F408356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 186 | 326 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300025919|Ga0207657_10039459|Ga0207657_100394594 |
| Length | 328 |
| Sequence | VELDRGHARSVLSTLPGVGLAHWDDVDERRAAKGEMDAVWQMLGRAAGTAGVGVNRVRVASGKLPTPPHSHGASEEIYFVLAGSGLAWQDGDVHEIRPRDCIIQTPDHFEHTFVAGPDGLEYLVYGTRHPTEIGWLPRSRAIRIGWPWVEGRDDDPWDIEAAGPPLEVGDPKPRPENIRNVDEVELQSEGNQTWAGFEGSELAGFAWERLAPGKMGSVPHCHSEEEEIFVVLEGSATLHLWPSPRRAATGAQREQHELRPGHVVSRPPGSGTPHHFVAGEEGCTMLVYGTRKPNDMCFYPRSNKIAWRGLGVIGRVEHLDYWDGEERE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 81 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 82 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 86 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 88 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 89 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 91 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 92 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 98 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 99 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 100 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 101 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 102 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 103 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 104 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 105 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 1.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.44 |
| Rhizosphere | 92.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10033596 | 3300003323 | Bacteria | 1247 |
| 2 | Ga0070683_100134254 | 3300005329 | Bacteria | 2343 |
| 3 | Ga0068869_100048664 | 3300005334 | Bacteria | 3067 |
| 4 | Ga0070682_100164081 | 3300005337 | Unclassified | 1537 |
| 5 | Ga0070682_100205561 | 3300005337 | Unclassified | 1392 |
| 6 | Ga0070660_100001270 | 3300005339 | Bacteria | 17212 |
| 7 | Ga0070660_100162814 | 3300005339 | Bacteria | 1798 |
| 8 | Ga0070660_100285173 | 3300005339 | Bacteria | 1352 |
| 9 | Ga0070661_100012084 | 3300005344 | Bacteria | 6035 |
| 10 | Ga0070661_100176625 | 3300005344 | Bacteria | 1623 |
| 11 | Ga0070675_100237803 | 3300005354 | Bacteria | 1591 |
| 12 | Ga0070671_100128596 | 3300005355 | Bacteria | 2133 |
| 13 | Ga0070671_100230773 | 3300005355 | Bacteria | 1571 |
| 14 | Ga0070674_100266099 | 3300005356 | Bacteria | 1353 |
| 15 | Ga0070709_10068220 | 3300005434 | Bacteria | 2286 |
| 16 | Ga0070709_10174648 | 3300005434 | Bacteria | 1504 |
| 17 | Ga0070713_100384265 | 3300005436 | Bacteria | 1308 |
| 18 | Ga0070710_10249350 | 3300005437 | Unclassified | 1141 |
| 19 | Ga0070711_100000341 | 3300005439 | Bacteria | 23948 |
| 20 | Ga0070678_100178516 | 3300005456 | Bacteria | 1736 |
| 21 | Ga0070681_10000752 | 3300005458 | Bacteria | 26939 |
| 22 | Ga0070681_10282172 | 3300005458 | Bacteria | 1571 |
| 23 | Ga0068867_100074557 | 3300005459 | Bacteria | 2544 |
| 24 | Ga0070698_100022476 | 3300005471 | Bacteria | 6597 |
| 25 | Ga0070679_100071755 | 3300005530 | Bacteria | 3454 |
| 26 | Ga0070679_100089122 | 3300005530 | Bacteria | 3072 |
| 27 | Ga0070679_100215094 | 3300005530 | Bacteria | 1884 |
| 28 | Ga0068853_100173014 | 3300005539 | Unclassified | 1954 |
| 29 | Ga0070665_100090473 | 3300005548 | Bacteria | 3066 |
| 30 | Ga0068855_100022559 | 3300005563 | Bacteria | 7543 |
| 31 | Ga0068855_100063551 | 3300005563 | Bacteria | 4308 |
| 32 | Ga0068855_100067800 | 3300005563 | Bacteria | 4155 |
| 33 | Ga0068855_100337202 | 3300005563 | Bacteria | 1663 |
| 34 | Ga0068857_100071236 | 3300005577 | Bacteria | 3097 |
| 35 | Ga0068857_100187268 | 3300005577 | Bacteria | 1884 |
| 36 | Ga0068854_100508981 | 3300005578 | Unclassified | 1015 |
| 37 | Ga0068856_100025658 | 3300005614 | Bacteria | 5746 |
| 38 | Ga0068852_100067985 | 3300005616 | Bacteria | 3116 |
| 39 | Ga0068866_10034965 | 3300005718 | Bacteria | 2451 |
| 40 | Ga0068866_10143358 | 3300005718 | Bacteria | 1374 |
| 41 | Ga0081455_10044729 | 3300005937 | Bacteria | 3858 |
| 42 | Ga0070717_10001661 | 3300006028 | Bacteria | 15459 |
| 43 | Ga0075432_10004801 | 3300006058 | Bacteria | 4598 |
| 44 | Ga0070712_100005578 | 3300006175 | Bacteria | 7784 |
| 45 | Ga0070712_100020446 | 3300006175 | Bacteria | 4332 |
| 46 | Ga0070712_100036799 | 3300006175 | Bacteria | 3333 |
| 47 | Ga0068871_100425160 | 3300006358 | Bacteria | 1187 |
| 48 | Ga0075428_100408039 | 3300006844 | Bacteria | 1456 |
| 49 | Ga0075433_10052695 | 3300006852 | Bacteria | 3546 |
| 50 | Ga0075436_100015350 | 3300006914 | Bacteria | 5247 |
| 51 | Ga0075436_100042366 | 3300006914 | Bacteria | 3140 |
| 52 | Ga0075435_100024952 | 3300007076 | Bacteria | 4648 |
| 53 | Ga0105240_10223689 | 3300009093 | Bacteria | 2191 |
| 54 | Ga0111539_10012304 | 3300009094 | Bacteria | 10723 |
| 55 | Ga0111539_10747396 | 3300009094 | Bacteria | 1138 |
| 56 | Ga0105245_10039318 | 3300009098 | Bacteria | 4210 |
| 57 | Ga0105245_10045592 | 3300009098 | Bacteria | 3916 |
| 58 | Ga0105245_10367798 | 3300009098 | Bacteria | 1429 |
| 59 | Ga0105247_10044176 | 3300009101 | Bacteria | 2732 |
| 60 | Ga0105242_10012764 | 3300009176 | Bacteria | 6470 |
| 61 | Ga0105237_10079980 | 3300009545 | Bacteria | 3259 |
| 62 | Ga0105238_10008930 | 3300009551 | Bacteria | 10031 |
| 63 | Ga0105238_10074948 | 3300009551 | Bacteria | 3376 |
| 64 | Ga0105238_10572422 | 3300009551 | Bacteria | 1135 |
| 65 | Ga0157370_10040724 | 3300013104 | Bacteria | 4485 |
| 66 | Ga0157374_10182977 | 3300013296 | Bacteria | 2048 |
| 67 | Ga0157372_10073346 | 3300013307 | Bacteria | 3858 |
| 68 | Ga0157372_10504021 | 3300013307 | Bacteria | 1411 |
| 69 | Ga0182008_10061673 | 3300014497 | Bacteria | 1848 |
| 70 | Ga0157379_10533771 | 3300014968 | Unclassified | 1090 |
| 71 | Ga0197907_10614961 | 3300020069 | Bacteria | 1681 |
| 72 | Ga0206354_10337584 | 3300020081 | Bacteria | 1315 |
| 73 | Ga0206354_11199835 | 3300020081 | Bacteria | 1302 |
| 74 | Ga0206353_11851681 | 3300020082 | Unclassified | 1646 |
| 75 | Ga0224712_10156946 | 3300022467 | Unclassified | 1012 |
| 76 | Ga0207692_10190307 | 3300025898 | Unclassified | 1201 |
| 77 | Ga0207705_10106116 | 3300025909 | Bacteria | 2071 |
| 78 | Ga0207705_10134984 | 3300025909 | Bacteria | 1839 |
| 79 | Ga0207707_10005535 | 3300025912 | Bacteria | 11046 |
| 80 | Ga0207707_10029462 | 3300025912 | Bacteria | 4799 |
| 81 | Ga0207707_10102199 | 3300025912 | Bacteria | 2505 |
| 82 | Ga0207695_10188941 | 3300025913 | Bacteria | 1978 |
| 83 | Ga0207693_10002081 | 3300025915 | Bacteria | 17492 |
| 84 | Ga0207693_10084879 | 3300025915 | Bacteria | 2481 |
| 85 | Ga0207693_10218046 | 3300025915 | Bacteria | 1499 |
| 86 | Ga0207663_10021886 | 3300025916 | Bacteria | 3647 |
| 87 | Ga0207660_10067607 | 3300025917 | Bacteria | 2589 |
| 88 | Ga0207660_10146918 | 3300025917 | Bacteria | 1808 |
| 89 | Ga0207657_10000651 | 3300025919 | Bacteria | 36939 |
| 90 | Ga0207657_10000941 | 3300025919 | Bacteria | 30830 |
| 91 | Ga0207657_10039459 | 3300025919 | Bacteria | 4195 |
| 92 | Ga0207649_10055725 | 3300025920 | Bacteria | 2466 |
| 93 | Ga0207652_10078115 | 3300025921 | Bacteria | 2889 |
| 94 | Ga0207694_10073178 | 3300025924 | Bacteria | 2680 |
| 95 | Ga0207694_10301263 | 3300025924 | Bacteria | 1320 |
| 96 | Ga0207659_10193982 | 3300025926 | Bacteria | 1618 |
| 97 | Ga0207664_10053637 | 3300025929 | Bacteria | 3193 |
| 98 | Ga0207644_10070240 | 3300025931 | Bacteria | 2559 |
| 99 | Ga0207686_10049821 | 3300025934 | Bacteria | 2602 |
| 100 | Ga0207709_10035839 | 3300025935 | Bacteria | 2937 |
| 101 | Ga0207665_10000060 | 3300025939 | Bacteria | 70443 |
| 102 | Ga0207665_10183980 | 3300025939 | Bacteria | 1515 |
| 103 | Ga0207661_10023632 | 3300025944 | Bacteria | 4647 |
| 104 | Ga0207667_10178754 | 3300025949 | Bacteria | 2179 |
| 105 | Ga0207639_10038965 | 3300026041 | Bacteria | 3539 |
| 106 | Ga0207639_10042864 | 3300026041 | Bacteria | 3394 |
| 107 | Ga0207674_10292870 | 3300026116 | Unclassified | 1576 |
| 108 | Ga0207683_10206689 | 3300026121 | Bacteria | 1786 |
| 109 | Ga0207698_10410035 | 3300026142 | Bacteria | 1297 |
| 110 | Ga0207428_10007861 | 3300027907 | Bacteria | 9699 |
| 111 | Ga0265319_1027790 | 3300028563 | Bacteria | 2001 |
| 112 | Ga0265318_10008313 | 3300028577 | Bacteria | 4627 |
| 113 | Ga0265338_10078363 | 3300028800 | Bacteria | 2787 |
| 114 | Ga0265338_10281214 | 3300028800 | Unclassified | 1216 |
| 115 | Ga0265332_10012919 | 3300031238 | Bacteria | 3702 |
| 116 | Ga0265328_10002677 | 3300031239 | Bacteria | 7968 |
| 117 | Ga0265325_10001119 | 3300031241 | Bacteria | 19210 |
| 118 | Ga0265329_10024137 | 3300031242 | Bacteria | 2019 |
| 119 | Ga0265340_10051754 | 3300031247 | Bacteria | 1987 |
| 120 | Ga0265327_10009733 | 3300031251 | Bacteria | 6879 |
| 121 | Ga0265327_10057064 | 3300031251 | Unclassified | 2010 |
| 122 | Ga0265313_10063482 | 3300031595 | Bacteria | 1721 |
| 123 | Ga0265342_10087533 | 3300031712 | Bacteria | 1789 |
| 124 | Ga0307411_10380297 | 3300032005 | Bacteria | 1161 |
| 125 | Ga0373926_0092265 | 3300035083 | Bacteria | 1127 |
| 126 | Ga0373953_0076615 | 3300035117 | Bacteria | 1386 |
| 127 | Ga0373927_0159768 | 3300035695 | Bacteria | 1476 |
| 128 | Ga0373933_0133417 | 3300035724 | Bacteria | 1563 |
| 129 | Ga0373937_0000494 | 3300036401 | Bacteria | 35944 |
| 130 | Ga0373937_0114468 | 3300036401 | Bacteria | 2511 |
| 131 | Ga0373937_0127519 | 3300036401 | Bacteria | 2375 |
| 132 | Ga0395899_0021226 | 3300037312 | Bacteria | 4925 |
| 133 | Ga0395900_0007485 | 3300037418 | Bacteria | 11277 |
| 134 | Ga0395900_0237546 | 3300037418 | Bacteria | 1829 |
| 135 | Ga0395900_0241033 | 3300037418 | Bacteria | 1814 |
| 136 | Ga0395900_0310160 | 3300037418 | Bacteria | 1561 |
| 137 | Ga0395900_0420040 | 3300037418 | Bacteria | 1298 |
| 138 | Ga0395898_0001584 | 3300037466 | Bacteria | 31082 |
| 139 | Ga0395898_0216304 | 3300037466 | Bacteria | 1827 |
| 140 | Ga0395898_0236426 | 3300037466 | Bacteria | 1742 |
| 141 | Ga0395898_0499432 | 3300037466 | Bacteria | 1157 |
| 142 | Ga0395905_0087035 | 3300037471 | Bacteria | 2929 |
| 143 | Ga0395905_0163896 | 3300037471 | Bacteria | 2089 |
| 144 | Ga0395905_0235772 | 3300037471 | Bacteria | 1710 |
| 145 | Ga0395901_0001414 | 3300038443 | Bacteria | 25054 |
| 146 | Ga0395901_0059084 | 3300038443 | Bacteria | 3989 |
| 147 | Ga0395901_0099202 | 3300038443 | Bacteria | 3054 |
| 148 | Ga0451807_1075421 | 3300041486 | Bacteria | 1268 |
| 149 | Ga0451835_0535582 | 3300041492 | Bacteria | 2231 |
| 150 | Ga0451839_0782197 | 3300041496 | Bacteria | 1867 |
| 151 | Ga0451849_0829885 | 3300041505 | Bacteria | 1288 |
| 152 | Ga0451855_0171249 | 3300041511 | Bacteria | 1681 |
| 153 | Ga0439446_0000667 | 3300042156 | Bacteria | 7132 |
| 154 | Ga0439434_0002292 | 3300042435 | Bacteria | 5563 |
| 155 | Ga0466965_0007732 | 3300044683 | Bacteria | 4946 |
| 156 | Ga0466966_0014862 | 3300044684 | Bacteria | 5150 |
| 157 | Ga0466966_0052451 | 3300044684 | Bacteria | 2590 |
| 158 | Ga0466966_0096112 | 3300044684 | Bacteria | 1835 |
| 159 | Ga0466966_0113821 | 3300044684 | Bacteria | 1666 |
| 160 | Ga0466966_0115709 | 3300044684 | Bacteria | 1650 |
| 161 | Ga0466966_0126966 | 3300044684 | Bacteria | 1563 |
| 162 | Ga0466961_0004049 | 3300044693 | Bacteria | 9184 |
| 163 | Ga0466961_0011374 | 3300044693 | Bacteria | 5691 |
| 164 | Ga0466961_0075801 | 3300044693 | Bacteria | 2132 |
| 165 | Ga0466961_0099940 | 3300044693 | Bacteria | 1828 |
| 166 | Ga0466963_0000686 | 3300044694 | Bacteria | 16445 |
| 167 | Ga0466963_0003398 | 3300044694 | Bacteria | 9103 |
| 168 | Ga0466963_0012968 | 3300044694 | Bacteria | 5109 |
| 169 | Ga0466963_0015662 | 3300044694 | Bacteria | 4703 |
| 170 | Ga0466963_0027991 | 3300044694 | Bacteria | 3614 |
| 171 | Ga0466963_0036275 | 3300044694 | Bacteria | 3214 |
| 172 | Ga0466963_0046820 | 3300044694 | Bacteria | 2853 |
| 173 | Ga0466963_0047997 | 3300044694 | Bacteria | 2819 |
| 174 | Ga0466963_0048030 | 3300044694 | Bacteria | 2818 |
| 175 | Ga0466963_0058417 | 3300044694 | Bacteria | 2571 |
| 176 | Ga0466963_0146710 | 3300044694 | Bacteria | 1637 |
| 177 | Ga0466963_0188907 | 3300044694 | Bacteria | 1439 |
| 178 | Ga0466964_0007188 | 3300044706 | Bacteria | 4164 |
| 179 | Ga0466964_0014952 | 3300044706 | Bacteria | 2955 |
| 180 | Ga0466964_0116078 | 3300044706 | Bacteria | 1200 |
| 181 | Ga0466971_0004642 | 3300044719 | Bacteria | 5935 |
| 182 | Ga0466971_0007945 | 3300044719 | Bacteria | 4622 |
| 183 | Ga0466968_0025554 | 3300044735 | Bacteria | 2418 |
| 184 | Ga0466970_0001717 | 3300044765 | Bacteria | 10542 |
| 185 | Ga0466970_0055411 | 3300044765 | Bacteria | 2117 |
| 186 | Ga0466970_0085727 | 3300044765 | Unclassified | 1706 |
| 187 | Ga0466957_0001760 | 3300044842 | Bacteria | 11390 |
| 188 | Ga0466957_0009837 | 3300044842 | Bacteria | 5467 |
| 189 | Ga0466957_0015472 | 3300044842 | Bacteria | 4456 |
| 190 | Ga0466957_0016220 | 3300044842 | Bacteria | 4356 |
| 191 | Ga0466957_0052228 | 3300044842 | Bacteria | 2488 |
| 192 | Ga0466957_0254072 | 3300044842 | Bacteria | 1169 |
| 193 | Ga0466957_0404813 | 3300044842 | Unclassified | 934 |
| 194 | Ga0466960_0198977 | 3300044901 | Unclassified | 1094 |
| 195 | Ga0466959_0001127 | 3300045049 | Bacteria | 16111 |
| 196 | Ga0466959_0020641 | 3300045049 | Bacteria | 4854 |
| 197 | Ga0466959_0041244 | 3300045049 | Bacteria | 3408 |
| 198 | Ga0466959_0047468 | 3300045049 | Bacteria | 3158 |
| 199 | Ga0466958_0003210 | 3300045836 | Bacteria | 8443 |
| 200 | Ga0466958_0006409 | 3300045836 | Bacteria | 6402 |
| 201 | Ga0466958_0026201 | 3300045836 | Bacteria | 3444 |
| 202 | Ga0466958_0027760 | 3300045836 | Bacteria | 3350 |
| 203 | Ga0466958_0033578 | 3300045836 | Bacteria | 3057 |
| 204 | Ga0466967_0000367 | 3300045976 | Bacteria | 20993 |
| 205 | Ga0466967_0007395 | 3300045976 | Bacteria | 7917 |
| 206 | Ga0466967_0009473 | 3300045976 | Bacteria | 7228 |
| 207 | Ga0466967_0010182 | 3300045976 | Bacteria | 7032 |
| 208 | Ga0466967_0010856 | 3300045976 | Bacteria | 6861 |
| 209 | Ga0466967_0017320 | 3300045976 | Bacteria | 5715 |
| 210 | Ga0466967_0018787 | 3300045976 | Bacteria | 5537 |
| 211 | Ga0466967_0033765 | 3300045976 | Bacteria | 4335 |
| 212 | Ga0466967_0051582 | 3300045976 | Bacteria | 3606 |
| 213 | Ga0466967_0071080 | 3300045976 | Bacteria | 3115 |
| 214 | Ga0466967_0091361 | 3300045976 | Bacteria | 2767 |
| 215 | Ga0466967_0111743 | 3300045976 | Bacteria | 2511 |
| 216 | Ga0466967_0130152 | 3300045976 | Bacteria | 2335 |
| 217 | Ga0466967_0197644 | 3300045976 | Bacteria | 1903 |
| 218 | Ga0495592_0000123 | 3300046454 | Bacteria | 68503 |
| 219 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 220 | Ga0495653_0006797 | 3300046463 | Bacteria | 9395 |
| 221 | Ga0495653_0190266 | 3300046463 | Bacteria | 1401 |
| 222 | Ga0495580_0047205 | 3300046472 | Bacteria | 3053 |
| 223 | Ga0495664_0214840 | 3300046477 | Bacteria | 1164 |
| 224 | Ga0495608_0001396 | 3300046511 | Bacteria | 17181 |
| 225 | Ga0495608_0019502 | 3300046511 | Bacteria | 4666 |
| 226 | Ga0495608_0207250 | 3300046511 | Bacteria | 1233 |
| 227 | Ga0495618_0002333 | 3300046514 | Bacteria | 12257 |
| 228 | Ga0495618_0016885 | 3300046514 | Bacteria | 4472 |
| 229 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 230 | Ga0495628_0061669 | 3300046516 | Bacteria | 2941 |
| 231 | Ga0495628_0063746 | 3300046516 | Bacteria | 2887 |
| 232 | Ga0495630_0020192 | 3300046517 | Bacteria | 4909 |
| 233 | Ga0495630_0023711 | 3300046517 | Bacteria | 4536 |
| 234 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 235 | Ga0495640_0045469 | 3300046533 | Bacteria | 3046 |
| 236 | Ga0495640_0053581 | 3300046533 | Bacteria | 2765 |
| 237 | Ga0495640_0097008 | 3300046533 | Unclassified | 1939 |
| 238 | Ga0495640_0194517 | 3300046533 | Bacteria | 1288 |
| 239 | Ga0495587_0000275 | 3300046536 | Bacteria | 36839 |
| 240 | Ga0495645_0000068 | 3300046543 | Bacteria | 72552 |
| 241 | Ga0495645_0077158 | 3300046543 | Bacteria | 2396 |
| 242 | Ga0495645_0209395 | 3300046543 | Bacteria | 1317 |
| 243 | Ga0495667_0087052 | 3300046559 | Bacteria | 2026 |
| 244 | Ga0495634_0069879 | 3300046642 | Bacteria | 2315 |
| 245 | Ga0495635_0039290 | 3300046663 | Bacteria | 3273 |
| 246 | Ga0495657_0005214 | 3300046675 | Bacteria | 10289 |
| 247 | Ga0495657_0045768 | 3300046675 | Bacteria | 2967 |
| 248 | Ga0495599_0000271 | 3300046678 | Bacteria | 32430 |
| 249 | Ga0495599_0029027 | 3300046678 | Bacteria | 3466 |
| 250 | Ga0495623_0001174 | 3300046679 | Bacteria | 17771 |
| 251 | Ga0495646_0000588 | 3300046680 | Bacteria | 19747 |
| 252 | Ga0495647_0028733 | 3300046681 | Bacteria | 2052 |
| 253 | Ga0495600_0032676 | 3300046809 | Bacteria | 3377 |
| 254 | Ga0495604_0000072 | 3300047317 | Bacteria | 88631 |
| 255 | Ga0495604_0056469 | 3300047317 | Bacteria | 3022 |
| 256 | Ga0495604_0197646 | 3300047317 | Bacteria | 1397 |
| 257 | Ga0495674_0004634 | 3300047319 | Bacteria | 13218 |
| 258 | Ga0495674_0030291 | 3300047319 | Bacteria | 4921 |
| 259 | Ga0495674_0076209 | 3300047319 | Bacteria | 2885 |
| 260 | Ga0495674_0117722 | 3300047319 | Bacteria | 2247 |
| 261 | Ga0495674_0161564 | 3300047319 | Bacteria | 1874 |
| 262 | Ga0495680_0005913 | 3300047322 | Bacteria | 11439 |
| 263 | Ga0495675_0000269 | 3300047444 | Bacteria | 37748 |
| 264 | Ga0495675_0189129 | 3300047444 | Unclassified | 1257 |
| 265 | Ga0495602_0001060 | 3300048088 | Bacteria | 26944 |
| 266 | Ga0495614_0125881 | 3300048089 | Unclassified | 1132 |
| 267 | Ga0496100_0133147 | 3300048903 | Unclassified | 1753 |
| 268 | Ga0496101_0001655 | 3300048904 | Bacteria | 13367 |
| 269 | Ga0496102_0036355 | 3300048905 | Bacteria | 4436 |
| 270 | Ga0496102_0315568 | 3300048905 | Unclassified | 1473 |
| 271 | Ga0496104_0192166 | 3300048907 | Unclassified | 1953 |
| 272 | Ga0496105_0057777 | 3300048908 | Bacteria | 3203 |
| 273 | Ga0496105_0185900 | 3300048908 | Bacteria | 1700 |
| 274 | Ga0496106_0023106 | 3300048909 | Bacteria | 4618 |
| 275 | Ga0496107_0016196 | 3300048910 | Bacteria | 5232 |
| 276 | Ga0496108_0107065 | 3300048911 | Bacteria | 2387 |
| 277 | Ga0496110_0148689 | 3300048913 | Bacteria | 2120 |
| 278 | Ga0496111_0086575 | 3300048914 | Bacteria | 2292 |
| 279 | Ga0496111_0389974 | 3300048914 | Bacteria | 1030 |
| 280 | Ga0496112_0076316 | 3300048915 | Bacteria | 3314 |
| 281 | Ga0496112_0383690 | 3300048915 | Bacteria | 1346 |
| 282 | Ga0496113_0134536 | 3300048916 | Bacteria | 1942 |
| 283 | Ga0496113_0223288 | 3300048916 | Bacteria | 1501 |
| 284 | Ga0496114_0021695 | 3300048917 | Bacteria | 5226 |
| 285 | Ga0496115_0010597 | 3300048918 | Bacteria | 6894 |
| 286 | Ga0496115_0100881 | 3300048918 | Bacteria | 2366 |
| 287 | Ga0501031_0156103 | 3300049568 | Unclassified | 1491 |
| 288 | Ga0501038_0110038 | 3300049574 | Bacteria | 2283 |
| 289 | Ga0501041_0003946 | 3300049577 | Bacteria | 8558 |
| 290 | Ga0501042_0002132 | 3300049578 | Bacteria | 12010 |
| 291 | Ga0501047_0032244 | 3300049581 | Bacteria | 5057 |
| 292 | Ga0501048_0021655 | 3300049582 | Bacteria | 4704 |
| 293 | Ga0501067_0001730 | 3300049583 | Bacteria | 12002 |
| 294 | Ga0501067_0020415 | 3300049583 | Bacteria | 3667 |
| 295 | Ga0501069_0001302 | 3300049585 | Bacteria | 12240 |
| 296 | Ga0501069_0283471 | 3300049585 | Bacteria | 970 |
| 297 | Ga0501070_0000187 | 3300049586 | Bacteria | 58257 |
| 298 | Ga0501070_0072051 | 3300049586 | Bacteria | 2860 |
| 299 | Ga0501070_0188559 | 3300049586 | Bacteria | 1695 |
| 300 | Ga0501071_0047583 | 3300049587 | Unclassified | 3081 |
| 301 | Ga0501072_0041882 | 3300049588 | Bacteria | 3597 |
| 302 | Ga0501074_0089258 | 3300049590 | Bacteria | 2207 |
| 303 | Ga0501075_0400390 | 3300049591 | Unclassified | 1046 |
| 304 | Ga0501079_0035921 | 3300049741 | Unclassified | 3816 |
| 305 | Ga0501080_0255729 | 3300049742 | Bacteria | 1597 |
| 306 | Ga0501080_0408196 | 3300049742 | Unclassified | 1221 |
| 307 | Ga0501035_0222279 | 3300049822 | Unclassified | 1612 |
| 308 | Ga0501045_0148671 | 3300049824 | Bacteria | 1743 |
| 309 | nmdc:mga08y16_31871_c1 | 3300050511 | Bacteria | 5542 |
| 310 | nmdc:mga0a205_23254_c1 | 3300050515 | Bacteria | 5659 |
| 311 | nmdc:mga0a205_61845_c1 | 3300050515 | Bacteria | 3617 |
| 312 | Ga0495601_0000400 | 3300053077 | Bacteria | 22948 |
| 313 | Ga0495601_0034810 | 3300053077 | Bacteria | 3142 |
| 314 | Ga0495601_0043721 | 3300053077 | Bacteria | 2813 |
| 315 | Ga0495612_0016063 | 3300053078 | Bacteria | 2999 |
| 316 | Ga0495595_0040954 | 3300053084 | Bacteria | 2118 |
| 317 | Ga0495619_0000454 | 3300053085 | Bacteria | 27700 |
| 318 | Ga0495619_0017914 | 3300053085 | Bacteria | 4489 |
| 319 | Ga0495619_0123493 | 3300053085 | Unclassified | 1776 |
| 320 | Ga0495619_0362265 | 3300053085 | Unclassified | 1002 |
| 321 | Ga0501084_0030054 | 3300054114 | Unclassified | 4545 |
| 322 | Ga0501082_0037540 | 3300060353 | Unclassified | 4176 |
| 323 | Ga0466962_0000598 | 3300061719 | Bacteria | 15926 |
| 324 | Ga0466962_0015672 | 3300061719 | Bacteria | 3654 |
| 325 | Ga0530510_0027904 | 3300061734 | Bacteria | 4046 |
| 326 | Ga0530510_0192143 | 3300061734 | Bacteria | 1515 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044842 | Ga0466957_0404813 | Ga0466957_0404813_131_916 | 257 |
| 2 | 3300047317 | Ga0495604_0056469 | Ga0495604_0056469_2166_2960 | 258 |
| 3 | 3300044842 | Ga0466957_0254072 | Ga0466957_0254072_326_1159 | 271 |
| 4 | 3300048908 | Ga0496105_0057777 | Ga0496105_0057777_2353_3186 | 273 |
| 5 | 3300046517 | Ga0495630_0020192 | Ga0495630_0020192_4016_4897 | 275 |
| 6 | 3300046533 | Ga0495640_0194517 | Ga0495640_0194517_14_895 | 275 |
| 7 | 3300047317 | Ga0495604_0197646 | Ga0495604_0197646_30_911 | 275 |
| 8 | 3300038443 | Ga0395901_0099202 | Ga0395901_0099202_1992_2843 | 276 |
| 9 | 3300005937 | Ga0081455_10044729 | Ga0081455_100447293 | 277 |
| 10 | 3300049585 | Ga0501069_0283471 | Ga0501069_0283471_125_958 | 277 |
| 11 | 3300014497 | Ga0182008_10061673 | Ga0182008_100616732 | 282 |
| 12 | 3300046477 | Ga0495664_0214840 | Ga0495664_0214840_270_1148 | 286 |
| 13 | 3300048089 | Ga0495614_0125881 | Ga0495614_0125881_23_901 | 286 |
| 14 | 3300047319 | Ga0495674_0004634 | Ga0495674_0004634_11498_12379 | 287 |
| 15 | 3300037471 | Ga0395905_0163896 | Ga0395905_0163896_622_1527 | 290 |
| 16 | 3300044684 | Ga0466966_0115709 | Ga0466966_0115709_690_1625 | 292 |
| 17 | 3300044693 | Ga0466961_0004049 | Ga0466961_0004049_1921_2856 | 292 |
| 18 | 3300044719 | Ga0466971_0007945 | Ga0466971_0007945_3662_4597 | 292 |
| 19 | 3300044842 | Ga0466957_0016220 | Ga0466957_0016220_2897_3832 | 292 |
| 20 | 3300045049 | Ga0466959_0047468 | Ga0466959_0047468_1144_2079 | 292 |
| 21 | 3300045836 | Ga0466958_0033578 | Ga0466958_0033578_1160_2095 | 292 |
| 22 | 3300005339 | Ga0070660_100285173 | Ga0070660_1002851732 | 293 |
| 23 | 3300005356 | Ga0070674_100266099 | Ga0070674_1002660992 | 293 |
| 24 | 3300005459 | Ga0068867_100074557 | Ga0068867_1000745572 | 293 |
| 25 | 3300005563 | Ga0068855_100337202 | Ga0068855_1003372022 | 293 |
| 26 | 3300005578 | Ga0068854_100508981 | Ga0068854_1005089811 | 293 |
| 27 | 3300007076 | Ga0075435_100024952 | Ga0075435_1000249523 | 293 |
| 28 | 3300020069 | Ga0197907_10614961 | Ga0197907_106149612 | 293 |
| 29 | 3300022467 | Ga0224712_10156946 | Ga0224712_101569461 | 293 |
| 30 | 3300025924 | Ga0207694_10073178 | Ga0207694_100731782 | 293 |
| 31 | 3300025934 | Ga0207686_10049821 | Ga0207686_100498213 | 293 |
| 32 | 3300025935 | Ga0207709_10035839 | Ga0207709_100358393 | 293 |
| 33 | 3300028800 | Ga0265338_10281214 | Ga0265338_102812142 | 293 |
| 34 | 3300031251 | Ga0265327_10057064 | Ga0265327_100570642 | 293 |
| 35 | 3300036401 | Ga0373937_0114468 | Ga0373937_0114468_970_1905 | 293 |
| 36 | 3300044694 | Ga0466963_0027991 | Ga0466963_0027991_1200_2081 | 293 |
| 37 | 3300046516 | Ga0495628_0063746 | Ga0495628_0063746_452_1387 | 293 |
| 38 | 3300046543 | Ga0495645_0209395 | Ga0495645_0209395_144_1079 | 293 |
| 39 | 3300046678 | Ga0495599_0029027 | Ga0495599_0029027_769_1704 | 293 |
| 40 | 3300047319 | Ga0495674_0076209 | Ga0495674_0076209_1529_2464 | 293 |
| 41 | 3300047319 | Ga0495674_0117722 | Ga0495674_0117722_1053_1988 | 293 |
| 42 | 3300049574 | Ga0501038_0110038 | Ga0501038_0110038_10_903 | 293 |
| 43 | 3300053085 | Ga0495619_0362265 | Ga0495619_0362265_14_907 | 293 |
| 44 | 3300005530 | Ga0070679_100071755 | Ga0070679_1000717552 | 294 |
| 45 | 3300027907 | Ga0207428_10007861 | Ga0207428_100078613 | 294 |
| 46 | 3300009098 | Ga0105245_10045592 | Ga0105245_100455923 | 295 |
| 47 | 3300006058 | Ga0075432_10004801 | Ga0075432_100048012 | 298 |
| 48 | 3300006844 | Ga0075428_100408039 | Ga0075428_1004080391 | 298 |
| 49 | 3300006914 | Ga0075436_100015350 | Ga0075436_1000153501 | 298 |
| 50 | 3300009094 | Ga0111539_10012304 | Ga0111539_1001230410 | 298 |
| 51 | 3300025939 | Ga0207665_10183980 | Ga0207665_101839802 | 298 |
| 52 | 3300041486 | Ga0451807_1075421 | Ga0451807_1075421_138_1067 | 298 |
| 53 | 3300041492 | Ga0451835_0535582 | Ga0451835_0535582_437_1366 | 298 |
| 54 | 3300041496 | Ga0451839_0782197 | Ga0451839_0782197_146_1075 | 298 |
| 55 | 3300041505 | Ga0451849_0829885 | Ga0451849_0829885_37_966 | 298 |
| 56 | 3300041511 | Ga0451855_0171249 | Ga0451855_0171249_709_1638 | 298 |
| 57 | 3300048905 | Ga0496102_0315568 | Ga0496102_0315568_31_975 | 298 |
| 58 | 3300050511 | nmdc:mga08y16_31871_c1 | nmdc:mga08y16_31871_c1_1621_2556 | 298 |
| 59 | 3300050515 | nmdc:mga0a205_23254_c1 | nmdc:mga0a205_23254_c1_2345_3280 | 298 |
| 60 | 3300046681 | Ga0495647_0028733 | Ga0495647_0028733_196_1131 | 299 |
| 61 | 3300028563 | Ga0265319_1027790 | Ga0265319_10277902 | 301 |
| 62 | 3300028577 | Ga0265318_10008313 | Ga0265318_100083132 | 301 |
| 63 | 3300028800 | Ga0265338_10078363 | Ga0265338_100783632 | 301 |
| 64 | 3300031238 | Ga0265332_10012919 | Ga0265332_100129192 | 301 |
| 65 | 3300031239 | Ga0265328_10002677 | Ga0265328_100026775 | 301 |
| 66 | 3300031241 | Ga0265325_10001119 | Ga0265325_1000111915 | 301 |
| 67 | 3300031242 | Ga0265329_10024137 | Ga0265329_100241373 | 301 |
| 68 | 3300031247 | Ga0265340_10051754 | Ga0265340_100517543 | 301 |
| 69 | 3300031251 | Ga0265327_10009733 | Ga0265327_100097334 | 301 |
| 70 | 3300031595 | Ga0265313_10063482 | Ga0265313_100634822 | 301 |
| 71 | 3300031712 | Ga0265342_10087533 | Ga0265342_100875332 | 301 |
| 72 | 3300044684 | Ga0466966_0052451 | Ga0466966_0052451_521_1444 | 302 |
| 73 | 3300044765 | Ga0466970_0085727 | Ga0466970_0085727_507_1430 | 302 |
| 74 | 3300044842 | Ga0466957_0015472 | Ga0466957_0015472_1866_2789 | 302 |
| 75 | 3300045976 | Ga0466967_0009473 | Ga0466967_0009473_190_1116 | 302 |
| 76 | 3300049824 | Ga0501045_0148671 | Ga0501045_0148671_538_1470 | 302 |
| 77 | 3300035724 | Ga0373933_0133417 | Ga0373933_0133417_380_1309 | 303 |
| 78 | 3300036401 | Ga0373937_0127519 | Ga0373937_0127519_95_1024 | 303 |
| 79 | 3300046516 | Ga0495628_0061669 | Ga0495628_0061669_1300_2229 | 303 |
| 80 | 3300046543 | Ga0495645_0077158 | Ga0495645_0077158_235_1164 | 303 |
| 81 | 3300053085 | Ga0495619_0123493 | Ga0495619_0123493_784_1713 | 303 |
| 82 | 3300005337 | Ga0070682_100205561 | Ga0070682_1002055612 | 304 |
| 83 | 3300005434 | Ga0070709_10068220 | Ga0070709_100682203 | 304 |
| 84 | 3300005436 | Ga0070713_100384265 | Ga0070713_1003842651 | 304 |
| 85 | 3300009094 | Ga0111539_10747396 | Ga0111539_107473961 | 304 |
| 86 | 3300009098 | Ga0105245_10367798 | Ga0105245_103677982 | 304 |
| 87 | 3300009101 | Ga0105247_10044176 | Ga0105247_100441763 | 304 |
| 88 | 3300013296 | Ga0157374_10182977 | Ga0157374_101829773 | 304 |
| 89 | 3300014968 | Ga0157379_10533771 | Ga0157379_105337712 | 304 |
| 90 | 3300025939 | Ga0207665_10000060 | Ga0207665_100000603 | 304 |
| 91 | 3300035083 | Ga0373926_0092265 | Ga0373926_0092265_30_962 | 304 |
| 92 | 3300036401 | Ga0373937_0000494 | Ga0373937_0000494_26670_27605 | 304 |
| 93 | 3300044706 | Ga0466964_0014952 | Ga0466964_0014952_2003_2935 | 304 |
| 94 | 3300044735 | Ga0466968_0025554 | Ga0466968_0025554_353_1285 | 304 |
| 95 | 3300044901 | Ga0466960_0198977 | Ga0466960_0198977_140_1072 | 304 |
| 96 | 3300046454 | Ga0495592_0000123 | Ga0495592_0000123_63764_64699 | 304 |
| 97 | 3300046462 | Ga0495651_0000008 | Ga0495651_0000008_3853_4788 | 304 |
| 98 | 3300046463 | Ga0495653_0006797 | Ga0495653_0006797_3334_4269 | 304 |
| 99 | 3300046463 | Ga0495653_0190266 | Ga0495653_0190266_265_1197 | 304 |
| 100 | 3300046511 | Ga0495608_0001396 | Ga0495608_0001396_286_1221 | 304 |
| 101 | 3300046514 | Ga0495618_0002333 | Ga0495618_0002333_1728_2663 | 304 |
| 102 | 3300046514 | Ga0495618_0016885 | Ga0495618_0016885_1505_2437 | 304 |
| 103 | 3300046516 | Ga0495628_0000016 | Ga0495628_0000016_108701_109636 | 304 |
| 104 | 3300046529 | Ga0495652_0000045 | Ga0495652_0000045_41408_42343 | 304 |
| 105 | 3300046533 | Ga0495640_0053581 | Ga0495640_0053581_1247_2179 | 304 |
| 106 | 3300046536 | Ga0495587_0000275 | Ga0495587_0000275_29441_30376 | 304 |
| 107 | 3300046543 | Ga0495645_0000068 | Ga0495645_0000068_42564_43499 | 304 |
| 108 | 3300046559 | Ga0495667_0087052 | Ga0495667_0087052_31_966 | 304 |
| 109 | 3300046642 | Ga0495634_0069879 | Ga0495634_0069879_196_1128 | 304 |
| 110 | 3300046663 | Ga0495635_0039290 | Ga0495635_0039290_147_1079 | 304 |
| 111 | 3300046675 | Ga0495657_0045768 | Ga0495657_0045768_1205_2140 | 304 |
| 112 | 3300046678 | Ga0495599_0000271 | Ga0495599_0000271_27691_28626 | 304 |
| 113 | 3300046679 | Ga0495623_0001174 | Ga0495623_0001174_16000_16935 | 304 |
| 114 | 3300046680 | Ga0495646_0000588 | Ga0495646_0000588_14200_15135 | 304 |
| 115 | 3300046809 | Ga0495600_0032676 | Ga0495600_0032676_1136_2071 | 304 |
| 116 | 3300047317 | Ga0495604_0000072 | Ga0495604_0000072_9235_10170 | 304 |
| 117 | 3300047322 | Ga0495680_0005913 | Ga0495680_0005913_9726_10661 | 304 |
| 118 | 3300047444 | Ga0495675_0000269 | Ga0495675_0000269_31814_32749 | 304 |
| 119 | 3300048088 | Ga0495602_0001060 | Ga0495602_0001060_9978_10913 | 304 |
| 120 | 3300048903 | Ga0496100_0133147 | Ga0496100_0133147_140_1072 | 304 |
| 121 | 3300048908 | Ga0496105_0185900 | Ga0496105_0185900_37_969 | 304 |
| 122 | 3300048911 | Ga0496108_0107065 | Ga0496108_0107065_1108_2040 | 304 |
| 123 | 3300048914 | Ga0496111_0086575 | Ga0496111_0086575_559_1491 | 304 |
| 124 | 3300048915 | Ga0496112_0076316 | Ga0496112_0076316_2048_2980 | 304 |
| 125 | 3300048916 | Ga0496113_0223288 | Ga0496113_0223288_430_1362 | 304 |
| 126 | 3300053077 | Ga0495601_0000400 | Ga0495601_0000400_5959_6894 | 304 |
| 127 | 3300053077 | Ga0495601_0043721 | Ga0495601_0043721_909_1841 | 304 |
| 128 | 3300053084 | Ga0495595_0040954 | Ga0495595_0040954_1051_1986 | 304 |
| 129 | 3300053085 | Ga0495619_0000454 | Ga0495619_0000454_14114_15049 | 304 |
| 130 | 3300006028 | Ga0070717_10001661 | Ga0070717_1000166110 | 305 |
| 131 | 3300037418 | Ga0395900_0310160 | Ga0395900_0310160_505_1440 | 305 |
| 132 | 3300044683 | Ga0466965_0007732 | Ga0466965_0007732_1113_2048 | 305 |
| 133 | 3300044684 | Ga0466966_0096112 | Ga0466966_0096112_765_1700 | 305 |
| 134 | 3300044693 | Ga0466961_0099940 | Ga0466961_0099940_143_1078 | 305 |
| 135 | 3300044694 | Ga0466963_0000686 | Ga0466963_0000686_7392_8327 | 305 |
| 136 | 3300044694 | Ga0466963_0003398 | Ga0466963_0003398_888_1823 | 305 |
| 137 | 3300044694 | Ga0466963_0036275 | Ga0466963_0036275_378_1313 | 305 |
| 138 | 3300044694 | Ga0466963_0048030 | Ga0466963_0048030_984_1919 | 305 |
| 139 | 3300044694 | Ga0466963_0058417 | Ga0466963_0058417_1143_2084 | 305 |
| 140 | 3300044706 | Ga0466964_0116078 | Ga0466964_0116078_243_1178 | 305 |
| 141 | 3300044765 | Ga0466970_0001717 | Ga0466970_0001717_7773_8708 | 305 |
| 142 | 3300044842 | Ga0466957_0009837 | Ga0466957_0009837_3566_4501 | 305 |
| 143 | 3300044842 | Ga0466957_0052228 | Ga0466957_0052228_83_1018 | 305 |
| 144 | 3300045049 | Ga0466959_0001127 | Ga0466959_0001127_11707_12642 | 305 |
| 145 | 3300045836 | Ga0466958_0003210 | Ga0466958_0003210_6660_7595 | 305 |
| 146 | 3300045836 | Ga0466958_0006409 | Ga0466958_0006409_5102_6043 | 305 |
| 147 | 3300045836 | Ga0466958_0026201 | Ga0466958_0026201_1994_2929 | 305 |
| 148 | 3300045976 | Ga0466967_0007395 | Ga0466967_0007395_1554_2489 | 305 |
| 149 | 3300045976 | Ga0466967_0010182 | Ga0466967_0010182_2963_3898 | 305 |
| 150 | 3300045976 | Ga0466967_0017320 | Ga0466967_0017320_4638_5579 | 305 |
| 151 | 3300045976 | Ga0466967_0033765 | Ga0466967_0033765_2818_3753 | 305 |
| 152 | 3300046511 | Ga0495608_0019502 | Ga0495608_0019502_2215_3150 | 305 |
| 153 | 3300046533 | Ga0495640_0045469 | Ga0495640_0045469_1288_2223 | 305 |
| 154 | 3300006175 | Ga0070712_100036799 | Ga0070712_1000367993 | 306 |
| 155 | 3300025915 | Ga0207693_10084879 | Ga0207693_100848793 | 306 |
| 156 | 3300009093 | Ga0105240_10223689 | Ga0105240_102236893 | 307 |
| 157 | 3300020081 | Ga0206354_10337584 | Ga0206354_103375842 | 307 |
| 158 | 3300025913 | Ga0207695_10188941 | Ga0207695_101889412 | 307 |
| 159 | 3300025944 | Ga0207661_10023632 | Ga0207661_100236323 | 307 |
| 160 | 3300044684 | Ga0466966_0113821 | Ga0466966_0113821_188_1126 | 307 |
| 161 | 3300044694 | Ga0466963_0146710 | Ga0466963_0146710_557_1492 | 307 |
| 162 | 3300005471 | Ga0070698_100022476 | Ga0070698_1000224765 | 308 |
| 163 | 3300032005 | Ga0307411_10380297 | Ga0307411_103802971 | 308 |
| 164 | 3300037466 | Ga0395898_0499432 | Ga0395898_0499432_85_1017 | 308 |
| 165 | 3300005329 | Ga0070683_100134254 | Ga0070683_1001342542 | 309 |
| 166 | 3300005334 | Ga0068869_100048664 | Ga0068869_1000486643 | 309 |
| 167 | 3300005354 | Ga0070675_100237803 | Ga0070675_1002378032 | 309 |
| 168 | 3300005456 | Ga0070678_100178516 | Ga0070678_1001785162 | 309 |
| 169 | 3300005548 | Ga0070665_100090473 | Ga0070665_1000904734 | 309 |
| 170 | 3300005563 | Ga0068855_100022559 | Ga0068855_1000225596 | 309 |
| 171 | 3300005718 | Ga0068866_10034965 | Ga0068866_100349653 | 309 |
| 172 | 3300006358 | Ga0068871_100425160 | Ga0068871_1004251601 | 309 |
| 173 | 3300006914 | Ga0075436_100042366 | Ga0075436_1000423662 | 309 |
| 174 | 3300025926 | Ga0207659_10193982 | Ga0207659_101939822 | 309 |
| 175 | 3300026121 | Ga0207683_10206689 | Ga0207683_102066892 | 309 |
| 176 | 3300035117 | Ga0373953_0076615 | Ga0373953_0076615_230_1198 | 309 |
| 177 | 3300035695 | Ga0373927_0159768 | Ga0373927_0159768_282_1250 | 309 |
| 178 | 3300046472 | Ga0495580_0047205 | Ga0495580_0047205_1158_2126 | 309 |
| 179 | 3300053085 | Ga0495619_0017914 | Ga0495619_0017914_1158_2126 | 309 |
| 180 | 3300005344 | Ga0070661_100176625 | Ga0070661_1001766252 | 310 |
| 181 | 3300005355 | Ga0070671_100128596 | Ga0070671_1001285962 | 310 |
| 182 | 3300005355 | Ga0070671_100230773 | Ga0070671_1002307732 | 310 |
| 183 | 3300005530 | Ga0070679_100089122 | Ga0070679_1000891222 | 310 |
| 184 | 3300005539 | Ga0068853_100173014 | Ga0068853_1001730142 | 310 |
| 185 | 3300005577 | Ga0068857_100071236 | Ga0068857_1000712362 | 310 |
| 186 | 3300005718 | Ga0068866_10143358 | Ga0068866_101433582 | 310 |
| 187 | 3300009176 | Ga0105242_10012764 | Ga0105242_100127646 | 310 |
| 188 | 3300025912 | Ga0207707_10005535 | Ga0207707_1000553513 | 310 |
| 189 | 3300025915 | Ga0207693_10218046 | Ga0207693_102180462 | 310 |
| 190 | 3300025917 | Ga0207660_10067607 | Ga0207660_100676072 | 310 |
| 191 | 3300025920 | Ga0207649_10055725 | Ga0207649_100557252 | 310 |
| 192 | 3300025921 | Ga0207652_10078115 | Ga0207652_100781152 | 310 |
| 193 | 3300025931 | Ga0207644_10070240 | Ga0207644_100702402 | 310 |
| 194 | 3300026041 | Ga0207639_10042864 | Ga0207639_100428643 | 310 |
| 195 | 3300026116 | Ga0207674_10292870 | Ga0207674_102928702 | 310 |
| 196 | 3300037418 | Ga0395900_0007485 | Ga0395900_0007485_3104_4048 | 310 |
| 197 | 3300037466 | Ga0395898_0001584 | Ga0395898_0001584_20134_21078 | 310 |
| 198 | 3300045976 | Ga0466967_0091361 | Ga0466967_0091361_1716_2660 | 310 |
| 199 | 3300048904 | Ga0496101_0001655 | Ga0496101_0001655_8331_9284 | 310 |
| 200 | 3300048905 | Ga0496102_0036355 | Ga0496102_0036355_2548_3501 | 310 |
| 201 | 3300048907 | Ga0496104_0192166 | Ga0496104_0192166_646_1590 | 310 |
| 202 | 3300048909 | Ga0496106_0023106 | Ga0496106_0023106_972_1925 | 310 |
| 203 | 3300048910 | Ga0496107_0016196 | Ga0496107_0016196_2538_3491 | 310 |
| 204 | 3300048913 | Ga0496110_0148689 | Ga0496110_0148689_762_1706 | 310 |
| 205 | 3300048914 | Ga0496111_0389974 | Ga0496111_0389974_35_979 | 310 |
| 206 | 3300048916 | Ga0496113_0134536 | Ga0496113_0134536_363_1322 | 310 |
| 207 | 3300048917 | Ga0496114_0021695 | Ga0496114_0021695_412_1365 | 310 |
| 208 | 3300049586 | Ga0501070_0072051 | Ga0501070_0072051_1249_2193 | 310 |
| 209 | 3300049586 | Ga0501070_0188559 | Ga0501070_0188559_169_1113 | 310 |
| 210 | 3300049590 | Ga0501074_0089258 | Ga0501074_0089258_959_1903 | 310 |
| 211 | 3300049742 | Ga0501080_0255729 | Ga0501080_0255729_485_1429 | 310 |
| 212 | 3300053077 | Ga0495601_0034810 | Ga0495601_0034810_162_1133 | 310 |
| 213 | 3300003323 | rootH1_10033596 | rootH1_100335962 | 311 |
| 214 | 3300005337 | Ga0070682_100164081 | Ga0070682_1001640812 | 311 |
| 215 | 3300005339 | Ga0070660_100001270 | Ga0070660_10000127012 | 311 |
| 216 | 3300005339 | Ga0070660_100162814 | Ga0070660_1001628142 | 311 |
| 217 | 3300005344 | Ga0070661_100012084 | Ga0070661_1000120848 | 311 |
| 218 | 3300005434 | Ga0070709_10174648 | Ga0070709_101746482 | 311 |
| 219 | 3300005437 | Ga0070710_10249350 | Ga0070710_102493502 | 311 |
| 220 | 3300005439 | Ga0070711_100000341 | Ga0070711_1000003413 | 311 |
| 221 | 3300005458 | Ga0070681_10000752 | Ga0070681_1000075211 | 311 |
| 222 | 3300005458 | Ga0070681_10282172 | Ga0070681_102821722 | 311 |
| 223 | 3300005530 | Ga0070679_100215094 | Ga0070679_1002150942 | 311 |
| 224 | 3300005563 | Ga0068855_100063551 | Ga0068855_1000635514 | 311 |
| 225 | 3300005563 | Ga0068855_100067800 | Ga0068855_1000678002 | 311 |
| 226 | 3300005577 | Ga0068857_100187268 | Ga0068857_1001872682 | 311 |
| 227 | 3300005614 | Ga0068856_100025658 | Ga0068856_1000256583 | 311 |
| 228 | 3300005616 | Ga0068852_100067985 | Ga0068852_1000679853 | 311 |
| 229 | 3300006175 | Ga0070712_100005578 | Ga0070712_1000055782 | 311 |
| 230 | 3300006175 | Ga0070712_100020446 | Ga0070712_1000204462 | 311 |
| 231 | 3300006852 | Ga0075433_10052695 | Ga0075433_100526953 | 311 |
| 232 | 3300009098 | Ga0105245_10039318 | Ga0105245_100393183 | 311 |
| 233 | 3300009545 | Ga0105237_10079980 | Ga0105237_100799802 | 311 |
| 234 | 3300009551 | Ga0105238_10008930 | Ga0105238_100089304 | 311 |
| 235 | 3300009551 | Ga0105238_10074948 | Ga0105238_100749483 | 311 |
| 236 | 3300009551 | Ga0105238_10572422 | Ga0105238_105724222 | 311 |
| 237 | 3300013104 | Ga0157370_10040724 | Ga0157370_100407243 | 311 |
| 238 | 3300013307 | Ga0157372_10073346 | Ga0157372_100733465 | 311 |
| 239 | 3300013307 | Ga0157372_10504021 | Ga0157372_105040212 | 311 |
| 240 | 3300020081 | Ga0206354_11199835 | Ga0206354_111998351 | 311 |
| 241 | 3300020082 | Ga0206353_11851681 | Ga0206353_118516813 | 311 |
| 242 | 3300025898 | Ga0207692_10190307 | Ga0207692_101903072 | 311 |
| 243 | 3300025909 | Ga0207705_10106116 | Ga0207705_101061162 | 311 |
| 244 | 3300025909 | Ga0207705_10134984 | Ga0207705_101349842 | 311 |
| 245 | 3300025912 | Ga0207707_10029462 | Ga0207707_100294622 | 311 |
| 246 | 3300025912 | Ga0207707_10102199 | Ga0207707_101021992 | 311 |
| 247 | 3300025915 | Ga0207693_10002081 | Ga0207693_100020818 | 311 |
| 248 | 3300025916 | Ga0207663_10021886 | Ga0207663_100218862 | 311 |
| 249 | 3300025917 | Ga0207660_10146918 | Ga0207660_101469182 | 311 |
| 250 | 3300025919 | Ga0207657_10000651 | Ga0207657_1000065126 | 311 |
| 251 | 3300025919 | Ga0207657_10000941 | Ga0207657_100009418 | 311 |
| 252 | 3300025919 | Ga0207657_10039459 | Ga0207657_100394594 | 311 |
| 253 | 3300025924 | Ga0207694_10301263 | Ga0207694_103012632 | 311 |
| 254 | 3300025929 | Ga0207664_10053637 | Ga0207664_100536373 | 311 |
| 255 | 3300025949 | Ga0207667_10178754 | Ga0207667_101787542 | 311 |
| 256 | 3300026041 | Ga0207639_10038965 | Ga0207639_100389653 | 311 |
| 257 | 3300026142 | Ga0207698_10410035 | Ga0207698_104100351 | 311 |
| 258 | 3300037312 | Ga0395899_0021226 | Ga0395899_0021226_1012_1959 | 311 |
| 259 | 3300037418 | Ga0395900_0237546 | Ga0395900_0237546_653_1600 | 311 |
| 260 | 3300037418 | Ga0395900_0241033 | Ga0395900_0241033_609_1556 | 311 |
| 261 | 3300037418 | Ga0395900_0420040 | Ga0395900_0420040_259_1212 | 311 |
| 262 | 3300037466 | Ga0395898_0216304 | Ga0395898_0216304_653_1600 | 311 |
| 263 | 3300037466 | Ga0395898_0236426 | Ga0395898_0236426_24_977 | 311 |
| 264 | 3300037471 | Ga0395905_0087035 | Ga0395905_0087035_481_1428 | 311 |
| 265 | 3300037471 | Ga0395905_0235772 | Ga0395905_0235772_23_970 | 311 |
| 266 | 3300038443 | Ga0395901_0001414 | Ga0395901_0001414_5391_6338 | 311 |
| 267 | 3300038443 | Ga0395901_0059084 | Ga0395901_0059084_17_970 | 311 |
| 268 | 3300042156 | Ga0439446_0000667 | Ga0439446_0000667_4201_5169 | 311 |
| 269 | 3300042435 | Ga0439434_0002292 | Ga0439434_0002292_227_1195 | 311 |
| 270 | 3300044684 | Ga0466966_0014862 | Ga0466966_0014862_2718_3665 | 311 |
| 271 | 3300044684 | Ga0466966_0126966 | Ga0466966_0126966_364_1305 | 311 |
| 272 | 3300044693 | Ga0466961_0011374 | Ga0466961_0011374_470_1417 | 311 |
| 273 | 3300044693 | Ga0466961_0075801 | Ga0466961_0075801_366_1310 | 311 |
| 274 | 3300044694 | Ga0466963_0012968 | Ga0466963_0012968_1783_2718 | 311 |
| 275 | 3300044694 | Ga0466963_0015662 | Ga0466963_0015662_888_1835 | 311 |
| 276 | 3300044694 | Ga0466963_0046820 | Ga0466963_0046820_1166_2113 | 311 |
| 277 | 3300044694 | Ga0466963_0047997 | Ga0466963_0047997_1496_2449 | 311 |
| 278 | 3300044694 | Ga0466963_0188907 | Ga0466963_0188907_304_1239 | 311 |
| 279 | 3300044706 | Ga0466964_0007188 | Ga0466964_0007188_2317_3252 | 311 |
| 280 | 3300044719 | Ga0466971_0004642 | Ga0466971_0004642_3805_4752 | 311 |
| 281 | 3300044765 | Ga0466970_0055411 | Ga0466970_0055411_1111_2058 | 311 |
| 282 | 3300044842 | Ga0466957_0001760 | Ga0466957_0001760_2314_3261 | 311 |
| 283 | 3300045049 | Ga0466959_0020641 | Ga0466959_0020641_179_1120 | 311 |
| 284 | 3300045049 | Ga0466959_0041244 | Ga0466959_0041244_1185_2132 | 311 |
| 285 | 3300045836 | Ga0466958_0027760 | Ga0466958_0027760_1186_2133 | 311 |
| 286 | 3300045976 | Ga0466967_0000367 | Ga0466967_0000367_15944_16879 | 311 |
| 287 | 3300045976 | Ga0466967_0010856 | Ga0466967_0010856_3550_4497 | 311 |
| 288 | 3300045976 | Ga0466967_0018787 | Ga0466967_0018787_1436_2371 | 311 |
| 289 | 3300045976 | Ga0466967_0051582 | Ga0466967_0051582_2094_3029 | 311 |
| 290 | 3300045976 | Ga0466967_0071080 | Ga0466967_0071080_1746_2693 | 311 |
| 291 | 3300045976 | Ga0466967_0111743 | Ga0466967_0111743_1319_2266 | 311 |
| 292 | 3300045976 | Ga0466967_0130152 | Ga0466967_0130152_962_1918 | 311 |
| 293 | 3300045976 | Ga0466967_0197644 | Ga0466967_0197644_721_1656 | 311 |
| 294 | 3300046511 | Ga0495608_0207250 | Ga0495608_0207250_246_1193 | 311 |
| 295 | 3300046517 | Ga0495630_0023711 | Ga0495630_0023711_254_1201 | 311 |
| 296 | 3300046533 | Ga0495640_0097008 | Ga0495640_0097008_767_1714 | 311 |
| 297 | 3300046675 | Ga0495657_0005214 | Ga0495657_0005214_1688_2635 | 311 |
| 298 | 3300047319 | Ga0495674_0030291 | Ga0495674_0030291_1581_2528 | 311 |
| 299 | 3300047319 | Ga0495674_0161564 | Ga0495674_0161564_66_1016 | 311 |
| 300 | 3300047444 | Ga0495675_0189129 | Ga0495675_0189129_141_1088 | 311 |
| 301 | 3300048915 | Ga0496112_0383690 | Ga0496112_0383690_108_1055 | 311 |
| 302 | 3300048918 | Ga0496115_0010597 | Ga0496115_0010597_2316_3266 | 311 |
| 303 | 3300048918 | Ga0496115_0100881 | Ga0496115_0100881_1172_2119 | 311 |
| 304 | 3300049568 | Ga0501031_0156103 | Ga0501031_0156103_470_1417 | 311 |
| 305 | 3300049577 | Ga0501041_0003946 | Ga0501041_0003946_2275_3222 | 311 |
| 306 | 3300049578 | Ga0501042_0002132 | Ga0501042_0002132_5476_6423 | 311 |
| 307 | 3300049581 | Ga0501047_0032244 | Ga0501047_0032244_2304_3251 | 311 |
| 308 | 3300049582 | Ga0501048_0021655 | Ga0501048_0021655_3724_4671 | 311 |
| 309 | 3300049583 | Ga0501067_0001730 | Ga0501067_0001730_3910_4845 | 311 |
| 310 | 3300049583 | Ga0501067_0020415 | Ga0501067_0020415_1547_2515 | 311 |
| 311 | 3300049585 | Ga0501069_0001302 | Ga0501069_0001302_8856_9791 | 311 |
| 312 | 3300049586 | Ga0501070_0000187 | Ga0501070_0000187_16587_17534 | 311 |
| 313 | 3300049587 | Ga0501071_0047583 | Ga0501071_0047583_121_1068 | 311 |
| 314 | 3300049588 | Ga0501072_0041882 | Ga0501072_0041882_789_1736 | 311 |
| 315 | 3300049591 | Ga0501075_0400390 | Ga0501075_0400390_10_957 | 311 |
| 316 | 3300049741 | Ga0501079_0035921 | Ga0501079_0035921_2299_3246 | 311 |
| 317 | 3300049742 | Ga0501080_0408196 | Ga0501080_0408196_56_1003 | 311 |
| 318 | 3300049822 | Ga0501035_0222279 | Ga0501035_0222279_207_1154 | 311 |
| 319 | 3300050515 | nmdc:mga0a205_61845_c1 | nmdc:mga0a205_61845_c1_1415_2368 | 311 |
| 320 | 3300053078 | Ga0495612_0016063 | Ga0495612_0016063_1019_1969 | 311 |
| 321 | 3300054114 | Ga0501084_0030054 | Ga0501084_0030054_3293_4240 | 311 |
| 322 | 3300060353 | Ga0501082_0037540 | Ga0501082_0037540_2440_3387 | 311 |
| 323 | 3300061719 | Ga0466962_0000598 | Ga0466962_0000598_10889_11836 | 311 |
| 324 | 3300061719 | Ga0466962_0015672 | Ga0466962_0015672_1686_2633 | 311 |
| 325 | 3300061734 | Ga0530510_0027904 | Ga0530510_0027904_1978_2913 | 311 |
| 326 | 3300061734 | Ga0530510_0192143 | Ga0530510_0192143_487_1434 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l2h-assembly1.cif.gz_D | crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution | 0.9146 | 7 | 125 |
| 5fpx-assembly1.cif.gz_A | the structure of kdgf from yersinia enterocolitica. | 0.904 | 165 | 274 |
| 5fpz-assembly1.cif.gz_A-2 | the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. | 0.8952 | 164 | 275 |
| 2pfw-assembly1.cif.gz_B | crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution | 0.8783 | 162 | 275 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.8703 | 164 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.904 | 165 | 274 | 2.60.120.10 |
| 3l2hD01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9021 | 10 | 125 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8646 | 171 | 274 | 2.60.120.10 |
| af_F1LVA4_327_469_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8567 | 186 | 274 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8561 | 171 | 274 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534XSA4-F1-model_v4 | Cupin domain-containing protein | 0.9712 | 4 | 127 |
|
| AF-A0A7V9IG87-F1-model_v4 | Cupin domain-containing protein | 0.9642 | 177 | 311 |
|
| AF-A0A1E5XV51-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9626 | 4 | 127 |
|
| AF-A0A523J718-F1-model_v4 | Cupin domain-containing protein | 0.9622 | 4 | 127 |
|
| AF-A0A7C1U969-F1-model_v4 | Cupin domain-containing protein | 0.9596 | 4 | 127 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar