F408329

General Info

Members Datasets Scaffolds Average Seq Length
326 233 652 291

Family's Representative Sequence

Representative Sequence 3300021327|Ga0214543_1014631|Ga0214543_10146316
Length 343
Sequence MQVNFEMRHGIGEAGRSRDDKAFRDISEHSGAHGRTMPESAFPIDGSEMKPAPFEYLAATSAAEAAEALAAANGDGKIIAGGQSLMPMINFRLVKPTILIDINRVAGLDRIEKHGERLRIGATVRHRMTATDALVHRHIPILHDAMSHVAHLTVRNRGTFCGSVCHADPAAEMPMMTLLLDGTIAALSIRGERQIAASEFFVGSLMTSLEPDEFVTWIDIDTLPPETGWGFEEFSRRHGDFALACVATTLRIVDGVACDVRFGMMGVGETPLRLPDIETLVEGQAISETLLQDVSEALKGLLQPNTDIHASADYRRHLAGVLARRALRDAWKRATFRKDGPDA

Samples

Sample ID Description Type Environment
1 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
64 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
65 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
203 2643221610 Ensifer sp. Root74 Isolate Unclassified
204 2643221675 Ensifer sp. Root1298 Isolate Unclassified
205 2643221680 Ensifer sp. Root1312 Isolate Unclassified
206 2643221726 Ensifer sp. Root954 Isolate Unclassified
207 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
208 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
209 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
210 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
211 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
212 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
213 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
214 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
215 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
219 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
220 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
221 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
222 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
223 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
224 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
225 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
226 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
227 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
228 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
229 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
230 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
231 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
232 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
233 8005382845 Rhizobium sp. R634 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.88
Metatranscriptomes 0
Isolates 10.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.67
Nodule 10.43
Rhizoplane 7.36
Rhizosphere 70.55
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0214543_1014631 3300021327 Bacteria 9117
2 JGI25158J39367_1000940 3300002739 Bacteria 5391
3 JGI25158J39367_1002335 3300002739 Bacteria 3111
4 JGI25159J45721_1000026 3300002987 Bacteria 114104
5 JGI25160J50197_1000013 3300003354 Bacteria 263367
6 JGI25161J50226_1001386 3300003374 Bacteria 7384
7 JGI25404J52841_10001243 3300003659 Bacteria 4407
8 Ga0055531_10001692 3300003794 Bacteria 15850
9 Ga0055543_1000132 3300004625 Bacteria 61786
10 Ga0065165_1000021 3300005262 Bacteria 262983
11 Ga0065165_1005494 3300005262 Bacteria 7088
12 Ga0070690_100047368 3300005330 Bacteria 2735
13 Ga0070677_10041216 3300005333 Bacteria 1821
14 Ga0068869_100168055 3300005334 Bacteria 1712
15 Ga0070660_100348933 3300005339 Unclassified 1218
16 Ga0070689_100124621 3300005340 Bacteria 2061
17 Ga0070687_100271621 3300005343 Bacteria 1063
18 Ga0070669_100142745 3300005353 Bacteria 1847
19 Ga0070669_100316211 3300005353 Bacteria 1260
20 Ga0070671_100017825 3300005355 Bacteria 5755
21 Ga0070671_100370558 3300005355 Bacteria 1223
22 Ga0070674_100200569 3300005356 Bacteria 1540
23 Ga0070673_100000963 3300005364 Bacteria 16323
24 Ga0070673_100122642 3300005364 Bacteria 2170
25 Ga0070688_100012965 3300005365 Bacteria 4688
26 Ga0070659_100090962 3300005366 Bacteria 2445
27 Ga0070667_100236646 3300005367 Bacteria 1629
28 Ga0070714_100133793 3300005435 Bacteria 2218
29 Ga0070713_100030829 3300005436 Bacteria 4264
30 Ga0070678_100085058 3300005456 Bacteria 2409
31 Ga0070698_100100570 3300005471 Bacteria 2864
32 Ga0070684_100038824 3300005535 Bacteria 4093
33 Ga0070672_100127816 3300005543 Bacteria 2086
34 Ga0070686_100012798 3300005544 Bacteria 4789
35 Ga0070665_100068364 3300005548 Bacteria 3562
36 Ga0070664_100067446 3300005564 Bacteria 3058
37 Ga0068857_100464589 3300005577 Bacteria 1185
38 Ga0068856_100103569 3300005614 Bacteria 2840
39 Ga0068859_100070666 3300005617 Bacteria 3527
40 Ga0068864_100060229 3300005618 Bacteria 3287
41 Ga0068864_100595987 3300005618 Bacteria 1072
42 Ga0068863_100591044 3300005841 Bacteria 1098
43 Ga0068860_100265578 3300005843 Bacteria 1674
44 Ga0081455_10002165 3300005937 Bacteria 23432
45 Ga0081539_10006509 3300005985 Bacteria 11164
46 Ga0070716_100023817 3300006173 Bacteria 3253
47 Ga0070712_100047678 3300006175 Bacteria 2966
48 Ga0097621_100238240 3300006237 Bacteria 1590
49 Ga0075430_100099741 3300006846 Bacteria 2425
50 Ga0075431_100139402 3300006847 Bacteria 2500
51 Ga0075433_10115075 3300006852 Bacteria 2386
52 Ga0075434_100060492 3300006871 Bacteria 3767
53 Ga0075434_100177553 3300006871 Bacteria 2149
54 Ga0075434_100439185 3300006871 Bacteria 1326
55 Ga0097620_100070664 3300006931 Bacteria 3527
56 Ga0079104_1000183 3300006946 Bacteria 89496
57 Ga0099794_10009307 3300007265 Bacteria 4124
58 Ga0099794_10079536 3300007265 Bacteria 1615
59 Ga0099795_10001516 3300007788 Bacteria 5078
60 Ga0105240_10013711 3300009093 Bacteria 11107
61 Ga0105240_10345326 3300009093 Bacteria 1690
62 Ga0111539_10108009 3300009094 Bacteria 3265
63 Ga0111539_10514489 3300009094 Bacteria 1394
64 Ga0105245_10046581 3300009098 Bacteria 3875
65 Ga0105245_10126367 3300009098 Bacteria 2394
66 Ga0105245_10280166 3300009098 Bacteria 1629
67 Ga0105247_10061800 3300009101 Bacteria 2323
68 Ga0105248_10008575 3300009177 Bacteria 11224
69 Ga0105248_10078911 3300009177 Bacteria 3700
70 Ga0105238_10018088 3300009551 Bacteria 7165
71 Ga0105239_10219026 3300010375 Bacteria 2134
72 Ga0105239_10222110 3300010375 Bacteria 2119
73 Ga0105239_10549509 3300010375 Bacteria 1315
74 Ga0157374_10155203 3300013296 Bacteria 2227
75 Ga0163162_10187678 3300013306 Bacteria 2194
76 Ga0163163_10000318 3300014325 Bacteria 46911
77 Ga0163163_10054827 3300014325 Bacteria 3939
78 Ga0157377_10292899 3300014745 Unclassified 1071
79 Ga0157379_10070150 3300014968 Bacteria 3135
80 Ga0214544_1000030 3300021320 Bacteria 153107
81 Ga0214544_1000097 3300021320 Bacteria 116548
82 Ga0214542_1000026 3300021321 Bacteria 182145
83 Ga0214542_1007350 3300021321 Bacteria 19208
84 Ga0214545_1000015 3300021324 Bacteria 182143
85 Ga0214543_1000036 3300021327 Bacteria 182143
86 Ga0209436_100024 3300025208 Bacteria 95606
87 Ga0209673_1000905 3300025273 Bacteria 37932
88 Ga0209130_1000039 3300025284 Bacteria 263493
89 Ga0209758_1002277 3300025297 Bacteria 19883
90 Ga0209050_1032874 3300025298 Bacteria 1585
91 Ga0209256_1008639 3300025299 Bacteria 4668
92 Ga0207426_1000099 3300025302 Bacteria 263493
93 Ga0209257_1001965 3300025304 Bacteria 22155
94 Ga0207710_10088647 3300025900 Bacteria 1445
95 Ga0207645_10009782 3300025907 Bacteria 6619
96 Ga0207695_10361440 3300025913 Bacteria 1338
97 Ga0207693_10100007 3300025915 Bacteria 2274
98 Ga0207662_10078291 3300025918 Bacteria 2012
99 Ga0207662_10185751 3300025918 Bacteria 1339
100 Ga0207649_10043374 3300025920 Bacteria 2750
101 Ga0207694_10042152 3300025924 Bacteria 3520
102 Ga0207650_10000973 3300025925 Bacteria 21537
103 Ga0207687_10038260 3300025927 Bacteria 3278
104 Ga0207687_10244909 3300025927 Bacteria 1422
105 Ga0207664_10136517 3300025929 Bacteria 2070
106 Ga0207644_10006443 3300025931 Bacteria 7650
107 Ga0207709_10046376 3300025935 Bacteria 2637
108 Ga0207670_10109414 3300025936 Bacteria 1988
109 Ga0207665_10035886 3300025939 Bacteria 3294
110 Ga0207691_10014062 3300025940 Bacteria 7637
111 Ga0207711_10043016 3300025941 Bacteria 3851
112 Ga0207711_10303420 3300025941 Bacteria 1473
113 Ga0207661_10373036 3300025944 Bacteria 1290
114 Ga0207651_10003178 3300025960 Bacteria 8017
115 Ga0207651_10382365 3300025960 Bacteria 1193
116 Ga0207651_10426525 3300025960 Bacteria 1133
117 Ga0207658_10206864 3300025986 Bacteria 1642
118 Ga0207703_10028300 3300026035 Bacteria 4417
119 Ga0207703_10458531 3300026035 Bacteria 1192
120 Ga0207648_10050943 3300026089 Bacteria 3619
121 Ga0207676_10016220 3300026095 Bacteria 5393
122 Ga0207674_10066356 3300026116 Bacteria 3635
123 Ga0207683_10003984 3300026121 Bacteria 12807
124 Ga0209281_1000295 3300027111 Bacteria 90994
125 Ga0209588_1001835 3300027671 Bacteria 5655
126 Ga0207428_10023271 3300027907 Bacteria 5212
127 Ga0207428_10024442 3300027907 Bacteria 5073
128 Ga0268264_10171509 3300028381 Bacteria 1962
129 Ga0265330_10013355 3300031235 Bacteria 3830
130 Ga0265330_10020904 3300031235 Bacteria 2990
131 Ga0265332_10021052 3300031238 Bacteria 2881
132 Ga0265320_10007608 3300031240 Bacteria 6711
133 Ga0265325_10036860 3300031241 Bacteria 2589
134 Ga0265325_10053002 3300031241 Bacteria 2081
135 Ga0265325_10078686 3300031241 Bacteria 1642
136 Ga0265329_10011122 3300031242 Bacteria 3278
137 Ga0265340_10124048 3300031247 Bacteria 1187
138 Ga0265339_10060387 3300031249 Bacteria 2043
139 Ga0265331_10080978 3300031250 Bacteria 1508
140 Ga0265316_10092834 3300031344 Bacteria 2301
141 Ga0265316_10284579 3300031344 Bacteria 1207
142 Ga0265316_10288627 3300031344 Bacteria 1197
143 Ga0307509_10331621 3300031507 Bacteria 1253
144 Ga0265314_10152448 3300031711 Bacteria 1415
145 Ga0265314_10163207 3300031711 Bacteria 1353
146 Ga0373934_0034651 3300035086 Bacteria 1984
147 Ga0373923_0000332 3300035111 Bacteria 10623
148 Ga0373953_0000796 3300035117 Bacteria 8792
149 Ga0373954_0000359 3300035118 Bacteria 16829
150 Ga0373954_0012234 3300035118 Bacteria 3815
151 Ga0373954_0055073 3300035118 Bacteria 1871
152 Ga0373956_0056575 3300035119 Bacteria 1771
153 Ga0373957_0000584 3300035120 Bacteria 9218
154 Ga0373957_0036176 3300035120 Bacteria 1838
155 Ga0373955_0101599 3300035172 Bacteria 1651
156 Ga0373955_0230286 3300035172 Bacteria 1108
157 Ga0373924_0014688 3300035410 Bacteria 2962
158 Ga0373924_0020639 3300035410 Bacteria 2563
159 Ga0373935_0192523 3300035692 Bacteria 1405
160 Ga0373935_0300985 3300035692 Bacteria 1133
161 Ga0373927_0039594 3300035695 Bacteria 3060
162 Ga0373933_0002349 3300035724 Bacteria 10718
163 Ga0373933_0060304 3300035724 Bacteria 2287
164 Ga0373933_0085494 3300035724 Bacteria 1939
165 Ga0373937_0004738 3300036401 Bacteria 11572
166 Ga0373937_0006342 3300036401 Bacteria 10200
167 Ga0373937_0024328 3300036401 Bacteria 5460
168 Ga0373937_0080052 3300036401 Bacteria 3020
169 Ga0373925_0416529 3300037068 Bacteria 1097
170 Ga0436364_0459773 3300037853 Bacteria 2353
171 Ga0436365_0562553 3300039437 Bacteria 1964
172 Ga0436365_1928201 3300039437 Bacteria 2525
173 Ga0439465_0025347 3300041413 Bacteria 1871
174 Ga0466972_0099384 3300044658 Bacteria 1377
175 Ga0495592_0000710 3300046454 Bacteria 23301
176 Ga0495592_0102100 3300046454 Bacteria 2042
177 Ga0495603_0016886 3300046455 Bacteria 4417
178 Ga0495629_0031268 3300046459 Bacteria 3770
179 Ga0495629_0107201 3300046459 Bacteria 1949
180 Ga0495651_0018068 3300046462 Bacteria 5458
181 Ga0495651_0151550 3300046462 Bacteria 1670
182 Ga0495653_0000729 3300046463 Bacteria 25098
183 Ga0495653_0063827 3300046463 Bacteria 2777
184 Ga0495664_0022631 3300046477 Bacteria 3645
185 Ga0495608_0000921 3300046511 Bacteria 20621
186 Ga0495608_0080777 3300046511 Bacteria 2113
187 Ga0495608_0091338 3300046511 Bacteria 1969
188 Ga0495618_0032149 3300046514 Bacteria 3286
189 Ga0495628_0006699 3300046516 Bacteria 10044
190 Ga0495628_0062896 3300046516 Bacteria 2908
191 Ga0495630_0124509 3300046517 Bacteria 1956
192 Ga0495652_0008596 3300046529 Bacteria 9307
193 Ga0495652_0118855 3300046529 Bacteria 2111
194 Ga0495640_0002672 3300046533 Bacteria 14324
195 Ga0495640_0029797 3300046533 Bacteria 3912
196 Ga0495586_0029388 3300046535 Bacteria 2941
197 Ga0495587_0012062 3300046536 Bacteria 5458
198 Ga0495587_0016325 3300046536 Bacteria 4620
199 Ga0495587_0030331 3300046536 Bacteria 3279
200 Ga0495645_0039443 3300046543 Bacteria 3444
201 Ga0495645_0046688 3300046543 Bacteria 3156
202 Ga0495667_0011209 3300046559 Bacteria 6069
203 Ga0495667_0029170 3300046559 Bacteria 3713
204 Ga0495667_0065914 3300046559 Bacteria 2368
205 Ga0495635_0002229 3300046663 Bacteria 13164
206 Ga0495635_0075580 3300046663 Bacteria 2307
207 Ga0495635_0344830 3300046663 Bacteria 994
208 Ga0495657_0012393 3300046675 Bacteria 6334
209 Ga0495599_0003285 3300046678 Bacteria 9429
210 Ga0495599_0008230 3300046678 Bacteria 6340
211 Ga0495599_0053122 3300046678 Bacteria 2538
212 Ga0495623_0025928 3300046679 Bacteria 3775
213 Ga0495623_0036510 3300046679 Bacteria 3147
214 Ga0495646_0003902 3300046680 Bacteria 9328
215 Ga0495646_0030511 3300046680 Bacteria 3366
216 Ga0495658_0123538 3300046683 Bacteria 1568
217 Ga0495613_0038342 3300046689 Bacteria 3552
218 Ga0495613_0085329 3300046689 Bacteria 2291
219 Ga0495600_0008208 3300046809 Bacteria 6411
220 Ga0495600_0086862 3300046809 Bacteria 2040
221 Ga0495581_0067582 3300047315 Bacteria 2067
222 Ga0495604_0010253 3300047317 Bacteria 7421
223 Ga0495604_0081661 3300047317 Bacteria 2419
224 Ga0495674_0024868 3300047319 Bacteria 5498
225 Ga0495674_0091723 3300047319 Bacteria 2594
226 Ga0495680_0015102 3300047322 Bacteria 6670
227 Ga0495680_0020795 3300047322 Bacteria 5509
228 Ga0495675_0002709 3300047444 Bacteria 10614
229 Ga0495685_112234 3300047447 Bacteria 897
230 Ga0495684_0000104 3300047471 Bacteria 59909
231 Ga0495684_0043058 3300047471 Bacteria 3456
232 Ga0495684_0403319 3300047471 Bacteria 959
233 Ga0495593_0001792 3300047673 Bacteria 12741
234 Ga0495602_0018322 3300048088 Bacteria 6997
235 Ga0495602_0033407 3300048088 Bacteria 4826
236 Ga0496102_0501749 3300048905 Bacteria 1136
237 Ga0496104_0005007 3300048907 Bacteria 11555
238 Ga0496104_0020410 3300048907 Bacteria 6073
239 Ga0496104_0218491 3300048907 Bacteria 1818
240 Ga0496104_0372626 3300048907 Bacteria 1340
241 Ga0496106_0018205 3300048909 Bacteria 5194
242 Ga0496107_0060354 3300048910 Bacteria 2745
243 Ga0496108_0001304 3300048911 Bacteria 19616
244 Ga0496108_0039477 3300048911 Bacteria 3935
245 Ga0496109_0005480 3300048912 Bacteria 10619
246 Ga0496109_0005799 3300048912 Bacteria 10340
247 Ga0496109_0262807 3300048912 Bacteria 1626
248 Ga0496110_0009849 3300048913 Bacteria 7745
249 Ga0496110_0019801 3300048913 Bacteria 5670
250 Ga0496111_0215452 3300048914 Archaea 1426
251 Ga0496112_0003458 3300048915 Bacteria 13050
252 Ga0496112_0026080 3300048915 Bacteria 5619
253 Ga0496112_0061056 3300048915 Bacteria 3715
254 Ga0496112_0330405 3300048915 Bacteria 1468
255 Ga0496113_0001813 3300048916 Bacteria 12136
256 Ga0496113_0067309 3300048916 Bacteria 2715
257 Ga0496113_0067402 3300048916 Bacteria 2714
258 Ga0496115_0216836 3300048918 Bacteria 1580
259 Ga0496115_0220322 3300048918 Archaea 1566
260 Ga0496126_0081290 3300048929 Bacteria 2865
261 Ga0501039_0057857 3300049575 Bacteria 3002
262 Ga0501040_0110621 3300049576 Bacteria 1921
263 Ga0501069_0079313 3300049585 Bacteria 1848
264 Ga0501075_0038199 3300049591 Bacteria 3589
265 Ga0501077_0004617 3300049593 Bacteria 8365
266 Ga0501079_0005504 3300049741 Bacteria 9438
267 Ga0501080_0015570 3300049742 Bacteria 7013
268 Ga0501081_0056255 3300049743 Bacteria 2718
269 Ga0501044_0202771 3300049823 Bacteria 1941
270 Ga0501045_0339876 3300049824 Bacteria 1117
271 nmdc:mga07m45_65359_c1 3300050496 Bacteria 2065
272 nmdc:mga05p37_22586_c1 3300050507 Bacteria 7629
273 nmdc:mga05p37_80180_c1 3300050507 Bacteria 4021
274 nmdc:mga06r32_2748_c1 3300050510 Bacteria 15741
275 nmdc:mga08y16_82869_c1 3300050511 Bacteria 3343
276 nmdc:mga0n895_90402_c1 3300050512 Bacteria 3063
277 nmdc:mga0rr50_36155_c1 3300050513 Bacteria 3554
278 nmdc:mga0a205_239190_c1 3300050515 Bacteria 1697
279 Ga0495601_0010665 3300053077 Bacteria 5478
280 Ga0495601_0230542 3300053077 Bacteria 1209
281 Ga0495612_0012674 3300053078 Bacteria 3398
282 Ga0500635_0010733 3300053080 Bacteria 2582
283 Ga0495595_0028133 3300053084 Bacteria 2509
284 Ga0495619_0000727 3300053085 Bacteria 21527
285 Ga0500554_002967 3300053102 Bacteria 3405
286 Ga0500593_021108 3300053117 Bacteria 2866
287 Ga0500642_0095466 3300053130 Bacteria 1378
288 Ga0500616_0011069 3300053153 Bacteria 5360
289 Ga0500616_0022410 3300053153 Bacteria 3526
290 Ga0500616_0040498 3300053153 Bacteria 2505
291 Ga0501082_0022697 3300060353 Bacteria 5404
292 Ga0501082_0189013 3300060353 Bacteria 1792
293 Ga0501082_0432069 3300060353 Bacteria 1150
294 2509392851 2509276021 Bacteria 7634384
295 2644068964 2643221610 Bacteria 7480339
296 2644420035 2643221675 Bacteria 7473456
297 2644453442 2643221680 Bacteria 7473610
298 2644692141 2643221726 Bacteria 7455827
299 2792643840 2791355094 Bacteria 7011481
300 2824603812 2824600985 Bacteria 8488197
301 2838746214 2838742623 Bacteria 7396178
302 2841858126 2841851746 Bacteria 7532261
303 2841866392 2841864319 Bacteria 6742987
304 2841946081 2841941048 Bacteria 8688029
305 2842234332 2842229732 Bacteria 7475766
306 2842247854 2842243621 Bacteria 7421798
307 2842259449 2842257432 Bacteria 7401195
308 2842414501 2842409023 Bacteria 6687331
309 2842421570 2842415677 Bacteria 6596907
310 2842523914 2842521101 Bacteria 6569494
311 2844459777 2844454524 Bacteria 7952546
312 2855872797 2855872281 Bacteria 6964271
313 2896385486 2896384573 Bacteria 7700774
314 2919176145 2919171160 Bacteria 6499771
315 2922397878 2922393267 Bacteria 8285685
316 2937024507 2937023124 Bacteria 6815156
317 2957385665 2957382221 Bacteria 6737050
318 2957400691 2957395598 Bacteria 6822399
319 2957406039 2957402308 Bacteria 6741770
320 2964620884 2964615318 Bacteria 6809089
321 2967756140 2967755722 Bacteria 6814706
322 2970103911 2970102677 Bacteria 6812532
323 3005490787 3005483717 Bacteria 7877331
324 643824804 643692032 Bacteria 6891900
325 8005386720 8005382845 Bacteria 6732062
326 8005386986 8005382845 Bacteria 6732062
327 Ga0214543_1014631
328 JGI25158J39367_1000940
329 JGI25158J39367_1002335
330 JGI25159J45721_1000026
331 JGI25160J50197_1000013
332 JGI25161J50226_1001386
333 JGI25404J52841_10001243
334 Ga0055531_10001692
335 Ga0055543_1000132
336 Ga0065165_1000021
337 Ga0065165_1005494
338 Ga0070690_100047368
339 Ga0070677_10041216
340 Ga0068869_100168055
341 Ga0070660_100348933
342 Ga0070689_100124621
343 Ga0070687_100271621
344 Ga0070669_100142745
345 Ga0070669_100316211
346 Ga0070671_100017825
347 Ga0070671_100370558
348 Ga0070674_100200569
349 Ga0070673_100000963
350 Ga0070673_100122642
351 Ga0070688_100012965
352 Ga0070659_100090962
353 Ga0070667_100236646
354 Ga0070714_100133793
355 Ga0070713_100030829
356 Ga0070678_100085058
357 Ga0070698_100100570
358 Ga0070684_100038824
359 Ga0070672_100127816
360 Ga0070686_100012798
361 Ga0070665_100068364
362 Ga0070664_100067446
363 Ga0068857_100464589
364 Ga0068856_100103569
365 Ga0068859_100070666
366 Ga0068864_100060229
367 Ga0068864_100595987
368 Ga0068863_100591044
369 Ga0068860_100265578
370 Ga0081455_10002165
371 Ga0081539_10006509
372 Ga0070716_100023817
373 Ga0070712_100047678
374 Ga0097621_100238240
375 Ga0075430_100099741
376 Ga0075431_100139402
377 Ga0075433_10115075
378 Ga0075434_100060492
379 Ga0075434_100177553
380 Ga0075434_100439185
381 Ga0097620_100070664
382 Ga0079104_1000183
383 Ga0099794_10009307
384 Ga0099794_10079536
385 Ga0099795_10001516
386 Ga0105240_10013711
387 Ga0105240_10345326
388 Ga0111539_10108009
389 Ga0111539_10514489
390 Ga0105245_10046581
391 Ga0105245_10126367
392 Ga0105245_10280166
393 Ga0105247_10061800
394 Ga0105248_10008575
395 Ga0105248_10078911
396 Ga0105238_10018088
397 Ga0105239_10219026
398 Ga0105239_10222110
399 Ga0105239_10549509
400 Ga0157374_10155203
401 Ga0163162_10187678
402 Ga0163163_10000318
403 Ga0163163_10054827
404 Ga0157377_10292899
405 Ga0157379_10070150
406 Ga0214544_1000030
407 Ga0214544_1000097
408 Ga0214542_1000026
409 Ga0214542_1007350
410 Ga0214545_1000015
411 Ga0214543_1000036
412 Ga0209436_100024
413 Ga0209673_1000905
414 Ga0209130_1000039
415 Ga0209758_1002277
416 Ga0209050_1032874
417 Ga0209256_1008639
418 Ga0207426_1000099
419 Ga0209257_1001965
420 Ga0207710_10088647
421 Ga0207645_10009782
422 Ga0207695_10361440
423 Ga0207693_10100007
424 Ga0207662_10078291
425 Ga0207662_10185751
426 Ga0207649_10043374
427 Ga0207694_10042152
428 Ga0207650_10000973
429 Ga0207687_10038260
430 Ga0207687_10244909
431 Ga0207664_10136517
432 Ga0207644_10006443
433 Ga0207709_10046376
434 Ga0207670_10109414
435 Ga0207665_10035886
436 Ga0207691_10014062
437 Ga0207711_10043016
438 Ga0207711_10303420
439 Ga0207661_10373036
440 Ga0207651_10003178
441 Ga0207651_10382365
442 Ga0207651_10426525
443 Ga0207658_10206864
444 Ga0207703_10028300
445 Ga0207703_10458531
446 Ga0207648_10050943
447 Ga0207676_10016220
448 Ga0207674_10066356
449 Ga0207683_10003984
450 Ga0209281_1000295
451 Ga0209588_1001835
452 Ga0207428_10023271
453 Ga0207428_10024442
454 Ga0268264_10171509
455 Ga0265330_10013355
456 Ga0265330_10020904
457 Ga0265332_10021052
458 Ga0265320_10007608
459 Ga0265325_10036860
460 Ga0265325_10053002
461 Ga0265325_10078686
462 Ga0265329_10011122
463 Ga0265340_10124048
464 Ga0265339_10060387
465 Ga0265331_10080978
466 Ga0265316_10092834
467 Ga0265316_10284579
468 Ga0265316_10288627
469 Ga0307509_10331621
470 Ga0265314_10152448
471 Ga0265314_10163207
472 Ga0373934_0034651
473 Ga0373923_0000332
474 Ga0373953_0000796
475 Ga0373954_0000359
476 Ga0373954_0012234
477 Ga0373954_0055073
478 Ga0373956_0056575
479 Ga0373957_0000584
480 Ga0373957_0036176
481 Ga0373955_0101599
482 Ga0373955_0230286
483 Ga0373924_0014688
484 Ga0373924_0020639
485 Ga0373935_0192523
486 Ga0373935_0300985
487 Ga0373927_0039594
488 Ga0373933_0002349
489 Ga0373933_0060304
490 Ga0373933_0085494
491 Ga0373937_0004738
492 Ga0373937_0006342
493 Ga0373937_0024328
494 Ga0373937_0080052
495 Ga0373925_0416529
496 Ga0436364_0459773
497 Ga0436365_0562553
498 Ga0436365_1928201
499 Ga0439465_0025347
500 Ga0466972_0099384
501 Ga0495592_0000710
502 Ga0495592_0102100
503 Ga0495603_0016886
504 Ga0495629_0031268
505 Ga0495629_0107201
506 Ga0495651_0018068
507 Ga0495651_0151550
508 Ga0495653_0000729
509 Ga0495653_0063827
510 Ga0495664_0022631
511 Ga0495608_0000921
512 Ga0495608_0080777
513 Ga0495608_0091338
514 Ga0495618_0032149
515 Ga0495628_0006699
516 Ga0495628_0062896
517 Ga0495630_0124509
518 Ga0495652_0008596
519 Ga0495652_0118855
520 Ga0495640_0002672
521 Ga0495640_0029797
522 Ga0495586_0029388
523 Ga0495587_0012062
524 Ga0495587_0016325
525 Ga0495587_0030331
526 Ga0495645_0039443
527 Ga0495645_0046688
528 Ga0495667_0011209
529 Ga0495667_0029170
530 Ga0495667_0065914
531 Ga0495635_0002229
532 Ga0495635_0075580
533 Ga0495635_0344830
534 Ga0495657_0012393
535 Ga0495599_0003285
536 Ga0495599_0008230
537 Ga0495599_0053122
538 Ga0495623_0025928
539 Ga0495623_0036510
540 Ga0495646_0003902
541 Ga0495646_0030511
542 Ga0495658_0123538
543 Ga0495613_0038342
544 Ga0495613_0085329
545 Ga0495600_0008208
546 Ga0495600_0086862
547 Ga0495581_0067582
548 Ga0495604_0010253
549 Ga0495604_0081661
550 Ga0495674_0024868
551 Ga0495674_0091723
552 Ga0495680_0015102
553 Ga0495680_0020795
554 Ga0495675_0002709
555 Ga0495685_112234
556 Ga0495684_0000104
557 Ga0495684_0043058
558 Ga0495684_0403319
559 Ga0495593_0001792
560 Ga0495602_0018322
561 Ga0495602_0033407
562 Ga0496102_0501749
563 Ga0496104_0005007
564 Ga0496104_0020410
565 Ga0496104_0218491
566 Ga0496104_0372626
567 Ga0496106_0018205
568 Ga0496107_0060354
569 Ga0496108_0001304
570 Ga0496108_0039477
571 Ga0496109_0005480
572 Ga0496109_0005799
573 Ga0496109_0262807
574 Ga0496110_0009849
575 Ga0496110_0019801
576 Ga0496111_0215452
577 Ga0496112_0003458
578 Ga0496112_0026080
579 Ga0496112_0061056
580 Ga0496112_0330405
581 Ga0496113_0001813
582 Ga0496113_0067309
583 Ga0496113_0067402
584 Ga0496115_0216836
585 Ga0496115_0220322
586 Ga0496126_0081290
587 Ga0501039_0057857
588 Ga0501040_0110621
589 Ga0501069_0079313
590 Ga0501075_0038199
591 Ga0501077_0004617
592 Ga0501079_0005504
593 Ga0501080_0015570
594 Ga0501081_0056255
595 Ga0501044_0202771
596 Ga0501045_0339876
597 nmdc:mga07m45_65359_c1
598 nmdc:mga05p37_22586_c1
599 nmdc:mga05p37_80180_c1
600 nmdc:mga06r32_2748_c1
601 nmdc:mga08y16_82869_c1
602 nmdc:mga0n895_90402_c1
603 nmdc:mga0rr50_36155_c1
604 nmdc:mga0a205_239190_c1
605 Ga0495601_0010665
606 Ga0495601_0230542
607 Ga0495612_0012674
608 Ga0500635_0010733
609 Ga0495595_0028133
610 Ga0495619_0000727
611 Ga0500554_002967
612 Ga0500593_021108
613 Ga0500642_0095466
614 Ga0500616_0011069
615 Ga0500616_0022410
616 Ga0500616_0040498
617 Ga0501082_0022697
618 Ga0501082_0189013
619 Ga0501082_0432069
620 2509392851
621 2644068964
622 2644420035
623 2644453442
624 2644692141
625 2792643840
626 2824603812
627 2838746214
628 2841858126
629 2841866392
630 2841946081
631 2842234332
632 2842247854
633 2842259449
634 2842414501
635 2842421570
636 2842523914
637 2844459777
638 2855872797
639 2896385486
640 2919176145
641 2922397878
642 2937024507
643 2957385665
644 2957400691
645 2957406039
646 2964620884
647 2967756140
648 2970103911
649 3005490787
650 643824804
651 8005386720
652 8005386986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

52

222

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

229

330

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9619 1 285
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9618 1 285
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9617 1 286
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9603 1 285
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9599 1 285
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9689 60 173 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9636 67 172 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.962 61 172 3.30.465.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9516 4 55 3.30.43.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.946 61 172 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A0T6Z482-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9923 80 295 GO:0016491
GO:0071949
AF-A0A0T6Z482-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9877 80 295 GO:0016491
GO:0071949
AF-A0A257DC85-F1-model_v4 Carbon monoxide dehydrogenase 0.9736 1 286 GO:0016491
GO:0071949
AF-A0A7W4W0Q9-F1-model_v4 CO/xanthine dehydrogenase FAD-binding subunit 0.9729 1 293 GO:0016491
GO:0071949
AF-A0A3E0KGJ9-F1-model_v4 Molybdopterin dehydrogenase 0.9725 1 232 GO:0016491
GO:0071949

Map