F408358

General Info

Members Datasets Scaffolds Average Seq Length
326 218 652 338

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10238780|Ga0207652_102387802
Length 396
Sequence MRTPDDNRITRRGLLQRALGTFASAGGVSLFPSAEPAYRSSRSAEVRPKSAPLRGKIALEEHFVIPETLAASYGAAGGPEFQRRLEDIGSARIAEMDRGGLDVCILSLVGDGIQAIPDVSEAIRIARRANDHLAEQIARNPGRFKGFAALPLQDPQAAAQELTRCIGELGFSGALVNGYSQIGTADRIVFYDLPQYRDFWATVQQLDVPFYLHPRSAPAHLPAYEGHAWLTGSVWGFASETAIHALRLMGSGLFDDYPKLKVILGHLGEGLPCGIWRIDNRVSRTLGAKPRARLPIGHYLRENFYITTSGNFHTPTLTEVMTEVGADRILYSVDYPFEDVAIASDWFDHAAISDADRTRIARSNAERLFRIQVGVNRRTSSLPLVNTAPGSAQRLV

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
178 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
179 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
180 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
181 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
182 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
183 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
184 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
185 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
186 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
187 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
188 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
189 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
190 2791355199
191 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
192 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
193 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
194 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
195 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
196 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
197 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
198 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
199 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
200 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
201 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
202 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
203 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
204 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
205 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
206 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
207 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
208 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
209 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
210 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
211 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
212 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
213 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
214 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
215 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
216 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
217 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
218 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.77
Metatranscriptomes 0.62
Isolates 12.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 10.43
Rhizoplane 7.67
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10238780 3300025921 Bacteria 1638
2 JGI25406J46586_10002267 3300003203 Bacteria 9066
3 JGI25153J46596_10003474 3300003215 Bacteria 8818
4 Ga0070683_100005880 3300005329 Bacteria 10266
5 Ga0070666_10073173 3300005335 Bacteria 2334
6 Ga0070666_10212405 3300005335 Bacteria 1363
7 Ga0070680_100029475 3300005336 Unclassified 4409
8 Ga0070682_100073214 3300005337 Bacteria 2197
9 Ga0070660_100216132 3300005339 Bacteria 1557
10 Ga0070691_10052902 3300005341 Bacteria 1942
11 Ga0070671_100049051 3300005355 Bacteria 3512
12 Ga0070667_100078224 3300005367 Bacteria 2825
13 Ga0070709_10000149 3300005434 Bacteria 45901
14 Ga0070709_10024720 3300005434 Bacteria 3539
15 Ga0070709_10114514 3300005434 Bacteria 1818
16 Ga0070714_100065504 3300005435 Bacteria 3129
17 Ga0070714_100220031 3300005435 Bacteria 1745
18 Ga0070714_100244084 3300005435 Bacteria 1658
19 Ga0070713_100000326 3300005436 Bacteria 31172
20 Ga0070713_100001227 3300005436 Bacteria 16384
21 Ga0070713_100008702 3300005436 Bacteria 7218
22 Ga0070713_100008740 3300005436 Bacteria 7204
23 Ga0070713_100057752 3300005436 Bacteria 3233
24 Ga0070713_100058741 3300005436 Bacteria 3209
25 Ga0070713_100084847 3300005436 Bacteria 2711
26 Ga0070713_100162032 3300005436 Bacteria 1997
27 Ga0070713_100273133 3300005436 Unclassified 1549
28 Ga0070710_10017620 3300005437 Bacteria 3660
29 Ga0070710_10049416 3300005437 Bacteria 2353
30 Ga0070710_10082794 3300005437 Bacteria 1877
31 Ga0070710_10138502 3300005437 Bacteria 1490
32 Ga0070710_10174893 3300005437 Bacteria 1340
33 Ga0070711_100003112 3300005439 Bacteria 9604
34 Ga0070711_100020189 3300005439 Bacteria 4290
35 Ga0070711_100071957 3300005439 Bacteria 2438
36 Ga0070711_100143566 3300005439 Bacteria 1792
37 Ga0070708_100198398 3300005445 Bacteria 1878
38 Ga0070708_100334894 3300005445 Bacteria 1426
39 Ga0070678_100147700 3300005456 Bacteria 1890
40 Ga0070662_100233093 3300005457 Bacteria 1473
41 Ga0070681_10052401 3300005458 Unclassified 4069
42 Ga0070679_100007682 3300005530 Bacteria 10095
43 Ga0070679_100028661 3300005530 Bacteria 5491
44 Ga0070679_100261650 3300005530 Bacteria 1685
45 Ga0070684_100081838 3300005535 Bacteria 2858
46 Ga0068855_100288337 3300005563 Bacteria 1820
47 Ga0070664_100141019 3300005564 Bacteria 2122
48 Ga0070664_100340179 3300005564 Bacteria 1363
49 Ga0068854_100032515 3300005578 Bacteria 3631
50 Ga0068856_100131870 3300005614 Bacteria 2504
51 Ga0068859_100386042 3300005617 Bacteria 1496
52 Ga0081455_10002927 3300005937 Bacteria 20020
53 Ga0081538_10076330 3300005981 Bacteria 1812
54 Ga0081540_1029012 3300005983 Bacteria 3092
55 Ga0081539_10000150 3300005985 Bacteria 161260
56 Ga0070717_10055401 3300006028 Bacteria 3271
57 Ga0070717_10055657 3300006028 Bacteria 3264
58 Ga0070717_10095221 3300006028 Bacteria 2520
59 Ga0070717_10145521 3300006028 Bacteria 2047
60 Ga0075365_10008883 3300006038 Bacteria 5735
61 Ga0075365_10013242 3300006038 Bacteria 4922
62 Ga0075368_10063762 3300006042 Bacteria 1479
63 Ga0070716_100001705 3300006173 Bacteria 9909
64 Ga0070716_100048758 3300006173 Bacteria 2396
65 Ga0070716_100091814 3300006173 Unclassified 1839
66 Ga0070712_100000424 3300006175 Bacteria 24251
67 Ga0070712_100001825 3300006175 Bacteria 12969
68 Ga0070712_100013856 3300006175 Bacteria 5161
69 Ga0070712_100058291 3300006175 Unclassified 2716
70 Ga0070712_100070353 3300006175 Bacteria 2500
71 Ga0070712_100071326 3300006175 Bacteria 2485
72 Ga0070712_100090009 3300006175 Unclassified 2246
73 Ga0070712_100131372 3300006175 Bacteria 1898
74 Ga0097621_100069125 3300006237 Bacteria 2915
75 Ga0097621_100160868 3300006237 Bacteria 1930
76 Ga0097621_100258155 3300006237 Unclassified 1528
77 Ga0068871_100268661 3300006358 Bacteria 1489
78 Ga0075428_100013189 3300006844 Bacteria 9194
79 Ga0075428_100128057 3300006844 Bacteria 2762
80 Ga0075430_100136652 3300006846 Bacteria 2042
81 Ga0075434_100028629 3300006871 Bacteria 5476
82 Ga0075436_100007064 3300006914 Bacteria 7689
83 Ga0097620_100386038 3300006931 Bacteria 1496
84 Ga0099825_1026653 3300006941 Bacteria 3048
85 Ga0075435_100007599 3300007076 Bacteria 7739
86 Ga0075435_100030539 3300007076 Bacteria 4238
87 Ga0105240_10102407 3300009093 Bacteria 3480
88 Ga0105240_10303508 3300009093 Bacteria 1826
89 Ga0105245_10081809 3300009098 Bacteria 2953
90 Ga0105247_10134793 3300009101 Bacteria 1612
91 Ga0114129_10051824 3300009147 Bacteria 5761
92 Ga0114129_10249713 3300009147 Unclassified 2382
93 Ga0114129_10904093 3300009147 Bacteria 1118
94 Ga0105241_10069804 3300009174 Bacteria 2725
95 Ga0105241_10198229 3300009174 Unclassified 1675
96 Ga0105242_10230572 3300009176 Bacteria 1659
97 Ga0105237_10065603 3300009545 Bacteria 3626
98 Ga0105237_10118258 3300009545 Bacteria 2644
99 Ga0105238_10081810 3300009551 Unclassified 3219
100 Ga0105239_10703056 3300010375 Bacteria 1156
101 Ga0105246_10052957 3300011119 Bacteria 2791
102 Ga0105246_10225127 3300011119 Bacteria 1473
103 Ga0157370_10023697 3300013104 Bacteria 6091
104 Ga0157370_10326821 3300013104 Unclassified 1414
105 Ga0157369_10068951 3300013105 Bacteria 3800
106 Ga0163162_10071630 3300013306 Bacteria 3520
107 Ga0163162_10157565 3300013306 Bacteria 2391
108 Ga0163162_10269151 3300013306 Bacteria 1835
109 Ga0157372_10004502 3300013307 Bacteria 14868
110 Ga0157372_10145089 3300013307 Bacteria 2737
111 Ga0157372_10196731 3300013307 Bacteria 2335
112 Ga0157372_10297451 3300013307 Bacteria 1877
113 Ga0157375_10047897 3300013308 Bacteria 4177
114 Ga0157379_10211562 3300014968 Bacteria 1755
115 Ga0157376_10001446 3300014969 Bacteria 15634
116 Ga0157376_10097114 3300014969 Bacteria 2566
117 Ga0157376_10138360 3300014969 Bacteria 2181
118 Ga0213875_10003206 3300021388 Bacteria 9404
119 Ga0207680_10014194 3300025903 Bacteria 4114
120 Ga0207685_10068847 3300025905 Unclassified 1427
121 Ga0207699_10017704 3300025906 Bacteria 3759
122 Ga0207699_10033377 3300025906 Bacteria 2909
123 Ga0207699_10068932 3300025906 Bacteria 2155
124 Ga0207699_10071344 3300025906 Bacteria 2124
125 Ga0207699_10095011 3300025906 Bacteria 1879
126 Ga0207707_10023456 3300025912 Bacteria 5397
127 Ga0207707_10109764 3300025912 Bacteria 2411
128 Ga0207695_10003222 3300025913 Bacteria 23229
129 Ga0207695_10013510 3300025913 Bacteria 9733
130 Ga0207695_10025057 3300025913 Bacteria 6691
131 Ga0207693_10000089 3300025915 Bacteria 81143
132 Ga0207693_10002215 3300025915 Bacteria 16946
133 Ga0207693_10012845 3300025915 Bacteria 6756
134 Ga0207693_10029306 3300025915 Bacteria 4349
135 Ga0207663_10018421 3300025916 Bacteria 3913
136 Ga0207663_10082454 3300025916 Bacteria 2110
137 Ga0207663_10083767 3300025916 Bacteria 2096
138 Ga0207663_10091668 3300025916 Bacteria 2018
139 Ga0207663_10344698 3300025916 Bacteria 1126
140 Ga0207660_10026426 3300025917 Unclassified 3953
141 Ga0207652_10034478 3300025921 Bacteria 4265
142 Ga0207652_10206366 3300025921 Bacteria 1769
143 Ga0207687_10019699 3300025927 Bacteria 4472
144 Ga0207700_10000198 3300025928 Bacteria 35892
145 Ga0207700_10028587 3300025928 Bacteria 3922
146 Ga0207700_10053215 3300025928 Bacteria 3032
147 Ga0207700_10085434 3300025928 Bacteria 2477
148 Ga0207700_10139611 3300025928 Bacteria 1989
149 Ga0207700_10346499 3300025928 Unclassified 1293
150 Ga0207664_10205723 3300025929 Bacteria 1701
151 Ga0207644_10030711 3300025931 Bacteria 3739
152 Ga0207706_10051361 3300025933 Bacteria 3641
153 Ga0207686_10187060 3300025934 Bacteria 1473
154 Ga0207665_10012807 3300025939 Bacteria 5514
155 Ga0207665_10104859 3300025939 Bacteria 1979
156 Ga0207661_10096509 3300025944 Bacteria 2473
157 Ga0207679_10122853 3300025945 Unclassified 2070
158 Ga0207679_10178265 3300025945 Bacteria 1756
159 Ga0207667_10031627 3300025949 Bacteria 5711
160 Ga0207667_10053762 3300025949 Bacteria 4236
161 Ga0207712_10134842 3300025961 Bacteria 1887
162 Ga0207683_10179031 3300026121 Bacteria 1922
163 Ga0307515_10011237 3300028794 Bacteria 17001
164 Ga0265338_10008913 3300028800 Bacteria 12081
165 Ga0265338_10023798 3300028800 Bacteria 6281
166 Ga0265763_1000085 3300030763 Bacteria 4120
167 Ga0265760_10063642 3300031090 Bacteria 1124
168 Ga0265325_10113864 3300031241 Bacteria 1311
169 Ga0265339_10000553 3300031249 Bacteria 29257
170 Ga0307513_10018962 3300031456 Bacteria 8203
171 Ga0307513_10162895 3300031456 Bacteria 2119
172 Ga0265313_10000144 3300031595 Bacteria 73810
173 Ga0373944_0071986 3300035089 Bacteria 1128
174 Ga0373945_0037552 3300035116 Bacteria 1739
175 Ga0373953_0002295 3300035117 Bacteria 5756
176 Ga0373954_0030261 3300035118 Bacteria 2495
177 Ga0373956_0021955 3300035119 Bacteria 2726
178 Ga0373955_0001676 3300035172 Bacteria 9468
179 Ga0373962_0043973 3300035242 Bacteria 1267
180 Ga0373935_0133971 3300035692 Bacteria 1667
181 Ga0373935_0424332 3300035692 Bacteria 958
182 Ga0373933_0003819 3300035724 Bacteria 8330
183 Ga0373937_0049324 3300036401 Bacteria 3855
184 Ga0395900_0006634 3300037418 Bacteria 12039
185 Ga0395898_0003665 3300037466 Bacteria 17070
186 Ga0395905_0025649 3300037471 Bacteria 5559
187 Ga0395901_0007496 3300038443 Bacteria 11021
188 Ga0451789_1239159 3300041443 Bacteria 1672
189 Ga0451853_1074761 3300041512 Bacteria 1399
190 Ga0466966_0010415 3300044684 Bacteria 6175
191 Ga0466961_0057581 3300044693 Bacteria 2474
192 Ga0466964_0024765 3300044706 Bacteria 2339
193 Ga0453684_0269131 3300044712 Bacteria 1948
194 Ga0466959_0150377 3300045049 Bacteria 1641
195 Ga0451576_0046338 3300045051 Bacteria 4579
196 Ga0466958_0133421 3300045836 Bacteria 1560
197 Ga0495651_0002849 3300046462 Bacteria 13393
198 Ga0495653_0004747 3300046463 Bacteria 11002
199 Ga0495580_0007104 3300046472 Bacteria 9022
200 Ga0495580_0010990 3300046472 Bacteria 7017
201 Ga0495580_0047514 3300046472 Unclassified 3042
202 Ga0495582_0006260 3300046473 Bacteria 6634
203 Ga0495582_0110056 3300046473 Unclassified 1547
204 Ga0495664_0008207 3300046477 Bacteria 5814
205 Ga0495608_0010468 3300046511 Bacteria 6472
206 Ga0495618_0011951 3300046514 Bacteria 5268
207 Ga0495628_0006855 3300046516 Bacteria 9903
208 Ga0495630_0043930 3300046517 Bacteria 3339
209 Ga0495630_0419227 3300046517 Bacteria 1026
210 Ga0495663_0025439 3300046525 Bacteria 1726
211 Ga0495666_0047101 3300046526 Bacteria 2077
212 Ga0495652_0051480 3300046529 Bacteria 3516
213 Ga0495587_0001962 3300046536 Bacteria 13708
214 Ga0495645_0012676 3300046543 Bacteria 5945
215 Ga0495634_0020645 3300046642 Bacteria 4668
216 Ga0495635_0013994 3300046663 Bacteria 5613
217 Ga0495657_0006791 3300046675 Bacteria 8914
218 Ga0495599_0097056 3300046678 Bacteria 1837
219 Ga0495623_0098843 3300046679 Bacteria 1780
220 Ga0495658_0035795 3300046683 Unclassified 2734
221 Ga0495658_0154149 3300046683 Bacteria 1413
222 Ga0495613_0006097 3300046689 Bacteria 9020
223 Ga0495670_0013786 3300046691 Bacteria 3975
224 Ga0495600_0001643 3300046809 Bacteria 12464
225 Ga0495581_0011622 3300047315 Bacteria 5096
226 Ga0495604_0014975 3300047317 Bacteria 6186
227 Ga0495674_0061861 3300047319 Bacteria 3261
228 Ga0495680_0009794 3300047322 Bacteria 8594
229 Ga0495675_0001359 3300047444 Bacteria 14808
230 Ga0495593_0032310 3300047673 Bacteria 2854
231 Ga0495602_0027761 3300048088 Bacteria 5432
232 Ga0495602_0082399 3300048088 Bacteria 2700
233 Ga0496100_0024601 3300048903 Bacteria 3674
234 Ga0496101_0165913 3300048904 Bacteria 1695
235 Ga0496102_0039018 3300048905 Bacteria 4289
236 Ga0496103_0047186 3300048906 Bacteria 2661
237 Ga0496104_0018567 3300048907 Bacteria 6347
238 Ga0496104_0179452 3300048907 Bacteria 2028
239 Ga0496105_0006753 3300048908 Bacteria 8823
240 Ga0496105_0026900 3300048908 Bacteria 4695
241 Ga0496105_0159180 3300048908 Bacteria 1854
242 Ga0496106_0290204 3300048909 Bacteria 1311
243 Ga0496106_0297474 3300048909 Bacteria 1294
244 Ga0496107_0038084 3300048910 Bacteria 3451
245 Ga0496107_0091933 3300048910 Bacteria 2218
246 Ga0496107_0157477 3300048910 Bacteria 1682
247 Ga0496108_0054369 3300048911 Bacteria 3360
248 Ga0496109_0008406 3300048912 Bacteria 8774
249 Ga0496110_0032623 3300048913 Bacteria 4500
250 Ga0496110_0238667 3300048913 Bacteria 1654
251 Ga0496110_0276531 3300048913 Unclassified 1529
252 Ga0496114_0006628 3300048917 Bacteria 9124
253 Ga0496115_0018480 3300048918 Bacteria 5353
254 Ga0496115_0037568 3300048918 Bacteria 3838
255 Ga0496115_0041470 3300048918 Bacteria 3663
256 Ga0496115_0198222 3300048918 Bacteria 1659
257 Ga0501047_0043757 3300049581 Bacteria 4325
258 Ga0501048_0148285 3300049582 Bacteria 1659
259 nmdc:mga0yw44_318006_c1 3300050492 Bacteria 1045
260 nmdc:mga05p37_218292_c1 3300050507 Bacteria 2302
261 nmdc:mga05p37_318136_c1 3300050507 Bacteria 1843
262 nmdc:mga0qj67_246806_c1 3300050509 Bacteria 1448
263 nmdc:mga0qj67_91188_c1 3300050509 Bacteria 2449
264 nmdc:mga0n895_375022_c1 3300050512 Bacteria 1440
265 nmdc:mga08x19_293150_c1 3300050514 Bacteria 1129
266 nmdc:mga08x19_3981_c1 3300050514 Bacteria 8788
267 Ga0495595_0010085 3300053084 Bacteria 3921
268 Ga0495619_0005627 3300053085 Bacteria 7950
269 Ga0500643_000245 3300053087 Bacteria 49888
270 Ga0500643_001873 3300053087 Bacteria 11452
271 Ga0500641_0000297 3300053096 Bacteria 18568
272 Ga0500556_0000020 3300053104 Bacteria 185929
273 Ga0500556_0001152 3300053104 Bacteria 12813
274 Ga0500556_0001266 3300053104 Bacteria 11551
275 Ga0500562_005288 3300053108 Bacteria 3242
276 Ga0500621_061604 3300053126 Bacteria 1516
277 Ga0500658_0034324 3300053134 Bacteria 2001
278 Ga0500568_0000012 3300053139 Bacteria 225711
279 Ga0500616_0004336 3300053153 Bacteria 10156
280 Ga0500616_0017080 3300053153 Bacteria 4120
281 Ga0500622_0010318 3300053156 Bacteria 5132
282 Ga0500622_0122386 3300053156 Bacteria 1260
283 Ga0500645_000791 3300053730 Bacteria 18988
284 Ga0500645_000907 3300053730 Bacteria 17067
285 2510136422 2510065019 Bacteria 6903379
286 2513568051 2513237084 Bacteria 7231967
287 2513696788 2513237101 Bacteria 7952346
288 2514021100 2513237162 Bacteria 7468464
289 2515108622 2515075009 Bacteria 7288508
290 2515632210 2515154113 Bacteria 7807172
291 2515643538 2515154114 Bacteria 7848616
292 2517041193 2516653077 Bacteria 7555578
293 2524436136 2524023205 Bacteria 8918781
294 2528857188 2528768022 Bacteria 10457665
295 2723846641 2721755755 Bacteria 8322773
296 2725947828 2724679232 Bacteria 7646494
297 2745080909 2744054633 Bacteria 8678936
298 2793076598
299 2824672260 2824671348 Bacteria 8369588
300 2824688857 2824687955 Bacteria 8360029
301 2838669516 2838668709 Bacteria 6671819
302 2838701888 2838701080 Bacteria 6669771
303 2841869351 2841864319 Bacteria 6742987
304 2842251689 2842250916 Bacteria 6579627
305 2842344101 2842341865 Bacteria 7003929
306 2842369234 2842363717 Bacteria 6844742
307 2842489665 2842489311 Bacteria 6620893
308 2847937474 2847930680 Bacteria 9342022
309 2874605666 2874604998 Bacteria 7834745
310 2879084887 2879083081 Bacteria 8587928
311 2889041201 2889033259 Bacteria 9099371
312 2922365843 2922361189 Bacteria 7436256
313 2922391389 2922386360 Bacteria 7017218
314 2929621183 2929615660 Bacteria 9193770
315 2929625986 2929624759 Bacteria 9339455
316 2933582948 2933577622 Bacteria 9116884
317 8005467204 8005460587 Bacteria 7157962
318 8005565529 8005563573 Bacteria 7153261
319 8006971730 8006964411 Bacteria 8966052
320 8006987796 8006984368 Bacteria 9651211
321 8007000793 8006994254 Bacteria 8309700
322 8018165496 8018163183 Bacteria 7277977
323 8024485047 8024479707 Bacteria 6954785
324 8055744955 8055742211 Bacteria 9226248
325 8056677012 8056673599 Bacteria 7871253
326 8057878022 8057874678 Bacteria 7494653
327 Ga0207652_10238780
328 JGI25406J46586_10002267
329 JGI25153J46596_10003474
330 Ga0070683_100005880
331 Ga0070666_10073173
332 Ga0070666_10212405
333 Ga0070680_100029475
334 Ga0070682_100073214
335 Ga0070660_100216132
336 Ga0070691_10052902
337 Ga0070671_100049051
338 Ga0070667_100078224
339 Ga0070709_10000149
340 Ga0070709_10024720
341 Ga0070709_10114514
342 Ga0070714_100065504
343 Ga0070714_100220031
344 Ga0070714_100244084
345 Ga0070713_100000326
346 Ga0070713_100001227
347 Ga0070713_100008702
348 Ga0070713_100008740
349 Ga0070713_100057752
350 Ga0070713_100058741
351 Ga0070713_100084847
352 Ga0070713_100162032
353 Ga0070713_100273133
354 Ga0070710_10017620
355 Ga0070710_10049416
356 Ga0070710_10082794
357 Ga0070710_10138502
358 Ga0070710_10174893
359 Ga0070711_100003112
360 Ga0070711_100020189
361 Ga0070711_100071957
362 Ga0070711_100143566
363 Ga0070708_100198398
364 Ga0070708_100334894
365 Ga0070678_100147700
366 Ga0070662_100233093
367 Ga0070681_10052401
368 Ga0070679_100007682
369 Ga0070679_100028661
370 Ga0070679_100261650
371 Ga0070684_100081838
372 Ga0068855_100288337
373 Ga0070664_100141019
374 Ga0070664_100340179
375 Ga0068854_100032515
376 Ga0068856_100131870
377 Ga0068859_100386042
378 Ga0081455_10002927
379 Ga0081538_10076330
380 Ga0081540_1029012
381 Ga0081539_10000150
382 Ga0070717_10055401
383 Ga0070717_10055657
384 Ga0070717_10095221
385 Ga0070717_10145521
386 Ga0075365_10008883
387 Ga0075365_10013242
388 Ga0075368_10063762
389 Ga0070716_100001705
390 Ga0070716_100048758
391 Ga0070716_100091814
392 Ga0070712_100000424
393 Ga0070712_100001825
394 Ga0070712_100013856
395 Ga0070712_100058291
396 Ga0070712_100070353
397 Ga0070712_100071326
398 Ga0070712_100090009
399 Ga0070712_100131372
400 Ga0097621_100069125
401 Ga0097621_100160868
402 Ga0097621_100258155
403 Ga0068871_100268661
404 Ga0075428_100013189
405 Ga0075428_100128057
406 Ga0075430_100136652
407 Ga0075434_100028629
408 Ga0075436_100007064
409 Ga0097620_100386038
410 Ga0099825_1026653
411 Ga0075435_100007599
412 Ga0075435_100030539
413 Ga0105240_10102407
414 Ga0105240_10303508
415 Ga0105245_10081809
416 Ga0105247_10134793
417 Ga0114129_10051824
418 Ga0114129_10249713
419 Ga0114129_10904093
420 Ga0105241_10069804
421 Ga0105241_10198229
422 Ga0105242_10230572
423 Ga0105237_10065603
424 Ga0105237_10118258
425 Ga0105238_10081810
426 Ga0105239_10703056
427 Ga0105246_10052957
428 Ga0105246_10225127
429 Ga0157370_10023697
430 Ga0157370_10326821
431 Ga0157369_10068951
432 Ga0163162_10071630
433 Ga0163162_10157565
434 Ga0163162_10269151
435 Ga0157372_10004502
436 Ga0157372_10145089
437 Ga0157372_10196731
438 Ga0157372_10297451
439 Ga0157375_10047897
440 Ga0157379_10211562
441 Ga0157376_10001446
442 Ga0157376_10097114
443 Ga0157376_10138360
444 Ga0213875_10003206
445 Ga0207680_10014194
446 Ga0207685_10068847
447 Ga0207699_10017704
448 Ga0207699_10033377
449 Ga0207699_10068932
450 Ga0207699_10071344
451 Ga0207699_10095011
452 Ga0207707_10023456
453 Ga0207707_10109764
454 Ga0207695_10003222
455 Ga0207695_10013510
456 Ga0207695_10025057
457 Ga0207693_10000089
458 Ga0207693_10002215
459 Ga0207693_10012845
460 Ga0207693_10029306
461 Ga0207663_10018421
462 Ga0207663_10082454
463 Ga0207663_10083767
464 Ga0207663_10091668
465 Ga0207663_10344698
466 Ga0207660_10026426
467 Ga0207652_10034478
468 Ga0207652_10206366
469 Ga0207687_10019699
470 Ga0207700_10000198
471 Ga0207700_10028587
472 Ga0207700_10053215
473 Ga0207700_10085434
474 Ga0207700_10139611
475 Ga0207700_10346499
476 Ga0207664_10205723
477 Ga0207644_10030711
478 Ga0207706_10051361
479 Ga0207686_10187060
480 Ga0207665_10012807
481 Ga0207665_10104859
482 Ga0207661_10096509
483 Ga0207679_10122853
484 Ga0207679_10178265
485 Ga0207667_10031627
486 Ga0207667_10053762
487 Ga0207712_10134842
488 Ga0207683_10179031
489 Ga0307515_10011237
490 Ga0265338_10008913
491 Ga0265338_10023798
492 Ga0265763_1000085
493 Ga0265760_10063642
494 Ga0265325_10113864
495 Ga0265339_10000553
496 Ga0307513_10018962
497 Ga0307513_10162895
498 Ga0265313_10000144
499 Ga0373944_0071986
500 Ga0373945_0037552
501 Ga0373953_0002295
502 Ga0373954_0030261
503 Ga0373956_0021955
504 Ga0373955_0001676
505 Ga0373962_0043973
506 Ga0373935_0133971
507 Ga0373935_0424332
508 Ga0373933_0003819
509 Ga0373937_0049324
510 Ga0395900_0006634
511 Ga0395898_0003665
512 Ga0395905_0025649
513 Ga0395901_0007496
514 Ga0451789_1239159
515 Ga0451853_1074761
516 Ga0466966_0010415
517 Ga0466961_0057581
518 Ga0466964_0024765
519 Ga0453684_0269131
520 Ga0466959_0150377
521 Ga0451576_0046338
522 Ga0466958_0133421
523 Ga0495651_0002849
524 Ga0495653_0004747
525 Ga0495580_0007104
526 Ga0495580_0010990
527 Ga0495580_0047514
528 Ga0495582_0006260
529 Ga0495582_0110056
530 Ga0495664_0008207
531 Ga0495608_0010468
532 Ga0495618_0011951
533 Ga0495628_0006855
534 Ga0495630_0043930
535 Ga0495630_0419227
536 Ga0495663_0025439
537 Ga0495666_0047101
538 Ga0495652_0051480
539 Ga0495587_0001962
540 Ga0495645_0012676
541 Ga0495634_0020645
542 Ga0495635_0013994
543 Ga0495657_0006791
544 Ga0495599_0097056
545 Ga0495623_0098843
546 Ga0495658_0035795
547 Ga0495658_0154149
548 Ga0495613_0006097
549 Ga0495670_0013786
550 Ga0495600_0001643
551 Ga0495581_0011622
552 Ga0495604_0014975
553 Ga0495674_0061861
554 Ga0495680_0009794
555 Ga0495675_0001359
556 Ga0495593_0032310
557 Ga0495602_0027761
558 Ga0495602_0082399
559 Ga0496100_0024601
560 Ga0496101_0165913
561 Ga0496102_0039018
562 Ga0496103_0047186
563 Ga0496104_0018567
564 Ga0496104_0179452
565 Ga0496105_0006753
566 Ga0496105_0026900
567 Ga0496105_0159180
568 Ga0496106_0290204
569 Ga0496106_0297474
570 Ga0496107_0038084
571 Ga0496107_0091933
572 Ga0496107_0157477
573 Ga0496108_0054369
574 Ga0496109_0008406
575 Ga0496110_0032623
576 Ga0496110_0238667
577 Ga0496110_0276531
578 Ga0496114_0006628
579 Ga0496115_0018480
580 Ga0496115_0037568
581 Ga0496115_0041470
582 Ga0496115_0198222
583 Ga0501047_0043757
584 Ga0501048_0148285
585 nmdc:mga0yw44_318006_c1
586 nmdc:mga05p37_218292_c1
587 nmdc:mga05p37_318136_c1
588 nmdc:mga0qj67_246806_c1
589 nmdc:mga0qj67_91188_c1
590 nmdc:mga0n895_375022_c1
591 nmdc:mga08x19_293150_c1
592 nmdc:mga08x19_3981_c1
593 Ga0495595_0010085
594 Ga0495619_0005627
595 Ga0500643_000245
596 Ga0500643_001873
597 Ga0500641_0000297
598 Ga0500556_0000020
599 Ga0500556_0001152
600 Ga0500556_0001266
601 Ga0500562_005288
602 Ga0500621_061604
603 Ga0500658_0034324
604 Ga0500568_0000012
605 Ga0500616_0004336
606 Ga0500616_0017080
607 Ga0500622_0010318
608 Ga0500622_0122386
609 Ga0500645_000791
610 Ga0500645_000907
611 2510136422
612 2513568051
613 2513696788
614 2514021100
615 2515108622
616 2515632210
617 2515643538
618 2517041193
619 2524436136
620 2528857188
621 2723846641
622 2725947828
623 2745080909
624 2793076598
625 2824672260
626 2824688857
627 2838669516
628 2838701888
629 2841869351
630 2842251689
631 2842344101
632 2842369234
633 2842489665
634 2847937474
635 2874605666
636 2879084887
637 2889041201
638 2922365843
639 2922391389
640 2929621183
641 2929625986
642 2933582948
643 8005467204
644 8005565529
645 8006971730
646 8006987796
647 8007000793
648 8018165496
649 8024485047
650 8055744955
651 8056677012
652 8057878022

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

62

371

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s4t-assembly1.cif.gz_A crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666 0.9864 1 329
2dvx-assembly1.cif.gz_B crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde 0.9848 1 327
2dvx-assembly1.cif.gz_B crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde 0.9818 1 327
2dvt-assembly1.cif.gz_C crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium 0.9795 1 329
2dvu-assembly1.cif.gz_C crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with 2,6-dihydroxybenzoate 0.979 1 329
ID Description Score Start End Superfamily
3s4tH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9848 2 327 3.20.20.140
3s4tH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9817 2 327 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9006 2 327 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8901 2 327 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8858 1 327 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A0R3QAU4-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45) (Picolinate carboxylase) 0.9984 47 129 GO:0001760
GO:0005829
GO:0016787
GO:0019748
GO:1904985
AF-A0A7C7BT12-F1-model_v4 Amidohydrolase 0.9895 1 136 GO:0005829
GO:0016787
GO:0016831
GO:0019748
AF-A0A7C7BUL3-F1-model_v4 Amidohydrolase 0.9862 1 237 GO:0005829
GO:0016787
GO:0016831
GO:0019748
AF-A0A316A7E4-F1-model_v4 Gamma-resorcylate decarboxylase 0.9858 1 329 GO:0005829
GO:0016787
GO:0016831
GO:0019748
AF-A0A7Y9LMF0-F1-model_v4 2,3-dihydroxybenzoate decarboxylase (EC 4.1.1.46) 0.9836 1 327 GO:0005829
GO:0016787
GO:0019748
GO:0050150

Map