0097621_100258155 | 3300006237 | Unclassified | 1528 |
| 77 | Ga0068871_100268661 | 3300006358 | Bacteria | 1489 |
| 78 | Ga0075428_100013189 | 3300006844 | Bacteria | 9194 |
| 79 | Ga0075428_100128057 | 3300006844 | Bacteria | 2762 |
| 80 | Ga0075430_100136652 | 3300006846 | Bacteria | 2042 |
| 81 | Ga0075434_100028629 | 3300006871 | Bacteria | 5476 |
| 82 | Ga0075436_100007064 | 3300006914 | Bacteria | 7689 |
| 83 | Ga0097620_100386038 | 3300006931 | Bacteria | 1496 |
| 84 | Ga0099825_1026653 | 3300006941 | Bacteria | 3048 |
| 85 | Ga0075435_100007599 | 3300007076 | Bacteria | 7739 |
| 86 | Ga0075435_100030539 | 3300007076 | Bacteria | 4238 |
| 87 | Ga0105240_10102407 | 3300009093 | Bacteria | 3480 |
| 88 | Ga0105240_10303508 | 3300009093 | Bacteria | 1826 |
| 89 | Ga0105245_10081809 | 3300009098 | Bacteria | 2953 |
| 90 | Ga0105247_10134793 | 3300009101 | Bacteria | 1612 |
| 91 | Ga0114129_10051824 | 3300009147 | Bacteria | 5761 |
| 92 | Ga0114129_10249713 | 3300009147 | Unclassified | 2382 |
| 93 | Ga0114129_10904093 | 3300009147 | Bacteria | 1118 |
| 94 | Ga0105241_10069804 | 3300009174 | Bacteria | 2725 |
| 95 | Ga0105241_10198229 | 3300009174 | Unclassified | 1675 |
| 96 | Ga0105242_10230572 | 3300009176 | Bacteria | 1659 |
| 97 | Ga0105237_10065603 | 3300009545 | Bacteria | 3626 |
| 98 | Ga0105237_10118258 | 3300009545 | Bacteria | 2644 |
| 99 | Ga0105238_10081810 | 3300009551 | Unclassified | 3219 |
| 100 | Ga0105239_10703056 | 3300010375 | Bacteria | 1156 |
| 101 | Ga0105246_10052957 | 3300011119 | Bacteria | 2791 |
| 102 | Ga0105246_10225127 | 3300011119 | Bacteria | 1473 |
| 103 | Ga0157370_10023697 | 3300013104 | Bacteria | 6091 |
| 104 | Ga0157370_10326821 | 3300013104 | Unclassified | 1414 |
| 105 | Ga0157369_10068951 | 3300013105 | Bacteria | 3800 |
| 106 | Ga0163162_10071630 | 3300013306 | Bacteria | 3520 |
| 107 | Ga0163162_10157565 | 3300013306 | Bacteria | 2391 |
| 108 | Ga0163162_10269151 | 3300013306 | Bacteria | 1835 |
| 109 | Ga0157372_10004502 | 3300013307 | Bacteria | 14868 |
| 110 | Ga0157372_10145089 | 3300013307 | Bacteria | 2737 |
| 111 | Ga0157372_10196731 | 3300013307 | Bacteria | 2335 |
| 112 | Ga0157372_10297451 | 3300013307 | Bacteria | 1877 |
| 113 | Ga0157375_10047897 | 3300013308 | Bacteria | 4177 |
| 114 | Ga0157379_10211562 | 3300014968 | Bacteria | 1755 |
| 115 | Ga0157376_10001446 | 3300014969 | Bacteria | 15634 |
| 116 | Ga0157376_10097114 | 3300014969 | Bacteria | 2566 |
| 117 | Ga0157376_10138360 | 3300014969 | Bacteria | 2181 |
| 118 | Ga0213875_10003206 | 3300021388 | Bacteria | 9404 |
| 119 | Ga0207680_10014194 | 3300025903 | Bacteria | 4114 |
| 120 | Ga0207685_10068847 | 3300025905 | Unclassified | 1427 |
| 121 | Ga0207699_10017704 | 3300025906 | Bacteria | 3759 |
| 122 | Ga0207699_10033377 | 3300025906 | Bacteria | 2909 |
| 123 | Ga0207699_10068932 | 3300025906 | Bacteria | 2155 |
| 124 | Ga0207699_10071344 | 3300025906 | Bacteria | 2124 |
| 125 | Ga0207699_10095011 | 3300025906 | Bacteria | 1879 |
| 126 | Ga0207707_10023456 | 3300025912 | Bacteria | 5397 |
| 127 | Ga0207707_10109764 | 3300025912 | Bacteria | 2411 |
| 128 | Ga0207695_10003222 | 3300025913 | Bacteria | 23229 |
| 129 | Ga0207695_10013510 | 3300025913 | Bacteria | 9733 |
| 130 | Ga0207695_10025057 | 3300025913 | Bacteria | 6691 |
| 131 | Ga0207693_10000089 | 3300025915 | Bacteria | 81143 |
| 132 | Ga0207693_10002215 | 3300025915 | Bacteria | 16946 |
| 133 | Ga0207693_10012845 | 3300025915 | Bacteria | 6756 |
| 134 | Ga0207693_10029306 | 3300025915 | Bacteria | 4349 |
| 135 | Ga0207663_10018421 | 3300025916 | Bacteria | 3913 |
| 136 | Ga0207663_10082454 | 3300025916 | Bacteria | 2110 |
| 137 | Ga0207663_10083767 | 3300025916 | Bacteria | 2096 |
| 138 | Ga0207663_10091668 | 3300025916 | Bacteria | 2018 |
| 139 | Ga0207663_10344698 | 3300025916 | Bacteria | 1126 |
| 140 | Ga0207660_10026426 | 3300025917 | Unclassified | 3953 |
| 141 | Ga0207652_10034478 | 3300025921 | Bacteria | 4265 |
| 142 | Ga0207652_10206366 | 3300025921 | Bacteria | 1769 |
| 143 | Ga0207687_10019699 | 3300025927 | Bacteria | 4472 |
| 144 | Ga0207700_10000198 | 3300025928 | Bacteria | 35892 |
| 145 | Ga0207700_10028587 | 3300025928 | Bacteria | 3922 |
| 146 | Ga0207700_10053215 | 3300025928 | Bacteria | 3032 |
| 147 | Ga0207700_10085434 | 3300025928 | Bacteria | 2477 |
| 148 | Ga0207700_10139611 | 3300025928 | Bacteria | 1989 |
| 149 | Ga0207700_10346499 | 3300025928 | Unclassified | 1293 |
| 150 | Ga0207664_10205723 | 3300025929 | Bacteria | 1701 |
| 151 | Ga0207644_10030711 | 3300025931 | Bacteria | 3739 |
| 152 | Ga0207706_10051361 | 3300025933 | Bacteria | 3641 |
| 153 | Ga0207686_10187060 | 3300025934 | Bacteria | 1473 |
| 154 | Ga0207665_10012807 | 3300025939 | Bacteria | 5514 |
| 155 | Ga0207665_10104859 | 3300025939 | Bacteria | 1979 |
| 156 | Ga0207661_10096509 | 3300025944 | Bacteria | 2473 |
| 157 | Ga0207679_10122853 | 3300025945 | Unclassified | 2070 |
| 158 | Ga0207679_10178265 | 3300025945 | Bacteria | 1756 |
| 159 | Ga0207667_10031627 | 3300025949 | Bacteria | 5711 |
| 160 | Ga0207667_10053762 | 3300025949 | Bacteria | 4236 |
| 161 | Ga0207712_10134842 | 3300025961 | Bacteria | 1887 |
| 162 | Ga0207683_10179031 | 3300026121 | Bacteria | 1922 |
| 163 | Ga0307515_10011237 | 3300028794 | Bacteria | 17001 |
| 164 | Ga0265338_10008913 | 3300028800 | Bacteria | 12081 |
| 165 | Ga0265338_10023798 | 3300028800 | Bacteria | 6281 |
| 166 | Ga0265763_1000085 | 3300030763 | Bacteria | 4120 |
| 167 | Ga0265760_10063642 | 3300031090 | Bacteria | 1124 |
| 168 | Ga0265325_10113864 | 3300031241 | Bacteria | 1311 |
| 169 | Ga0265339_10000553 | 3300031249 | Bacteria | 29257 |
| 170 | Ga0307513_10018962 | 3300031456 | Bacteria | 8203 |
| 171 | Ga0307513_10162895 | 3300031456 | Bacteria | 2119 |
| 172 | Ga0265313_10000144 | 3300031595 | Bacteria | 73810 |
| 173 | Ga0373944_0071986 | 3300035089 | Bacteria | 1128 |
| 174 | Ga0373945_0037552 | 3300035116 | Bacteria | 1739 |
| 175 | Ga0373953_0002295 | 3300035117 | Bacteria | 5756 |
| 176 | Ga0373954_0030261 | 3300035118 | Bacteria | 2495 |
| 177 | Ga0373956_0021955 | 3300035119 | Bacteria | 2726 |
| 178 | Ga0373955_0001676 | 3300035172 | Bacteria | 9468 |
| 179 | Ga0373962_0043973 | 3300035242 | Bacteria | 1267 |
| 180 | Ga0373935_0133971 | 3300035692 | Bacteria | 1667 |
| 181 | Ga0373935_0424332 | 3300035692 | Bacteria | 958 |
| 182 | Ga0373933_0003819 | 3300035724 | Bacteria | 8330 |
| 183 | Ga0373937_0049324 | 3300036401 | Bacteria | 3855 |
| 184 | Ga0395900_0006634 | 3300037418 | Bacteria | 12039 |
| 185 | Ga0395898_0003665 | 3300037466 | Bacteria | 17070 |
| 186 | Ga0395905_0025649 | 3300037471 | Bacteria | 5559 |
| 187 | Ga0395901_0007496 | 3300038443 | Bacteria | 11021 |
| 188 | Ga0451789_1239159 | 3300041443 | Bacteria | 1672 |
| 189 | Ga0451853_1074761 | 3300041512 | Bacteria | 1399 |
| 190 | Ga0466966_0010415 | 3300044684 | Bacteria | 6175 |
| 191 | Ga0466961_0057581 | 3300044693 | Bacteria | 2474 |
| 192 | Ga0466964_0024765 | 3300044706 | Bacteria | 2339 |
| 193 | Ga0453684_0269131 | 3300044712 | Bacteria | 1948 |
| 194 | Ga0466959_0150377 | 3300045049 | Bacteria | 1641 |
| 195 | Ga0451576_0046338 | 3300045051 | Bacteria | 4579 |
| 196 | Ga0466958_0133421 | 3300045836 | Bacteria | 1560 |
| 197 | Ga0495651_0002849 | 3300046462 | Bacteria | 13393 |
| 198 | Ga0495653_0004747 | 3300046463 | Bacteria | 11002 |
| 199 | Ga0495580_0007104 | 3300046472 | Bacteria | 9022 |
| 200 | Ga0495580_0010990 | 3300046472 | Bacteria | 7017 |
| 201 | Ga0495580_0047514 | 3300046472 | Unclassified | 3042 |
| 202 | Ga0495582_0006260 | 3300046473 | Bacteria | 6634 |
| 203 | Ga0495582_0110056 | 3300046473 | Unclassified | 1547 |
| 204 | Ga0495664_0008207 | 3300046477 | Bacteria | 5814 |
| 205 | Ga0495608_0010468 | 3300046511 | Bacteria | 6472 |
| 206 | Ga0495618_0011951 | 3300046514 | Bacteria | 5268 |
| 207 | Ga0495628_0006855 | 3300046516 | Bacteria | 9903 |
| 208 | Ga0495630_0043930 | 3300046517 | Bacteria | 3339 |
| 209 | Ga0495630_0419227 | 3300046517 | Bacteria | 1026 |
| 210 | Ga0495663_0025439 | 3300046525 | Bacteria | 1726 |
| 211 | Ga0495666_0047101 | 3300046526 | Bacteria | 2077 |
| 212 | Ga0495652_0051480 | 3300046529 | Bacteria | 3516 |
| 213 | Ga0495587_0001962 | 3300046536 | Bacteria | 13708 |
| 214 | Ga0495645_0012676 | 3300046543 | Bacteria | 5945 |
| 215 | Ga0495634_0020645 | 3300046642 | Bacteria | 4668 |
| 216 | Ga0495635_0013994 | 3300046663 | Bacteria | 5613 |
| 217 | Ga0495657_0006791 | 3300046675 | Bacteria | 8914 |
| 218 | Ga0495599_0097056 | 3300046678 | Bacteria | 1837 |
| 219 | Ga0495623_0098843 | 3300046679 | Bacteria | 1780 |
| 220 | Ga0495658_0035795 | 3300046683 | Unclassified | 2734 |
| 221 | Ga0495658_0154149 | 3300046683 | Bacteria | 1413 |
| 222 | Ga0495613_0006097 | 3300046689 | Bacteria | 9020 |
| 223 | Ga0495670_0013786 | 3300046691 | Bacteria | 3975 |
| 224 | Ga0495600_0001643 | 3300046809 | Bacteria | 12464 |
| 225 | Ga0495581_0011622 | 3300047315 | Bacteria | 5096 |
| 226 | Ga0495604_0014975 | 3300047317 | Bacteria | 6186 |
| 227 | Ga0495674_0061861 | 3300047319 | Bacteria | 3261 |
| 228 | Ga0495680_0009794 | 3300047322 | Bacteria | 8594 |
| 229 | Ga0495675_0001359 | 3300047444 | Bacteria | 14808 |
| 230 | Ga0495593_0032310 | 3300047673 | Bacteria | 2854 |
| 231 | Ga0495602_0027761 | 3300048088 | Bacteria | 5432 |
| 232 | Ga0495602_0082399 | 3300048088 | Bacteria | 2700 |
| 233 | Ga0496100_0024601 | 3300048903 | Bacteria | 3674 |
| 234 | Ga0496101_0165913 | 3300048904 | Bacteria | 1695 |
| 235 | Ga0496102_0039018 | 3300048905 | Bacteria | 4289 |
| 236 | Ga0496103_0047186 | 3300048906 | Bacteria | 2661 |
| 237 | Ga0496104_0018567 | 3300048907 | Bacteria | 6347 |
| 238 | Ga0496104_0179452 | 3300048907 | Bacteria | 2028 |
| 239 | Ga0496105_0006753 | 3300048908 | Bacteria | 8823 |
| 240 | Ga0496105_0026900 | 3300048908 | Bacteria | 4695 |
| 241 | Ga0496105_0159180 | 3300048908 | Bacteria | 1854 |
| 242 | Ga0496106_0290204 | 3300048909 | Bacteria | 1311 |
| 243 | Ga0496106_0297474 | 3300048909 | Bacteria | 1294 |
| 244 | Ga0496107_0038084 | 3300048910 | Bacteria | 3451 |
| 245 | Ga0496107_0091933 | 3300048910 | Bacteria | 2218 |
| 246 | Ga0496107_0157477 | 3300048910 | Bacteria | 1682 |
| 247 | Ga0496108_0054369 | 3300048911 | Bacteria | 3360 |
| 248 | Ga0496109_0008406 | 3300048912 | Bacteria | 8774 |
| 249 | Ga0496110_0032623 | 3300048913 | Bacteria | 4500 |
| 250 | Ga0496110_0238667 | 3300048913 | Bacteria | 1654 |
| 251 | Ga0496110_0276531 | 3300048913 | Unclassified | 1529 |
| 252 | Ga0496114_0006628 | 3300048917 | Bacteria | 9124 |
| 253 | Ga0496115_0018480 | 3300048918 | Bacteria | 5353 |
| 254 | Ga0496115_0037568 | 3300048918 | Bacteria | 3838 |
| 255 | Ga0496115_0041470 | 3300048918 | Bacteria | 3663 |
| 256 | Ga0496115_0198222 | 3300048918 | Bacteria | 1659 |
| 257 | Ga0501047_0043757 | 3300049581 | Bacteria | 4325 |
| 258 | Ga0501048_0148285 | 3300049582 | Bacteria | 1659 |
| 259 | nmdc:mga0yw44_318006_c1 | 3300050492 | Bacteria | 1045 |
| 260 | nmdc:mga05p37_218292_c1 | 3300050507 | Bacteria | 2302 |
| 261 | nmdc:mga05p37_318136_c1 | 3300050507 | Bacteria | 1843 |
| 262 | nmdc:mga0qj67_246806_c1 | 3300050509 | Bacteria | 1448 |
| 263 | nmdc:mga0qj67_91188_c1 | 3300050509 | Bacteria | 2449 |
| 264 | nmdc:mga0n895_375022_c1 | 3300050512 | Bacteria | 1440 |
| 265 | nmdc:mga08x19_293150_c1 | 3300050514 | Bacteria | 1129 |
| 266 | nmdc:mga08x19_3981_c1 | 3300050514 | Bacteria | 8788 |
| 267 | Ga0495595_0010085 | 3300053084 | Bacteria | 3921 |
| 268 | Ga0495619_0005627 | 3300053085 | Bacteria | 7950 |
| 269 | Ga0500643_000245 | 3300053087 | Bacteria | 49888 |
| 270 | Ga0500643_001873 | 3300053087 | Bacteria | 11452 |
| 271 | Ga0500641_0000297 | 3300053096 | Bacteria | 18568 |
| 272 | Ga0500556_0000020 | 3300053104 | Bacteria | 185929 |
| 273 | Ga0500556_0001152 | 3300053104 | Bacteria | 12813 |
| 274 | Ga0500556_0001266 | 3300053104 | Bacteria | 11551 |
| 275 | Ga0500562_005288 | 3300053108 | Bacteria | 3242 |
| 276 | Ga0500621_061604 | 3300053126 | Bacteria | 1516 |
| 277 | Ga0500658_0034324 | 3300053134 | Bacteria | 2001 |
| 278 | Ga0500568_0000012 | 3300053139 | Bacteria | 225711 |
| 279 | Ga0500616_0004336 | 3300053153 | Bacteria | 10156 |
| 280 | Ga0500616_0017080 | 3300053153 | Bacteria | 4120 |
| 281 | Ga0500622_0010318 | 3300053156 | Bacteria | 5132 |
| 282 | Ga0500622_0122386 | 3300053156 | Bacteria | 1260 |
| 283 | Ga0500645_000791 | 3300053730 | Bacteria | 18988 |
| 284 | Ga0500645_000907 | 3300053730 | Bacteria | 17067 |
| 285 | 2510136422 | 2510065019 | Bacteria | 6903379 |
| 286 | 2513568051 | 2513237084 | Bacteria | 7231967 |
| 287 | 2513696788 | 2513237101 | Bacteria | 7952346 |
| 288 | 2514021100 | 2513237162 | Bacteria | 7468464 |
| 289 | 2515108622 | 2515075009 | Bacteria | 7288508 |
| 290 | 2515632210 | 2515154113 | Bacteria | 7807172 |
| 291 | 2515643538 | 2515154114 | Bacteria | 7848616 |
| 292 | 2517041193 | 2516653077 | Bacteria | 7555578 |
| 293 | 2524436136 | 2524023205 | Bacteria | 8918781 |
| 294 | 2528857188 | 2528768022 | Bacteria | 10457665 |
| 295 | 2723846641 | 2721755755 | Bacteria | 8322773 |
| 296 | 2725947828 | 2724679232 | Bacteria | 7646494 |
| 297 | 2745080909 | 2744054633 | Bacteria | 8678936 |
| 298 | 2793076598 | |||
| 299 | 2824672260 | 2824671348 | Bacteria | 8369588 |
| 300 | 2824688857 | 2824687955 | Bacteria | 8360029 |
| 301 | 2838669516 | 2838668709 | Bacteria | 6671819 |
| 302 | 2838701888 | 2838701080 | Bacteria | 6669771 |
| 303 | 2841869351 | 2841864319 | Bacteria | 6742987 |
| 304 | 2842251689 | 2842250916 | Bacteria | 6579627 |
| 305 | 2842344101 | 2842341865 | Bacteria | 7003929 |
| 306 | 2842369234 | 2842363717 | Bacteria | 6844742 |
| 307 | 2842489665 | 2842489311 | Bacteria | 6620893 |
| 308 | 2847937474 | 2847930680 | Bacteria | 9342022 |
| 309 | 2874605666 | 2874604998 | Bacteria | 7834745 |
| 310 | 2879084887 | 2879083081 | Bacteria | 8587928 |
| 311 | 2889041201 | 2889033259 | Bacteria | 9099371 |
| 312 | 2922365843 | 2922361189 | Bacteria | 7436256 |
| 313 | 2922391389 | 2922386360 | Bacteria | 7017218 |
| 314 | 2929621183 | 2929615660 | Bacteria | 9193770 |
| 315 | 2929625986 | 2929624759 | Bacteria | 9339455 |
| 316 | 2933582948 | 2933577622 | Bacteria | 9116884 |
| 317 | 8005467204 | 8005460587 | Bacteria | 7157962 |
| 318 | 8005565529 | 8005563573 | Bacteria | 7153261 |
| 319 | 8006971730 | 8006964411 | Bacteria | 8966052 |
| 320 | 8006987796 | 8006984368 | Bacteria | 9651211 |
| 321 | 8007000793 | 8006994254 | Bacteria | 8309700 |
| 322 | 8018165496 | 8018163183 | Bacteria | 7277977 |
| 323 | 8024485047 | 8024479707 | Bacteria | 6954785 |
| 324 | 8055744955 | 8055742211 | Bacteria | 9226248 |
| 325 | 8056677012 | 8056673599 | Bacteria | 7871253 |
| 326 | 8057878022 | 8057874678 | Bacteria | 7494653 |
| 327 | Ga0207652_10238780 | |||
| 328 | JGI25406J46586_10002267 | |||
| 329 | JGI25153J46596_10003474 | |||
| 330 | Ga0070683_100005880 | |||
| 331 | Ga0070666_10073173 | |||
| 332 | Ga0070666_10212405 | |||
| 333 | Ga0070680_100029475 | |||
| 334 | Ga0070682_100073214 | |||
| 335 | Ga0070660_100216132 | |||
| 336 | Ga0070691_10052902 | |||
| 337 | Ga0070671_100049051 | |||
| 338 | Ga0070667_100078224 | |||
| 339 | Ga0070709_10000149 | |||
| 340 | Ga0070709_10024720 | |||
| 341 | Ga0070709_10114514 | |||
| 342 | Ga0070714_100065504 | |||
| 343 | Ga0070714_100220031 | |||
| 344 | Ga0070714_100244084 | |||
| 345 | Ga0070713_100000326 | |||
| 346 | Ga0070713_100001227 | |||
| 347 | Ga0070713_100008702 | |||
| 348 | Ga0070713_100008740 | |||
| 349 | Ga0070713_100057752 | |||
| 350 | Ga0070713_100058741 | |||
| 351 | Ga0070713_100084847 | |||
| 352 | Ga0070713_100162032 | |||
| 353 | Ga0070713_100273133 | |||
| 354 | Ga0070710_10017620 | |||
| 355 | Ga0070710_10049416 | |||
| 356 | Ga0070710_10082794 | |||
| 357 | Ga0070710_10138502 | |||
| 358 | Ga0070710_10174893 | |||
| 359 | Ga0070711_100003112 | |||
| 360 | Ga0070711_100020189 | |||
| 361 | Ga0070711_100071957 | |||
| 362 | Ga0070711_100143566 | |||
| 363 | Ga0070708_100198398 | |||
| 364 | Ga0070708_100334894 | |||
| 365 | Ga0070678_100147700 | |||
| 366 | Ga0070662_100233093 | |||
| 367 | Ga0070681_10052401 | |||
| 368 | Ga0070679_100007682 | |||
| 369 | Ga0070679_100028661 | |||
| 370 | Ga0070679_100261650 | |||
| 371 | Ga0070684_100081838 | |||
| 372 | Ga0068855_100288337 | |||
| 373 | Ga0070664_100141019 | |||
| 374 | Ga0070664_100340179 | |||
| 375 | Ga0068854_100032515 | |||
| 376 | Ga0068856_100131870 | |||
| 377 | Ga0068859_100386042 | |||
| 378 | Ga0081455_10002927 | |||
| 379 | Ga0081538_10076330 | |||
| 380 | Ga0081540_1029012 | |||
| 381 | Ga0081539_10000150 | |||
| 382 | Ga0070717_10055401 | |||
| 383 | Ga0070717_10055657 | |||
| 384 | Ga0070717_10095221 | |||
| 385 | Ga0070717_10145521 | |||
| 386 | Ga0075365_10008883 | |||
| 387 | Ga0075365_10013242 | |||
| 388 | Ga0075368_10063762 | |||
| 389 | Ga0070716_100001705 | |||
| 390 | Ga0070716_100048758 | |||
| 391 | Ga0070716_100091814 | |||
| 392 | Ga0070712_100000424 | |||
| 393 | Ga0070712_100001825 | |||
| 394 | Ga0070712_100013856 | |||
| 395 | Ga0070712_100058291 | |||
| 396 | Ga0070712_100070353 | |||
| 397 | Ga0070712_100071326 | |||
| 398 | Ga0070712_100090009 | |||
| 399 | Ga0070712_100131372 | |||
| 400 | Ga0097621_100069125 | |||
| 401 | Ga0097621_100160868 | |||
| 402 | Ga0097621_100258155 | |||
| 403 | Ga0068871_100268661 | |||
| 404 | Ga0075428_100013189 | |||
| 405 | Ga0075428_100128057 | |||
| 406 | Ga0075430_100136652 | |||
| 407 | Ga0075434_100028629 | |||
| 408 | Ga0075436_100007064 | |||
| 409 | Ga0097620_100386038 | |||
| 410 | Ga0099825_1026653 | |||
| 411 | Ga0075435_100007599 | |||
| 412 | Ga0075435_100030539 | |||
| 413 | Ga0105240_10102407 | |||
| 414 | Ga0105240_10303508 | |||
| 415 | Ga0105245_10081809 | |||
| 416 | Ga0105247_10134793 | |||
| 417 | Ga0114129_10051824 | |||
| 418 | Ga0114129_10249713 | |||
| 419 | Ga0114129_10904093 | |||
| 420 | Ga0105241_10069804 | |||
| 421 | Ga0105241_10198229 | |||
| 422 | Ga0105242_10230572 | |||
| 423 | Ga0105237_10065603 | |||
| 424 | Ga0105237_10118258 | |||
| 425 | Ga0105238_10081810 | |||
| 426 | Ga0105239_10703056 | |||
| 427 | Ga0105246_10052957 | |||
| 428 | Ga0105246_10225127 | |||
| 429 | Ga0157370_10023697 | |||
| 430 | Ga0157370_10326821 | |||
| 431 | Ga0157369_10068951 | |||
| 432 | Ga0163162_10071630 | |||
| 433 | Ga0163162_10157565 | |||
| 434 | Ga0163162_10269151 | |||
| 435 | Ga0157372_10004502 | |||
| 436 | Ga0157372_10145089 | |||
| 437 | Ga0157372_10196731 | |||
| 438 | Ga0157372_10297451 | |||
| 439 | Ga0157375_10047897 | |||
| 440 | Ga0157379_10211562 | |||
| 441 | Ga0157376_10001446 | |||
| 442 | Ga0157376_10097114 | |||
| 443 | Ga0157376_10138360 | |||
| 444 | Ga0213875_10003206 | |||
| 445 | Ga0207680_10014194 | |||
| 446 | Ga0207685_10068847 | |||
| 447 | Ga0207699_10017704 | |||
| 448 | Ga0207699_10033377 | |||
| 449 | Ga0207699_10068932 | |||
| 450 | Ga0207699_10071344 | |||
| 451 | Ga0207699_10095011 | |||
| 452 | Ga0207707_10023456 | |||
| 453 | Ga0207707_10109764 | |||
| 454 | Ga0207695_10003222 | |||
| 455 | Ga0207695_10013510 | |||
| 456 | Ga0207695_10025057 | |||
| 457 | Ga0207693_10000089 | |||
| 458 | Ga0207693_10002215 | |||
| 459 | Ga0207693_10012845 | |||
| 460 | Ga0207693_10029306 | |||
| 461 | Ga0207663_10018421 | |||
| 462 | Ga0207663_10082454 | |||
| 463 | Ga0207663_10083767 | |||
| 464 | Ga0207663_10091668 | |||
| 465 | Ga0207663_10344698 | |||
| 466 | Ga0207660_10026426 | |||
| 467 | Ga0207652_10034478 | |||
| 468 | Ga0207652_10206366 | |||
| 469 | Ga0207687_10019699 | |||
| 470 | Ga0207700_10000198 | |||
| 471 | Ga0207700_10028587 | |||
| 472 | Ga0207700_10053215 | |||
| 473 | Ga0207700_10085434 | |||
| 474 | Ga0207700_10139611 | |||
| 475 | Ga0207700_10346499 | |||
| 476 | Ga0207664_10205723 | |||
| 477 | Ga0207644_10030711 | |||
| 478 | Ga0207706_10051361 | |||
| 479 | Ga0207686_10187060 | |||
| 480 | Ga0207665_10012807 | |||
| 481 | Ga0207665_10104859 | |||
| 482 | Ga0207661_10096509 | |||
| 483 | Ga0207679_10122853 | |||
| 484 | Ga0207679_10178265 | |||
| 485 | Ga0207667_10031627 | |||
| 486 | Ga0207667_10053762 | |||
| 487 | Ga0207712_10134842 | |||
| 488 | Ga0207683_10179031 | |||
| 489 | Ga0307515_10011237 | |||
| 490 | Ga0265338_10008913 | |||
| 491 | Ga0265338_10023798 | |||
| 492 | Ga0265763_1000085 | |||
| 493 | Ga0265760_10063642 | |||
| 494 | Ga0265325_10113864 | |||
| 495 | Ga0265339_10000553 | |||
| 496 | Ga0307513_10018962 | |||
| 497 | Ga0307513_10162895 | |||
| 498 | Ga0265313_10000144 | |||
| 499 | Ga0373944_0071986 | |||
| 500 | Ga0373945_0037552 | |||
| 501 | Ga0373953_0002295 | |||
| 502 | Ga0373954_0030261 | |||
| 503 | Ga0373956_0021955 | |||
| 504 | Ga0373955_0001676 | |||
| 505 | Ga0373962_0043973 | |||
| 506 | Ga0373935_0133971 | |||
| 507 | Ga0373935_0424332 | |||
| 508 | Ga0373933_0003819 | |||
| 509 | Ga0373937_0049324 | |||
| 510 | Ga0395900_0006634 | |||
| 511 | Ga0395898_0003665 | |||
| 512 | Ga0395905_0025649 | |||
| 513 | Ga0395901_0007496 | |||
| 514 | Ga0451789_1239159 | |||
| 515 | Ga0451853_1074761 | |||
| 516 | Ga0466966_0010415 | |||
| 517 | Ga0466961_0057581 | |||
| 518 | Ga0466964_0024765 | |||
| 519 | Ga0453684_0269131 | |||
| 520 | Ga0466959_0150377 | |||
| 521 | Ga0451576_0046338 | |||
| 522 | Ga0466958_0133421 | |||
| 523 | Ga0495651_0002849 | |||
| 524 | Ga0495653_0004747 | |||
| 525 | Ga0495580_0007104 | |||
| 526 | Ga0495580_0010990 | |||
| 527 | Ga0495580_0047514 | |||
| 528 | Ga0495582_0006260 | |||
| 529 | Ga0495582_0110056 | |||
| 530 | Ga0495664_0008207 | |||
| 531 | Ga0495608_0010468 | |||
| 532 | Ga0495618_0011951 | |||
| 533 | Ga0495628_0006855 | |||
| 534 | Ga0495630_0043930 | |||
| 535 | Ga0495630_0419227 | |||
| 536 | Ga0495663_0025439 | |||
| 537 | Ga0495666_0047101 | |||
| 538 | Ga0495652_0051480 | |||
| 539 | Ga0495587_0001962 | |||
| 540 | Ga0495645_0012676 | |||
| 541 | Ga0495634_0020645 | |||
| 542 | Ga0495635_0013994 | |||
| 543 | Ga0495657_0006791 | |||
| 544 | Ga0495599_0097056 | |||
| 545 | Ga0495623_0098843 | |||
| 546 | Ga0495658_0035795 | |||
| 547 | Ga0495658_0154149 | |||
| 548 | Ga0495613_0006097 | |||
| 549 | Ga0495670_0013786 | |||
| 550 | Ga0495600_0001643 | |||
| 551 | Ga0495581_0011622 | |||
| 552 | Ga0495604_0014975 | |||
| 553 | Ga0495674_0061861 | |||
| 554 | Ga0495680_0009794 | |||
| 555 | Ga0495675_0001359 | |||
| 556 | Ga0495593_0032310 | |||
| 557 | Ga0495602_0027761 | |||
| 558 | Ga0495602_0082399 | |||
| 559 | Ga0496100_0024601 | |||
| 560 | Ga0496101_0165913 | |||
| 561 | Ga0496102_0039018 | |||
| 562 | Ga0496103_0047186 | |||
| 563 | Ga0496104_0018567 | |||
| 564 | Ga0496104_0179452 | |||
| 565 | Ga0496105_0006753 | |||
| 566 | Ga0496105_0026900 | |||
| 567 | Ga0496105_0159180 | |||
| 568 | Ga0496106_0290204 | |||
| 569 | Ga0496106_0297474 | |||
| 570 | Ga0496107_0038084 | |||
| 571 | Ga0496107_0091933 | |||
| 572 | Ga0496107_0157477 | |||
| 573 | Ga0496108_0054369 | |||
| 574 | Ga0496109_0008406 | |||
| 575 | Ga0496110_0032623 | |||
| 576 | Ga0496110_0238667 | |||
| 577 | Ga0496110_0276531 | |||
| 578 | Ga0496114_0006628 | |||
| 579 | Ga0496115_0018480 | |||
| 580 | Ga0496115_0037568 | |||
| 581 | Ga0496115_0041470 | |||
| 582 | Ga0496115_0198222 | |||
| 583 | Ga0501047_0043757 | |||
| 584 | Ga0501048_0148285 | |||
| 585 | nmdc:mga0yw44_318006_c1 | |||
| 586 | nmdc:mga05p37_218292_c1 | |||
| 587 | nmdc:mga05p37_318136_c1 | |||
| 588 | nmdc:mga0qj67_246806_c1 | |||
| 589 | nmdc:mga0qj67_91188_c1 | |||
| 590 | nmdc:mga0n895_375022_c1 | |||
| 591 | nmdc:mga08x19_293150_c1 | |||
| 592 | nmdc:mga08x19_3981_c1 | |||
| 593 | Ga0495595_0010085 | |||
| 594 | Ga0495619_0005627 | |||
| 595 | Ga0500643_000245 | |||
| 596 | Ga0500643_001873 | |||
| 597 | Ga0500641_0000297 | |||
| 598 | Ga0500556_0000020 | |||
| 599 | Ga0500556_0001152 | |||
| 600 | Ga0500556_0001266 | |||
| 601 | Ga0500562_005288 | |||
| 602 | Ga0500621_061604 | |||
| 603 | Ga0500658_0034324 | |||
| 604 | Ga0500568_0000012 | |||
| 605 | Ga0500616_0004336 | |||
| 606 | Ga0500616_0017080 | |||
| 607 | Ga0500622_0010318 | |||
| 608 | Ga0500622_0122386 | |||
| 609 | Ga0500645_000791 | |||
| 610 | Ga0500645_000907 | |||
| 611 | 2510136422 | |||
| 612 | 2513568051 | |||
| 613 | 2513696788 | |||
| 614 | 2514021100 | |||
| 615 | 2515108622 | |||
| 616 | 2515632210 | |||
| 617 | 2515643538 | |||
| 618 | 2517041193 | |||
| 619 | 2524436136 | |||
| 620 | 2528857188 | |||
| 621 | 2723846641 | |||
| 622 | 2725947828 | |||
| 623 | 2745080909 | |||
| 624 | 2793076598 | |||
| 625 | 2824672260 | |||
| 626 | 2824688857 | |||
| 627 | 2838669516 | |||
| 628 | 2838701888 | |||
| 629 | 2841869351 | |||
| 630 | 2842251689 | |||
| 631 | 2842344101 | |||
| 632 | 2842369234 | |||
| 633 | 2842489665 | |||
| 634 | 2847937474 | |||
| 635 | 2874605666 | |||
| 636 | 2879084887 | |||
| 637 | 2889041201 | |||
| 638 | 2922365843 | |||
| 639 | 2922391389 | |||
| 640 | 2929621183 | |||
| 641 | 2929625986 | |||
| 642 | 2933582948 | |||
| 643 | 8005467204 | |||
| 644 | 8005565529 | |||
| 645 | 8006971730 | |||
| 646 | 8006987796 | |||
| 647 | 8007000793 | |||
| 648 | 8018165496 | |||
| 649 | 8024485047 | |||
| 650 | 8055744955 | |||
| 651 | 8056677012 | |||
| 652 | 8057878022 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s4t-assembly1.cif.gz_A | crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666 | 0.9864 | 1 | 329 |
| 2dvx-assembly1.cif.gz_B | crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde | 0.9848 | 1 | 327 |
| 2dvx-assembly1.cif.gz_B | crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde | 0.9818 | 1 | 327 |
| 2dvt-assembly1.cif.gz_C | crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium | 0.9795 | 1 | 329 |
| 2dvu-assembly1.cif.gz_C | crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with 2,6-dihydroxybenzoate | 0.979 | 1 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3s4tH00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9848 | 2 | 327 | 3.20.20.140 |
| 3s4tH00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9817 | 2 | 327 | 3.20.20.140 |
| 4infC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9006 | 2 | 327 | 3.20.20.140 |
| 4infC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8901 | 2 | 327 | 3.20.20.140 |
| 4icmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8858 | 1 | 327 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R3QAU4-F1-model_v4 | 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45) (Picolinate carboxylase) | 0.9984 | 47 | 129 |
GO:0001760
GO:0005829 GO:0016787 GO:0019748 GO:1904985 |
| AF-A0A7C7BT12-F1-model_v4 | Amidohydrolase | 0.9895 | 1 | 136 |
GO:0005829
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A7C7BUL3-F1-model_v4 | Amidohydrolase | 0.9862 | 1 | 237 |
GO:0005829
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A316A7E4-F1-model_v4 | Gamma-resorcylate decarboxylase | 0.9858 | 1 | 329 |
GO:0005829
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A7Y9LMF0-F1-model_v4 | 2,3-dihydroxybenzoate decarboxylase (EC 4.1.1.46) | 0.9836 | 1 | 327 |
GO:0005829
GO:0016787 GO:0019748 GO:0050150 |