F408314
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 145 | 320 | 508 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10030381|Ga0157372_100303814 |
| Length | 555 |
| Sequence | MTETFSPEPDRSTDHLARADQTTFDKALRRGTFSRENASQSGMAKPRLHKTFKGKRRRHSIIAFEMIRLDRAAAEPLHQQLYRQIRDELISGNVNDGAARLPSSRSLAHDLGISRLTVNLALSKLTTEGYLRSRVGSGTFVAHPLPETYLSAQKPTSNRQVERPPRLSNRVRNIQDKRAGKQFDFGIAGAPGVSFVPALAALDEFPIDTWERLRAQVLSRKGAHLLQYASSRGDVDLRKAIAAYLCDYRGARCHPDQIIITAGTQQAMMIAAMALVNRGEIAWMEDPGFYQARRVFSFAGATVVPRPVDREGIVIGHPTKKSSPKIIYVTPSHQFPLGMTMSLARRTALIDFARDRDAYIFEDDHNSEFRFTGPPLPCLQGLDHCGRVIYAGTFSKILYPSLRLGYLLVPEQLVDAMIKIRAVTDQHSPAIDQATMARFLTEGFFLSHIKRMRKLYSDRREFFIEHFNGLLGKYFRLEIPEAGLHFVAWVKRPKDLPGIMAVCSEIGIRPTPLSSCFIKAKLDPALTFGFAAWSRAQIREGLTKFASALHARLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.06 |
| Rhizosphere | 92.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10000065 | 3300003911 | Bacteria | 11716 |
| 2 | JGI25405J52794_10002978 | 3300003911 | Bacteria | 2946 |
| 3 | JGI25405J52794_10004178 | 3300003911 | Bacteria | 2566 |
| 4 | Ga0065704_10103115 | 3300005289 | Unclassified | 2182 |
| 5 | Ga0065712_10002575 | 3300005290 | Bacteria | 5054 |
| 6 | Ga0065712_10003383 | 3300005290 | Bacteria | 5339 |
| 7 | Ga0065712_10008555 | 3300005290 | Bacteria | 3119 |
| 8 | Ga0065712_10011966 | 3300005290 | Bacteria | 2633 |
| 9 | Ga0065712_10012170 | 3300005290 | Bacteria | 2092 |
| 10 | Ga0065715_10002096 | 3300005293 | Bacteria | 9330 |
| 11 | Ga0065715_10004216 | 3300005293 | Bacteria | 6468 |
| 12 | Ga0065715_10005624 | 3300005293 | Bacteria | 6006 |
| 13 | Ga0065715_10017433 | 3300005293 | Unclassified | 1801 |
| 14 | Ga0065707_10008501 | 3300005295 | Unclassified | 2628 |
| 15 | Ga0070676_10017439 | 3300005328 | Bacteria | 3974 |
| 16 | Ga0070690_100034239 | 3300005330 | Bacteria | 3183 |
| 17 | Ga0070690_100053844 | 3300005330 | Bacteria | 2575 |
| 18 | Ga0070690_100062563 | 3300005330 | Bacteria | 2400 |
| 19 | Ga0070670_100006841 | 3300005331 | Bacteria | 9660 |
| 20 | Ga0070670_100098462 | 3300005331 | Unclassified | 2516 |
| 21 | Ga0070666_10013040 | 3300005335 | Bacteria | 5263 |
| 22 | Ga0068868_100016118 | 3300005338 | Bacteria | 5544 |
| 23 | Ga0070689_100022157 | 3300005340 | Unclassified | 4741 |
| 24 | Ga0070689_100048388 | 3300005340 | Bacteria | 3279 |
| 25 | Ga0070668_100008317 | 3300005347 | Bacteria | 7702 |
| 26 | Ga0070668_100038713 | 3300005347 | Bacteria | 3646 |
| 27 | Ga0070668_100053100 | 3300005347 | Bacteria | 3126 |
| 28 | Ga0070669_100016893 | 3300005353 | Bacteria | 5210 |
| 29 | Ga0070669_100085870 | 3300005353 | Bacteria | 2350 |
| 30 | Ga0070669_100131033 | 3300005353 | Bacteria | 1924 |
| 31 | Ga0070675_100005376 | 3300005354 | Bacteria | 9786 |
| 32 | Ga0070675_100015131 | 3300005354 | Bacteria | 6092 |
| 33 | Ga0070675_100021297 | 3300005354 | Bacteria | 5180 |
| 34 | Ga0070675_100110174 | 3300005354 | Bacteria | 2328 |
| 35 | Ga0070675_100144591 | 3300005354 | Bacteria | 2035 |
| 36 | Ga0070671_100005953 | 3300005355 | Bacteria | 9715 |
| 37 | Ga0070671_100010467 | 3300005355 | Bacteria | 7441 |
| 38 | Ga0070671_100037401 | 3300005355 | Bacteria | 4025 |
| 39 | Ga0070671_100125271 | 3300005355 | Unclassified | 2163 |
| 40 | Ga0070674_100007164 | 3300005356 | Bacteria | 6560 |
| 41 | Ga0070674_100052354 | 3300005356 | Bacteria | 2816 |
| 42 | Ga0070673_100020120 | 3300005364 | Unclassified | 4807 |
| 43 | Ga0070673_100050852 | 3300005364 | Bacteria | 3242 |
| 44 | Ga0070673_100097531 | 3300005364 | Unclassified | 2414 |
| 45 | Ga0070688_100002046 | 3300005365 | Bacteria | 10174 |
| 46 | Ga0070667_100034922 | 3300005367 | Bacteria | 4210 |
| 47 | Ga0070709_10035564 | 3300005434 | Bacteria | 3028 |
| 48 | Ga0070709_10088446 | 3300005434 | Unclassified | 2038 |
| 49 | Ga0070713_100078269 | 3300005436 | Bacteria | 2814 |
| 50 | Ga0070713_100173416 | 3300005436 | Bacteria | 1933 |
| 51 | Ga0070710_10044735 | 3300005437 | Bacteria | 2457 |
| 52 | Ga0070701_10042325 | 3300005438 | Unclassified | 2324 |
| 53 | Ga0070711_100025431 | 3300005439 | Bacteria | 3874 |
| 54 | Ga0070711_100051857 | 3300005439 | Bacteria | 2820 |
| 55 | Ga0070711_100072791 | 3300005439 | Bacteria | 2425 |
| 56 | Ga0070711_100088316 | 3300005439 | Bacteria | 2227 |
| 57 | Ga0070700_100053050 | 3300005441 | Unclassified | 2530 |
| 58 | Ga0070708_100091989 | 3300005445 | Bacteria | 2763 |
| 59 | Ga0070708_100096898 | 3300005445 | Bacteria | 2695 |
| 60 | Ga0070708_100124293 | 3300005445 | Bacteria | 2383 |
| 61 | Ga0070708_100153088 | 3300005445 | Bacteria | 2145 |
| 62 | Ga0070663_100020482 | 3300005455 | Unclassified | 4380 |
| 63 | Ga0070678_100006535 | 3300005456 | Bacteria | 6846 |
| 64 | Ga0070678_100063855 | 3300005456 | Unclassified | 2726 |
| 65 | Ga0070662_100036090 | 3300005457 | Bacteria | 3495 |
| 66 | Ga0070662_100036463 | 3300005457 | Bacteria | 3479 |
| 67 | Ga0070662_100044456 | 3300005457 | Unclassified | 3181 |
| 68 | Ga0070706_100001926 | 3300005467 | Bacteria | 21396 |
| 69 | Ga0070706_100003303 | 3300005467 | Bacteria | 15949 |
| 70 | Ga0070706_100003887 | 3300005467 | Bacteria | 14581 |
| 71 | Ga0070706_100009594 | 3300005467 | Bacteria | 9000 |
| 72 | Ga0070706_100044260 | 3300005467 | Bacteria | 4111 |
| 73 | Ga0070706_100052223 | 3300005467 | Bacteria | 3773 |
| 74 | Ga0070707_100016201 | 3300005468 | Bacteria | 6995 |
| 75 | Ga0070707_100021654 | 3300005468 | Bacteria | 6077 |
| 76 | Ga0070707_100034193 | 3300005468 | Bacteria | 4847 |
| 77 | Ga0070707_100036095 | 3300005468 | Bacteria | 4716 |
| 78 | Ga0070707_100044955 | 3300005468 | Bacteria | 4227 |
| 79 | Ga0070707_100052442 | 3300005468 | Bacteria | 3910 |
| 80 | Ga0070707_100081247 | 3300005468 | Bacteria | 3129 |
| 81 | Ga0070707_100084790 | 3300005468 | Unclassified | 3062 |
| 82 | Ga0070707_100169065 | 3300005468 | Bacteria | 2131 |
| 83 | Ga0070698_100064178 | 3300005471 | Bacteria | 3701 |
| 84 | Ga0070698_100173178 | 3300005471 | Unclassified | 2098 |
| 85 | Ga0070698_100241548 | 3300005471 | Bacteria | 1739 |
| 86 | Ga0070699_100060773 | 3300005518 | Bacteria | 3275 |
| 87 | Ga0070699_100063486 | 3300005518 | Unclassified | 3203 |
| 88 | Ga0070684_100001068 | 3300005535 | Bacteria | 19615 |
| 89 | Ga0070684_100030455 | 3300005535 | Unclassified | 4584 |
| 90 | Ga0070684_100070234 | 3300005535 | Bacteria | 3081 |
| 91 | Ga0070697_100027671 | 3300005536 | Bacteria | 4537 |
| 92 | Ga0070697_100069096 | 3300005536 | Unclassified | 2893 |
| 93 | Ga0070672_100067701 | 3300005543 | Bacteria | 2830 |
| 94 | Ga0070686_100067379 | 3300005544 | Bacteria | 2332 |
| 95 | Ga0070696_100035418 | 3300005546 | Bacteria | 3437 |
| 96 | Ga0070665_100074168 | 3300005548 | Unclassified | 3408 |
| 97 | Ga0070665_100151898 | 3300005548 | Bacteria | 2318 |
| 98 | Ga0070665_100238555 | 3300005548 | Bacteria | 1819 |
| 99 | Ga0070664_100017227 | 3300005564 | Bacteria | 5933 |
| 100 | Ga0070664_100095855 | 3300005564 | Unclassified | 2574 |
| 101 | Ga0068856_100140996 | 3300005614 | Bacteria | 2418 |
| 102 | Ga0068859_100003179 | 3300005617 | Bacteria | 16711 |
| 103 | Ga0068866_10046564 | 3300005718 | Bacteria | 2182 |
| 104 | Ga0081455_10000385 | 3300005937 | Bacteria | 58366 |
| 105 | Ga0081455_10002288 | 3300005937 | Bacteria | 22855 |
| 106 | Ga0081455_10007236 | 3300005937 | Bacteria | 11721 |
| 107 | Ga0081455_10014762 | 3300005937 | Bacteria | 7623 |
| 108 | Ga0081455_10018839 | 3300005937 | Bacteria | 6547 |
| 109 | Ga0081455_10034009 | 3300005937 | Bacteria | 4573 |
| 110 | Ga0081455_10070788 | 3300005937 | Bacteria | 2894 |
| 111 | Ga0081455_10175306 | 3300005937 | Unclassified | 1629 |
| 112 | Ga0081540_1000152 | 3300005983 | Bacteria | 70858 |
| 113 | Ga0081540_1030042 | 3300005983 | Unclassified | 3016 |
| 114 | Ga0081539_10014875 | 3300005985 | Bacteria | 5712 |
| 115 | Ga0070717_10014397 | 3300006028 | Bacteria | 6085 |
| 116 | Ga0070717_10029758 | 3300006028 | Bacteria | 4385 |
| 117 | Ga0070717_10083697 | 3300006028 | Bacteria | 2683 |
| 118 | Ga0070715_10014135 | 3300006163 | Bacteria | 2949 |
| 119 | Ga0070715_10046064 | 3300006163 | Unclassified | 1852 |
| 120 | Ga0070712_100006774 | 3300006175 | Bacteria | 7128 |
| 121 | Ga0070712_100008603 | 3300006175 | Bacteria | 6423 |
| 122 | Ga0070712_100037541 | 3300006175 | Unclassified | 3304 |
| 123 | Ga0070712_100145428 | 3300006175 | Bacteria | 1814 |
| 124 | Ga0097621_100012301 | 3300006237 | Bacteria | 6335 |
| 125 | Ga0097621_100173375 | 3300006237 | Unclassified | 1860 |
| 126 | Ga0068871_100042299 | 3300006358 | Bacteria | 3657 |
| 127 | Ga0075428_100104683 | 3300006844 | Bacteria | 3086 |
| 128 | Ga0097620_100003179 | 3300006931 | Bacteria | 16711 |
| 129 | Ga0099795_10008251 | 3300007788 | Bacteria | 2960 |
| 130 | Ga0111539_10109024 | 3300009094 | Unclassified | 3249 |
| 131 | Ga0111539_10208875 | 3300009094 | Bacteria | 2275 |
| 132 | Ga0105245_10154885 | 3300009098 | Bacteria | 2170 |
| 133 | Ga0114129_10009497 | 3300009147 | Bacteria | 13870 |
| 134 | Ga0114129_10015127 | 3300009147 | Bacteria | 10981 |
| 135 | Ga0114129_10184161 | 3300009147 | Bacteria | 2840 |
| 136 | Ga0105242_10072543 | 3300009176 | Bacteria | 2859 |
| 137 | Ga0105249_10037239 | 3300009553 | Unclassified | 4415 |
| 138 | Ga0105239_10238907 | 3300010375 | Unclassified | 2039 |
| 139 | Ga0157374_10012955 | 3300013296 | Bacteria | 7269 |
| 140 | Ga0157374_10037864 | 3300013296 | Unclassified | 4430 |
| 141 | Ga0157374_10098288 | 3300013296 | Bacteria | 2802 |
| 142 | Ga0157374_10157158 | 3300013296 | Unclassified | 2213 |
| 143 | Ga0157378_10065871 | 3300013297 | Bacteria | 3243 |
| 144 | Ga0157378_10125277 | 3300013297 | Bacteria | 2373 |
| 145 | Ga0157378_10191327 | 3300013297 | Unclassified | 1930 |
| 146 | Ga0163162_10020409 | 3300013306 | Bacteria | 6511 |
| 147 | Ga0163162_10029487 | 3300013306 | Bacteria | 5430 |
| 148 | Ga0163162_10037428 | 3300013306 | Unclassified | 4842 |
| 149 | Ga0163162_10038017 | 3300013306 | Bacteria | 4804 |
| 150 | Ga0163162_10044220 | 3300013306 | Unclassified | 4460 |
| 151 | Ga0163162_10197465 | 3300013306 | Bacteria | 2141 |
| 152 | Ga0157372_10030381 | 3300013307 | Bacteria | 5912 |
| 153 | Ga0157375_10001548 | 3300013308 | Bacteria | 19783 |
| 154 | Ga0157375_10009424 | 3300013308 | Bacteria | 8569 |
| 155 | Ga0157375_10106556 | 3300013308 | Bacteria | 2895 |
| 156 | Ga0157375_10132379 | 3300013308 | Unclassified | 2614 |
| 157 | Ga0157375_10150048 | 3300013308 | Unclassified | 2466 |
| 158 | Ga0163163_10064253 | 3300014325 | Bacteria | 3641 |
| 159 | Ga0163163_10124995 | 3300014325 | Unclassified | 2609 |
| 160 | Ga0157379_10028693 | 3300014968 | Unclassified | 4949 |
| 161 | Ga0163161_10013937 | 3300017792 | Bacteria | 5599 |
| 162 | Ga0163161_10098919 | 3300017792 | Bacteria | 2169 |
| 163 | Ga0207666_1000279 | 3300025271 | Bacteria | 7292 |
| 164 | Ga0207673_1000356 | 3300025290 | Unclassified | 4624 |
| 165 | Ga0207673_1001430 | 3300025290 | Unclassified | 2608 |
| 166 | Ga0207697_10000438 | 3300025315 | Bacteria | 23468 |
| 167 | Ga0207697_10001111 | 3300025315 | Bacteria | 14826 |
| 168 | Ga0207697_10002314 | 3300025315 | Bacteria | 9919 |
| 169 | Ga0207697_10003112 | 3300025315 | Bacteria | 8298 |
| 170 | Ga0207697_10005743 | 3300025315 | Bacteria | 5720 |
| 171 | Ga0207697_10005972 | 3300025315 | Bacteria | 5580 |
| 172 | Ga0207697_10011556 | 3300025315 | Bacteria | 3732 |
| 173 | Ga0207697_10011792 | 3300025315 | Bacteria | 3687 |
| 174 | Ga0207697_10012855 | 3300025315 | Unclassified | 3502 |
| 175 | Ga0207697_10013116 | 3300025315 | Bacteria | 3462 |
| 176 | Ga0207642_10019935 | 3300025899 | Bacteria | 2608 |
| 177 | Ga0207688_10004490 | 3300025901 | Bacteria | 7597 |
| 178 | Ga0207688_10005408 | 3300025901 | Bacteria | 6941 |
| 179 | Ga0207680_10022996 | 3300025903 | Bacteria | 3398 |
| 180 | Ga0207680_10056588 | 3300025903 | Bacteria | 2369 |
| 181 | Ga0207647_10004405 | 3300025904 | Bacteria | 10442 |
| 182 | Ga0207685_10020559 | 3300025905 | Bacteria | 2197 |
| 183 | Ga0207699_10100654 | 3300025906 | Unclassified | 1833 |
| 184 | Ga0207645_10008104 | 3300025907 | Bacteria | 7363 |
| 185 | Ga0207645_10017146 | 3300025907 | Unclassified | 4784 |
| 186 | Ga0207645_10076144 | 3300025907 | Unclassified | 2148 |
| 187 | Ga0207645_10078699 | 3300025907 | Bacteria | 2112 |
| 188 | Ga0207684_10000086 | 3300025910 | Bacteria | 173807 |
| 189 | Ga0207684_10000186 | 3300025910 | Bacteria | 98342 |
| 190 | Ga0207684_10002487 | 3300025910 | Bacteria | 18534 |
| 191 | Ga0207684_10003013 | 3300025910 | Bacteria | 16696 |
| 192 | Ga0207684_10017955 | 3300025910 | Bacteria | 6062 |
| 193 | Ga0207684_10031620 | 3300025910 | Unclassified | 4501 |
| 194 | Ga0207684_10036340 | 3300025910 | Bacteria | 4182 |
| 195 | Ga0207684_10175736 | 3300025910 | Bacteria | 1846 |
| 196 | Ga0207707_10009207 | 3300025912 | Bacteria | 8571 |
| 197 | Ga0207693_10016156 | 3300025915 | Bacteria | 5970 |
| 198 | Ga0207693_10043785 | 3300025915 | Bacteria | 3519 |
| 199 | Ga0207693_10077665 | 3300025915 | Bacteria | 2600 |
| 200 | Ga0207693_10078066 | 3300025915 | Bacteria | 2592 |
| 201 | Ga0207663_10054719 | 3300025916 | Bacteria | 2500 |
| 202 | Ga0207662_10006736 | 3300025918 | Bacteria | 6214 |
| 203 | Ga0207657_10028248 | 3300025919 | Bacteria | 5120 |
| 204 | Ga0207646_10041444 | 3300025922 | Bacteria | 4139 |
| 205 | Ga0207646_10062566 | 3300025922 | Bacteria | 3322 |
| 206 | Ga0207646_10082233 | 3300025922 | Bacteria | 2880 |
| 207 | Ga0207646_10145304 | 3300025922 | Bacteria | 2137 |
| 208 | Ga0207681_10045208 | 3300025923 | Unclassified | 2955 |
| 209 | Ga0207681_10061286 | 3300025923 | Bacteria | 2585 |
| 210 | Ga0207681_10105371 | 3300025923 | Unclassified | 2041 |
| 211 | Ga0207659_10005881 | 3300025926 | Bacteria | 7487 |
| 212 | Ga0207659_10024637 | 3300025926 | Bacteria | 4035 |
| 213 | Ga0207659_10059505 | 3300025926 | Unclassified | 2746 |
| 214 | Ga0207659_10077748 | 3300025926 | Unclassified | 2443 |
| 215 | Ga0207700_10021405 | 3300025928 | Unclassified | 4414 |
| 216 | Ga0207700_10025689 | 3300025928 | Bacteria | 4095 |
| 217 | Ga0207644_10003514 | 3300025931 | Bacteria | 10145 |
| 218 | Ga0207644_10028673 | 3300025931 | Bacteria | 3856 |
| 219 | Ga0207644_10029126 | 3300025931 | Unclassified | 3828 |
| 220 | Ga0207644_10110253 | 3300025931 | Unclassified | 2080 |
| 221 | Ga0207690_10004400 | 3300025932 | Bacteria | 8317 |
| 222 | Ga0207690_10058584 | 3300025932 | Bacteria | 2605 |
| 223 | Ga0207706_10015831 | 3300025933 | Bacteria | 6819 |
| 224 | Ga0207706_10039457 | 3300025933 | Bacteria | 4186 |
| 225 | Ga0207706_10050499 | 3300025933 | Bacteria | 3675 |
| 226 | Ga0207706_10056365 | 3300025933 | Bacteria | 3465 |
| 227 | Ga0207706_10062114 | 3300025933 | Bacteria | 3290 |
| 228 | Ga0207686_10118131 | 3300025934 | Bacteria | 1800 |
| 229 | Ga0207670_10022473 | 3300025936 | Unclassified | 3910 |
| 230 | Ga0207670_10053287 | 3300025936 | Unclassified | 2724 |
| 231 | Ga0207665_10004292 | 3300025939 | Bacteria | 9477 |
| 232 | Ga0207665_10007042 | 3300025939 | Bacteria | 7448 |
| 233 | Ga0207665_10018787 | 3300025939 | Unclassified | 4542 |
| 234 | Ga0207665_10020888 | 3300025939 | Unclassified | 4304 |
| 235 | Ga0207665_10023343 | 3300025939 | Bacteria | 4075 |
| 236 | Ga0207691_10006878 | 3300025940 | Bacteria | 10974 |
| 237 | Ga0207691_10010382 | 3300025940 | Bacteria | 8934 |
| 238 | Ga0207691_10106313 | 3300025940 | Bacteria | 2500 |
| 239 | Ga0207691_10129956 | 3300025940 | Unclassified | 2225 |
| 240 | Ga0207691_10162759 | 3300025940 | Bacteria | 1957 |
| 241 | Ga0207679_10064249 | 3300025945 | Unclassified | 2743 |
| 242 | Ga0207651_10044404 | 3300025960 | Bacteria | 2974 |
| 243 | Ga0207668_10024684 | 3300025972 | Unclassified | 3883 |
| 244 | Ga0207668_10105235 | 3300025972 | Unclassified | 2105 |
| 245 | Ga0207677_10055080 | 3300026023 | Unclassified | 2717 |
| 246 | Ga0207677_10090952 | 3300026023 | Bacteria | 2218 |
| 247 | Ga0207703_10149241 | 3300026035 | Unclassified | 2037 |
| 248 | Ga0207678_10009753 | 3300026067 | Bacteria | 8444 |
| 249 | Ga0207678_10050828 | 3300026067 | Bacteria | 3580 |
| 250 | Ga0207708_10120133 | 3300026075 | Unclassified | 2047 |
| 251 | Ga0207702_10021761 | 3300026078 | Bacteria | 5310 |
| 252 | Ga0207641_10012208 | 3300026088 | Bacteria | 7050 |
| 253 | Ga0207641_10233741 | 3300026088 | Bacteria | 1710 |
| 254 | Ga0207648_10024001 | 3300026089 | Bacteria | 5450 |
| 255 | Ga0207648_10061793 | 3300026089 | Unclassified | 3266 |
| 256 | Ga0207683_10005253 | 3300026121 | Bacteria | 11117 |
| 257 | Ga0207683_10046023 | 3300026121 | Unclassified | 3817 |
| 258 | Ga0207683_10050846 | 3300026121 | Bacteria | 3631 |
| 259 | Ga0207683_10057482 | 3300026121 | Unclassified | 3415 |
| 260 | Ga0207683_10064239 | 3300026121 | Bacteria | 3235 |
| 261 | Ga0207683_10148694 | 3300026121 | Unclassified | 2113 |
| 262 | Ga0268266_10094816 | 3300028379 | Unclassified | 2620 |
| 263 | Ga0268266_10112498 | 3300028379 | Bacteria | 2414 |
| 264 | Ga0268266_10121934 | 3300028379 | Bacteria | 2321 |
| 265 | Ga0268266_10148741 | 3300028379 | Unclassified | 2109 |
| 266 | Ga0373943_0066994 | 3300035170 | Bacteria | 1810 |
| 267 | Ga0373946_0031616 | 3300035171 | Bacteria | 2122 |
| 268 | Ga0373935_0033064 | 3300035692 | Bacteria | 3218 |
| 269 | Ga0373935_0102637 | 3300035692 | Bacteria | 1887 |
| 270 | Ga0373947_0010962 | 3300035725 | Bacteria | 5203 |
| 271 | Ga0373947_0050943 | 3300035725 | Bacteria | 2490 |
| 272 | Ga0373947_0081955 | 3300035725 | Bacteria | 1999 |
| 273 | Ga0373937_0010351 | 3300036401 | Bacteria | 8143 |
| 274 | Ga0373925_0137227 | 3300037068 | Bacteria | 1912 |
| 275 | Ga0395900_0005968 | 3300037418 | Bacteria | 12719 |
| 276 | Ga0395900_0005988 | 3300037418 | Bacteria | 12697 |
| 277 | Ga0395900_0043365 | 3300037418 | Unclassified | 4637 |
| 278 | Ga0395898_0001597 | 3300037466 | Bacteria | 30926 |
| 279 | Ga0395905_0003973 | 3300037471 | Bacteria | 15553 |
| 280 | Ga0395901_0000525 | 3300038443 | Bacteria | 44276 |
| 281 | Ga0451576_0192172 | 3300045051 | Bacteria | 2132 |
| 282 | Ga0495630_0027818 | 3300046517 | Unclassified | 4199 |
| 283 | Ga0495630_0045933 | 3300046517 | Bacteria | 3264 |
| 284 | Ga0495598_0012921 | 3300046537 | Unclassified | 2060 |
| 285 | Ga0495598_0014826 | 3300046537 | Unclassified | 1956 |
| 286 | Ga0495647_0016698 | 3300046681 | Bacteria | 2589 |
| 287 | Ga0495658_0047380 | 3300046683 | Bacteria | 2420 |
| 288 | Ga0495669_0079604 | 3300046684 | Unclassified | 1502 |
| 289 | Ga0495624_0034609 | 3300046690 | Bacteria | 3266 |
| 290 | Ga0495581_0072310 | 3300047315 | Bacteria | 1995 |
| 291 | Ga0495674_0055425 | 3300047319 | Bacteria | 3477 |
| 292 | Ga0495676_0037624 | 3300047321 | Bacteria | 4026 |
| 293 | Ga0495684_0080998 | 3300047471 | Bacteria | 2464 |
| 294 | Ga0496100_0026830 | 3300048903 | Bacteria | 3535 |
| 295 | Ga0496101_0003554 | 3300048904 | Bacteria | 9723 |
| 296 | Ga0496102_0088162 | 3300048905 | Bacteria | 2868 |
| 297 | Ga0496103_0018870 | 3300048906 | Bacteria | 4141 |
| 298 | Ga0496104_0025427 | 3300048907 | Bacteria | 5458 |
| 299 | Ga0496104_0054285 | 3300048907 | Bacteria | 3787 |
| 300 | Ga0496104_0187380 | 3300048907 | Bacteria | 1980 |
| 301 | Ga0496105_0071125 | 3300048908 | Unclassified | 2876 |
| 302 | Ga0496106_0046962 | 3300048909 | Bacteria | 3248 |
| 303 | Ga0496107_0012485 | 3300048910 | Bacteria | 5928 |
| 304 | Ga0496108_0109590 | 3300048911 | Bacteria | 2360 |
| 305 | Ga0496109_0074684 | 3300048912 | Unclassified | 3117 |
| 306 | Ga0496109_0105364 | 3300048912 | Bacteria | 2619 |
| 307 | Ga0496109_0238545 | 3300048912 | Unclassified | 1711 |
| 308 | Ga0496110_0065458 | 3300048913 | Bacteria | 3213 |
| 309 | Ga0496112_0003138 | 3300048915 | Bacteria | 13560 |
| 310 | Ga0496112_0063129 | 3300048915 | Bacteria | 3654 |
| 311 | Ga0496112_0160802 | 3300048915 | Bacteria | 2212 |
| 312 | Ga0496114_0124004 | 3300048917 | Bacteria | 2225 |
| 313 | Ga0496114_0151304 | 3300048917 | Bacteria | 2013 |
| 314 | Ga0496115_0005758 | 3300048918 | Bacteria | 9025 |
| 315 | Ga0496115_0019542 | 3300048918 | Bacteria | 5214 |
| 316 | Ga0496115_0043240 | 3300048918 | Bacteria | 3592 |
| 317 | nmdc:mga05p37_134225_c1 | 3300050507 | Bacteria | 3036 |
| 318 | nmdc:mga05p37_1970_c1 | 3300050507 | Bacteria | 23955 |
| 319 | nmdc:mga0rr50_38897_c1 | 3300050513 | Bacteria | 3446 |
| 320 | nmdc:mga0a205_157468_c1 | 3300050515 | Bacteria | 2169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0074684 | Ga0496109_0074684_1672_2979 | 415 |
| 2 | 3300035725 | Ga0373947_0050943 | Ga0373947_0050943_73_1413 | 446 |
| 3 | 3300037418 | Ga0395900_0043365 | Ga0395900_0043365_1276_2616 | 446 |
| 4 | 3300013306 | Ga0163162_10020409 | Ga0163162_100204095 | 464 |
| 5 | 3300025903 | Ga0207680_10056588 | Ga0207680_100565883 | 464 |
| 6 | 3300005355 | Ga0070671_100010467 | Ga0070671_1000104673 | 466 |
| 7 | 3300005347 | Ga0070668_100008317 | Ga0070668_1000083173 | 468 |
| 8 | 3300005356 | Ga0070674_100052354 | Ga0070674_1000523541 | 468 |
| 9 | 3300013296 | Ga0157374_10157158 | Ga0157374_101571582 | 470 |
| 10 | 3300025315 | Ga0207697_10012855 | Ga0207697_100128553 | 470 |
| 11 | 3300025926 | Ga0207659_10077748 | Ga0207659_100777481 | 470 |
| 12 | 3300025945 | Ga0207679_10064249 | Ga0207679_100642492 | 470 |
| 13 | 3300006237 | Ga0097621_100012301 | Ga0097621_1000123013 | 471 |
| 14 | 3300048907 | Ga0496104_0025427 | Ga0496104_0025427_2382_3905 | 471 |
| 15 | 3300048908 | Ga0496105_0071125 | Ga0496105_0071125_241_1764 | 471 |
| 16 | 3300048917 | Ga0496114_0151304 | Ga0496114_0151304_254_1777 | 471 |
| 17 | 3300048918 | Ga0496115_0005758 | Ga0496115_0005758_2210_3733 | 471 |
| 18 | 3300026089 | Ga0207648_10024001 | Ga0207648_100240014 | 479 |
| 19 | 3300005468 | Ga0070707_100084790 | Ga0070707_1000847902 | 482 |
| 20 | 3300005364 | Ga0070673_100097531 | Ga0070673_1000975312 | 483 |
| 21 | 3300046517 | Ga0495630_0045933 | Ga0495630_0045933_1136_2593 | 485 |
| 22 | 3300046681 | Ga0495647_0016698 | Ga0495647_0016698_357_1814 | 485 |
| 23 | 3300046683 | Ga0495658_0047380 | Ga0495658_0047380_774_2231 | 485 |
| 24 | 3300046690 | Ga0495624_0034609 | Ga0495624_0034609_80_1537 | 485 |
| 25 | 3300047315 | Ga0495581_0072310 | Ga0495581_0072310_423_1880 | 485 |
| 26 | 3300047319 | Ga0495674_0055425 | Ga0495674_0055425_556_2013 | 485 |
| 27 | 3300047321 | Ga0495676_0037624 | Ga0495676_0037624_1251_2708 | 485 |
| 28 | 3300005290 | Ga0065712_10011966 | Ga0065712_100119663 | 486 |
| 29 | 3300005290 | Ga0065712_10012170 | Ga0065712_100121701 | 486 |
| 30 | 3300005293 | Ga0065715_10002096 | Ga0065715_100020967 | 486 |
| 31 | 3300005293 | Ga0065715_10017433 | Ga0065715_100174331 | 486 |
| 32 | 3300005439 | Ga0070711_100072791 | Ga0070711_1000727912 | 486 |
| 33 | 3300005468 | Ga0070707_100169065 | Ga0070707_1001690652 | 486 |
| 34 | 3300005471 | Ga0070698_100064178 | Ga0070698_1000641782 | 486 |
| 35 | 3300013306 | Ga0163162_10044220 | Ga0163162_100442206 | 486 |
| 36 | 3300013308 | Ga0157375_10132379 | Ga0157375_101323792 | 486 |
| 37 | 3300025907 | Ga0207645_10078699 | Ga0207645_100786992 | 486 |
| 38 | 3300025922 | Ga0207646_10145304 | Ga0207646_101453041 | 486 |
| 39 | 3300025933 | Ga0207706_10062114 | Ga0207706_100621142 | 486 |
| 40 | 3300025939 | Ga0207665_10007042 | Ga0207665_100070427 | 486 |
| 41 | 3300025940 | Ga0207691_10106313 | Ga0207691_101063132 | 486 |
| 42 | 3300026088 | Ga0207641_10233741 | Ga0207641_102337411 | 486 |
| 43 | 3300026121 | Ga0207683_10050846 | Ga0207683_100508462 | 486 |
| 44 | 3300035171 | Ga0373946_0031616 | Ga0373946_0031616_364_1824 | 486 |
| 45 | 3300037068 | Ga0373925_0137227 | Ga0373925_0137227_93_1553 | 486 |
| 46 | 3300046684 | Ga0495669_0079604 | Ga0495669_0079604_24_1484 | 486 |
| 47 | 3300047471 | Ga0495684_0080998 | Ga0495684_0080998_231_1691 | 486 |
| 48 | 3300048915 | Ga0496112_0160802 | Ga0496112_0160802_610_2070 | 486 |
| 49 | 3300005467 | Ga0070706_100052223 | Ga0070706_1000522232 | 487 |
| 50 | 3300005468 | Ga0070707_100044955 | Ga0070707_1000449554 | 487 |
| 51 | 3300005536 | Ga0070697_100027671 | Ga0070697_1000276714 | 487 |
| 52 | 3300025315 | Ga0207697_10011556 | Ga0207697_100115562 | 487 |
| 53 | 3300009094 | Ga0111539_10208875 | Ga0111539_102088751 | 488 |
| 54 | 3300037418 | Ga0395900_0005988 | Ga0395900_0005988_1819_3285 | 488 |
| 55 | 3300003911 | JGI25405J52794_10002978 | JGI25405J52794_100029782 | 489 |
| 56 | 3300005436 | Ga0070713_100078269 | Ga0070713_1000782693 | 489 |
| 57 | 3300005548 | Ga0070665_100238555 | Ga0070665_1002385552 | 489 |
| 58 | 3300006175 | Ga0070712_100145428 | Ga0070712_1001454281 | 489 |
| 59 | 3300009098 | Ga0105245_10154885 | Ga0105245_101548852 | 489 |
| 60 | 3300013296 | Ga0157374_10098288 | Ga0157374_100982882 | 489 |
| 61 | 3300013297 | Ga0157378_10125277 | Ga0157378_101252772 | 489 |
| 62 | 3300025915 | Ga0207693_10043785 | Ga0207693_100437853 | 489 |
| 63 | 3300025922 | Ga0207646_10082233 | Ga0207646_100822332 | 489 |
| 64 | 3300026121 | Ga0207683_10046023 | Ga0207683_100460233 | 489 |
| 65 | 3300028379 | Ga0268266_10112498 | Ga0268266_101124982 | 489 |
| 66 | 3300046537 | Ga0495598_0014826 | Ga0495598_0014826_30_1499 | 489 |
| 67 | 3300050513 | nmdc:mga0rr50_38897_c1 | nmdc:mga0rr50_38897_c1_612_2081 | 489 |
| 68 | 3300005330 | Ga0070690_100034239 | Ga0070690_1000342391 | 490 |
| 69 | 3300005546 | Ga0070696_100035418 | Ga0070696_1000354184 | 490 |
| 70 | 3300005718 | Ga0068866_10046564 | Ga0068866_100465642 | 490 |
| 71 | 3300017792 | Ga0163161_10013937 | Ga0163161_100139372 | 490 |
| 72 | 3300025899 | Ga0207642_10019935 | Ga0207642_100199352 | 490 |
| 73 | 3300025905 | Ga0207685_10020559 | Ga0207685_100205592 | 490 |
| 74 | 3300025907 | Ga0207645_10008104 | Ga0207645_100081046 | 490 |
| 75 | 3300025931 | Ga0207644_10028673 | Ga0207644_100286732 | 490 |
| 76 | 3300025939 | Ga0207665_10004292 | Ga0207665_100042927 | 490 |
| 77 | 3300025960 | Ga0207651_10044404 | Ga0207651_100444042 | 490 |
| 78 | 3300035692 | Ga0373935_0033064 | Ga0373935_0033064_1314_2816 | 490 |
| 79 | 3300036401 | Ga0373937_0010351 | Ga0373937_0010351_4730_6205 | 490 |
| 80 | 3300005290 | Ga0065712_10003383 | Ga0065712_100033833 | 491 |
| 81 | 3300005293 | Ga0065715_10004216 | Ga0065715_100042163 | 491 |
| 82 | 3300005340 | Ga0070689_100048388 | Ga0070689_1000483882 | 491 |
| 83 | 3300005353 | Ga0070669_100131033 | Ga0070669_1001310331 | 491 |
| 84 | 3300005434 | Ga0070709_10088446 | Ga0070709_100884462 | 491 |
| 85 | 3300005457 | Ga0070662_100044456 | Ga0070662_1000444562 | 491 |
| 86 | 3300005535 | Ga0070684_100030455 | Ga0070684_1000304554 | 491 |
| 87 | 3300006163 | Ga0070715_10014135 | Ga0070715_100141353 | 491 |
| 88 | 3300006175 | Ga0070712_100037541 | Ga0070712_1000375412 | 491 |
| 89 | 3300007788 | Ga0099795_10008251 | Ga0099795_100082512 | 491 |
| 90 | 3300009147 | Ga0114129_10015127 | Ga0114129_100151277 | 491 |
| 91 | 3300009147 | Ga0114129_10184161 | Ga0114129_101841614 | 491 |
| 92 | 3300014325 | Ga0163163_10064253 | Ga0163163_100642533 | 491 |
| 93 | 3300014325 | Ga0163163_10124995 | Ga0163163_101249952 | 491 |
| 94 | 3300025915 | Ga0207693_10016156 | Ga0207693_100161566 | 491 |
| 95 | 3300026035 | Ga0207703_10149241 | Ga0207703_101492412 | 491 |
| 96 | 3300045051 | Ga0451576_0192172 | Ga0451576_0192172_590_2095 | 491 |
| 97 | 3300046517 | Ga0495630_0027818 | Ga0495630_0027818_969_2468 | 491 |
| 98 | 3300050507 | nmdc:mga05p37_134225_c1 | nmdc:mga05p37_134225_c1_554_2053 | 491 |
| 99 | 3300050507 | nmdc:mga05p37_1970_c1 | nmdc:mga05p37_1970_c1_5741_7222 | 491 |
| 100 | 3300050515 | nmdc:mga0a205_157468_c1 | nmdc:mga0a205_157468_c1_368_1867 | 491 |
| 101 | 3300005330 | Ga0070690_100053844 | Ga0070690_1000538441 | 492 |
| 102 | 3300005365 | Ga0070688_100002046 | Ga0070688_10000204612 | 492 |
| 103 | 3300005467 | Ga0070706_100001926 | Ga0070706_10000192613 | 492 |
| 104 | 3300005544 | Ga0070686_100067379 | Ga0070686_1000673792 | 492 |
| 105 | 3300005614 | Ga0068856_100140996 | Ga0068856_1001409962 | 492 |
| 106 | 3300025290 | Ga0207673_1000356 | Ga0207673_10003566 | 492 |
| 107 | 3300025315 | Ga0207697_10011792 | Ga0207697_100117923 | 492 |
| 108 | 3300025910 | Ga0207684_10000186 | Ga0207684_1000018623 | 492 |
| 109 | 3300025910 | Ga0207684_10017955 | Ga0207684_100179552 | 492 |
| 110 | 3300025915 | Ga0207693_10078066 | Ga0207693_100780662 | 492 |
| 111 | 3300025939 | Ga0207665_10023343 | Ga0207665_100233432 | 492 |
| 112 | 3300026121 | Ga0207683_10057482 | Ga0207683_100574824 | 492 |
| 113 | 3300046537 | Ga0495598_0012921 | Ga0495598_0012921_448_1968 | 492 |
| 114 | 3300048905 | Ga0496102_0088162 | Ga0496102_0088162_461_1981 | 492 |
| 115 | 3300048911 | Ga0496108_0109590 | Ga0496108_0109590_300_1820 | 492 |
| 116 | 3300048912 | Ga0496109_0105364 | Ga0496109_0105364_730_2250 | 492 |
| 117 | 3300005355 | Ga0070671_100125271 | Ga0070671_1001252712 | 493 |
| 118 | 3300005434 | Ga0070709_10035564 | Ga0070709_100355641 | 493 |
| 119 | 3300005439 | Ga0070711_100088316 | Ga0070711_1000883162 | 493 |
| 120 | 3300005445 | Ga0070708_100096898 | Ga0070708_1000968982 | 493 |
| 121 | 3300005468 | Ga0070707_100034193 | Ga0070707_1000341935 | 493 |
| 122 | 3300005471 | Ga0070698_100241548 | Ga0070698_1002415481 | 493 |
| 123 | 3300006175 | Ga0070712_100006774 | Ga0070712_1000067746 | 493 |
| 124 | 3300009147 | Ga0114129_10009497 | Ga0114129_100094977 | 493 |
| 125 | 3300013306 | Ga0163162_10038017 | Ga0163162_100380173 | 493 |
| 126 | 3300025315 | Ga0207697_10013116 | Ga0207697_100131163 | 493 |
| 127 | 3300025906 | Ga0207699_10100654 | Ga0207699_101006541 | 493 |
| 128 | 3300025910 | Ga0207684_10002487 | Ga0207684_1000248712 | 493 |
| 129 | 3300025916 | Ga0207663_10054719 | Ga0207663_100547193 | 493 |
| 130 | 3300025922 | Ga0207646_10062566 | Ga0207646_100625662 | 493 |
| 131 | 3300025931 | Ga0207644_10110253 | Ga0207644_101102531 | 493 |
| 132 | 3300025939 | Ga0207665_10020888 | Ga0207665_100208884 | 493 |
| 133 | 3300005290 | Ga0065712_10002575 | Ga0065712_100025753 | 494 |
| 134 | 3300005331 | Ga0070670_100006841 | Ga0070670_1000068416 | 494 |
| 135 | 3300005335 | Ga0070666_10013040 | Ga0070666_100130402 | 494 |
| 136 | 3300005338 | Ga0068868_100016118 | Ga0068868_1000161182 | 494 |
| 137 | 3300005340 | Ga0070689_100022157 | Ga0070689_1000221574 | 494 |
| 138 | 3300005354 | Ga0070675_100015131 | Ga0070675_1000151314 | 494 |
| 139 | 3300005354 | Ga0070675_100144591 | Ga0070675_1001445912 | 494 |
| 140 | 3300005355 | Ga0070671_100005953 | Ga0070671_1000059534 | 494 |
| 141 | 3300005364 | Ga0070673_100050852 | Ga0070673_1000508522 | 494 |
| 142 | 3300005367 | Ga0070667_100034922 | Ga0070667_1000349222 | 494 |
| 143 | 3300005439 | Ga0070711_100051857 | Ga0070711_1000518572 | 494 |
| 144 | 3300005445 | Ga0070708_100153088 | Ga0070708_1001530882 | 494 |
| 145 | 3300005455 | Ga0070663_100020482 | Ga0070663_1000204823 | 494 |
| 146 | 3300005457 | Ga0070662_100036463 | Ga0070662_1000364631 | 494 |
| 147 | 3300005536 | Ga0070697_100069096 | Ga0070697_1000690962 | 494 |
| 148 | 3300005543 | Ga0070672_100067701 | Ga0070672_1000677012 | 494 |
| 149 | 3300005548 | Ga0070665_100074168 | Ga0070665_1000741682 | 494 |
| 150 | 3300006028 | Ga0070717_10029758 | Ga0070717_100297586 | 494 |
| 151 | 3300006175 | Ga0070712_100008603 | Ga0070712_1000086035 | 494 |
| 152 | 3300006237 | Ga0097621_100173375 | Ga0097621_1001733751 | 494 |
| 153 | 3300006358 | Ga0068871_100042299 | Ga0068871_1000422993 | 494 |
| 154 | 3300013306 | Ga0163162_10037428 | Ga0163162_100374282 | 494 |
| 155 | 3300013306 | Ga0163162_10197465 | Ga0163162_101974652 | 494 |
| 156 | 3300013308 | Ga0157375_10009424 | Ga0157375_100094245 | 494 |
| 157 | 3300013308 | Ga0157375_10150048 | Ga0157375_101500482 | 494 |
| 158 | 3300025315 | Ga0207697_10000438 | Ga0207697_1000043817 | 494 |
| 159 | 3300025315 | Ga0207697_10002314 | Ga0207697_100023142 | 494 |
| 160 | 3300025315 | Ga0207697_10005972 | Ga0207697_100059724 | 494 |
| 161 | 3300025901 | Ga0207688_10005408 | Ga0207688_100054084 | 494 |
| 162 | 3300025910 | Ga0207684_10000086 | Ga0207684_10000086117 | 494 |
| 163 | 3300025923 | Ga0207681_10061286 | Ga0207681_100612862 | 494 |
| 164 | 3300025926 | Ga0207659_10024637 | Ga0207659_100246372 | 494 |
| 165 | 3300025926 | Ga0207659_10059505 | Ga0207659_100595052 | 494 |
| 166 | 3300025928 | Ga0207700_10025689 | Ga0207700_100256892 | 494 |
| 167 | 3300025931 | Ga0207644_10003514 | Ga0207644_100035146 | 494 |
| 168 | 3300025933 | Ga0207706_10050499 | Ga0207706_100504991 | 494 |
| 169 | 3300025934 | Ga0207686_10118131 | Ga0207686_101181312 | 494 |
| 170 | 3300025936 | Ga0207670_10053287 | Ga0207670_100532872 | 494 |
| 171 | 3300025940 | Ga0207691_10006878 | Ga0207691_100068788 | 494 |
| 172 | 3300025940 | Ga0207691_10010382 | Ga0207691_100103827 | 494 |
| 173 | 3300025972 | Ga0207668_10105235 | Ga0207668_101052352 | 494 |
| 174 | 3300026023 | Ga0207677_10090952 | Ga0207677_100909522 | 494 |
| 175 | 3300026067 | Ga0207678_10009753 | Ga0207678_100097534 | 494 |
| 176 | 3300026121 | Ga0207683_10064239 | Ga0207683_100642392 | 494 |
| 177 | 3300028379 | Ga0268266_10148741 | Ga0268266_101487412 | 494 |
| 178 | 3300035725 | Ga0373947_0081955 | Ga0373947_0081955_421_1962 | 494 |
| 179 | 3300048915 | Ga0496112_0063129 | Ga0496112_0063129_618_2153 | 494 |
| 180 | 3300005293 | Ga0065715_10005624 | Ga0065715_100056242 | 495 |
| 181 | 3300005328 | Ga0070676_10017439 | Ga0070676_100174393 | 495 |
| 182 | 3300005347 | Ga0070668_100053100 | Ga0070668_1000531002 | 495 |
| 183 | 3300005353 | Ga0070669_100016893 | Ga0070669_1000168933 | 495 |
| 184 | 3300005354 | Ga0070675_100021297 | Ga0070675_1000212974 | 495 |
| 185 | 3300005355 | Ga0070671_100037401 | Ga0070671_1000374013 | 495 |
| 186 | 3300005445 | Ga0070708_100091989 | Ga0070708_1000919892 | 495 |
| 187 | 3300005457 | Ga0070662_100036090 | Ga0070662_1000360901 | 495 |
| 188 | 3300005467 | Ga0070706_100003303 | Ga0070706_10000330317 | 495 |
| 189 | 3300005467 | Ga0070706_100009594 | Ga0070706_1000095945 | 495 |
| 190 | 3300005468 | Ga0070707_100021654 | Ga0070707_1000216545 | 495 |
| 191 | 3300005471 | Ga0070698_100173178 | Ga0070698_1001731782 | 495 |
| 192 | 3300005518 | Ga0070699_100063486 | Ga0070699_1000634863 | 495 |
| 193 | 3300009176 | Ga0105242_10072543 | Ga0105242_100725432 | 495 |
| 194 | 3300013297 | Ga0157378_10065871 | Ga0157378_100658712 | 495 |
| 195 | 3300013306 | Ga0163162_10029487 | Ga0163162_100294871 | 495 |
| 196 | 3300013308 | Ga0157375_10106556 | Ga0157375_101065562 | 495 |
| 197 | 3300025315 | Ga0207697_10003112 | Ga0207697_100031122 | 495 |
| 198 | 3300025907 | Ga0207645_10076144 | Ga0207645_100761441 | 495 |
| 199 | 3300025910 | Ga0207684_10003013 | Ga0207684_1000301318 | 495 |
| 200 | 3300025918 | Ga0207662_10006736 | Ga0207662_100067368 | 495 |
| 201 | 3300025923 | Ga0207681_10105371 | Ga0207681_101053711 | 495 |
| 202 | 3300025933 | Ga0207706_10039457 | Ga0207706_100394574 | 495 |
| 203 | 3300025940 | Ga0207691_10162759 | Ga0207691_101627592 | 495 |
| 204 | 3300035170 | Ga0373943_0066994 | Ga0373943_0066994_89_1657 | 495 |
| 205 | 3300035725 | Ga0373947_0010962 | Ga0373947_0010962_3225_4826 | 495 |
| 206 | 3300048903 | Ga0496100_0026830 | Ga0496100_0026830_1004_2572 | 495 |
| 207 | 3300048904 | Ga0496101_0003554 | Ga0496101_0003554_5758_7326 | 495 |
| 208 | 3300048906 | Ga0496103_0018870 | Ga0496103_0018870_944_2512 | 495 |
| 209 | 3300048909 | Ga0496106_0046962 | Ga0496106_0046962_929_2497 | 495 |
| 210 | 3300048910 | Ga0496107_0012485 | Ga0496107_0012485_3674_5242 | 495 |
| 211 | 3300048917 | Ga0496114_0124004 | Ga0496114_0124004_387_1955 | 495 |
| 212 | 3300048918 | Ga0496115_0043240 | Ga0496115_0043240_1145_2713 | 495 |
| 213 | 3300005354 | Ga0070675_100110174 | Ga0070675_1001101741 | 496 |
| 214 | 3300005467 | Ga0070706_100044260 | Ga0070706_1000442602 | 496 |
| 215 | 3300005535 | Ga0070684_100070234 | Ga0070684_1000702342 | 496 |
| 216 | 3300005548 | Ga0070665_100151898 | Ga0070665_1001518982 | 496 |
| 217 | 3300005564 | Ga0070664_100017227 | Ga0070664_1000172273 | 496 |
| 218 | 3300006028 | Ga0070717_10014397 | Ga0070717_100143974 | 496 |
| 219 | 3300013296 | Ga0157374_10012955 | Ga0157374_100129554 | 496 |
| 220 | 3300025903 | Ga0207680_10022996 | Ga0207680_100229962 | 496 |
| 221 | 3300025910 | Ga0207684_10031620 | Ga0207684_100316204 | 496 |
| 222 | 3300025910 | Ga0207684_10175736 | Ga0207684_101757361 | 496 |
| 223 | 3300026067 | Ga0207678_10050828 | Ga0207678_100508285 | 496 |
| 224 | 3300048907 | Ga0496104_0054285 | Ga0496104_0054285_846_2378 | 496 |
| 225 | 3300048912 | Ga0496109_0238545 | Ga0496109_0238545_173_1663 | 496 |
| 226 | 3300048915 | Ga0496112_0003138 | Ga0496112_0003138_8204_9694 | 496 |
| 227 | 3300048918 | Ga0496115_0019542 | Ga0496115_0019542_2630_4162 | 496 |
| 228 | 3300005290 | Ga0065712_10008555 | Ga0065712_100085552 | 497 |
| 229 | 3300005330 | Ga0070690_100062563 | Ga0070690_1000625632 | 497 |
| 230 | 3300005331 | Ga0070670_100098462 | Ga0070670_1000984621 | 497 |
| 231 | 3300005347 | Ga0070668_100038713 | Ga0070668_1000387133 | 497 |
| 232 | 3300005353 | Ga0070669_100085870 | Ga0070669_1000858701 | 497 |
| 233 | 3300005356 | Ga0070674_100007164 | Ga0070674_1000071647 | 497 |
| 234 | 3300005364 | Ga0070673_100020120 | Ga0070673_1000201203 | 497 |
| 235 | 3300005436 | Ga0070713_100173416 | Ga0070713_1001734161 | 497 |
| 236 | 3300005437 | Ga0070710_10044735 | Ga0070710_100447352 | 497 |
| 237 | 3300005438 | Ga0070701_10042325 | Ga0070701_100423251 | 497 |
| 238 | 3300005441 | Ga0070700_100053050 | Ga0070700_1000530502 | 497 |
| 239 | 3300005445 | Ga0070708_100124293 | Ga0070708_1001242932 | 497 |
| 240 | 3300005456 | Ga0070678_100063855 | Ga0070678_1000638552 | 497 |
| 241 | 3300005467 | Ga0070706_100003887 | Ga0070706_1000038877 | 497 |
| 242 | 3300005468 | Ga0070707_100016201 | Ga0070707_1000162014 | 497 |
| 243 | 3300005468 | Ga0070707_100036095 | Ga0070707_1000360955 | 497 |
| 244 | 3300005468 | Ga0070707_100081247 | Ga0070707_1000812472 | 497 |
| 245 | 3300005518 | Ga0070699_100060773 | Ga0070699_1000607734 | 497 |
| 246 | 3300005564 | Ga0070664_100095855 | Ga0070664_1000958552 | 497 |
| 247 | 3300005617 | Ga0068859_100003179 | Ga0068859_1000031799 | 497 |
| 248 | 3300005937 | Ga0081455_10007236 | Ga0081455_1000723612 | 497 |
| 249 | 3300005937 | Ga0081455_10034009 | Ga0081455_100340093 | 497 |
| 250 | 3300005937 | Ga0081455_10070788 | Ga0081455_100707884 | 497 |
| 251 | 3300005937 | Ga0081455_10175306 | Ga0081455_101753061 | 497 |
| 252 | 3300005983 | Ga0081540_1000152 | Ga0081540_100015270 | 497 |
| 253 | 3300005985 | Ga0081539_10014875 | Ga0081539_100148752 | 497 |
| 254 | 3300006028 | Ga0070717_10083697 | Ga0070717_100836972 | 497 |
| 255 | 3300006163 | Ga0070715_10046064 | Ga0070715_100460642 | 497 |
| 256 | 3300006931 | Ga0097620_100003179 | Ga0097620_1000031799 | 497 |
| 257 | 3300009094 | Ga0111539_10109024 | Ga0111539_101090242 | 497 |
| 258 | 3300009553 | Ga0105249_10037239 | Ga0105249_100372392 | 497 |
| 259 | 3300010375 | Ga0105239_10238907 | Ga0105239_102389072 | 497 |
| 260 | 3300013296 | Ga0157374_10037864 | Ga0157374_100378644 | 497 |
| 261 | 3300013308 | Ga0157375_10001548 | Ga0157375_100015489 | 497 |
| 262 | 3300014968 | Ga0157379_10028693 | Ga0157379_100286935 | 497 |
| 263 | 3300017792 | Ga0163161_10098919 | Ga0163161_100989192 | 497 |
| 264 | 3300025271 | Ga0207666_1000279 | Ga0207666_10002793 | 497 |
| 265 | 3300025290 | Ga0207673_1001430 | Ga0207673_10014302 | 497 |
| 266 | 3300025315 | Ga0207697_10005743 | Ga0207697_100057432 | 497 |
| 267 | 3300025901 | Ga0207688_10004490 | Ga0207688_100044903 | 497 |
| 268 | 3300025904 | Ga0207647_10004405 | Ga0207647_1000440510 | 497 |
| 269 | 3300025907 | Ga0207645_10017146 | Ga0207645_100171462 | 497 |
| 270 | 3300025912 | Ga0207707_10009207 | Ga0207707_100092072 | 497 |
| 271 | 3300025922 | Ga0207646_10041444 | Ga0207646_100414441 | 497 |
| 272 | 3300025923 | Ga0207681_10045208 | Ga0207681_100452082 | 497 |
| 273 | 3300025926 | Ga0207659_10005881 | Ga0207659_100058812 | 497 |
| 274 | 3300025928 | Ga0207700_10021405 | Ga0207700_100214052 | 497 |
| 275 | 3300025931 | Ga0207644_10029126 | Ga0207644_100291262 | 497 |
| 276 | 3300025932 | Ga0207690_10004400 | Ga0207690_100044009 | 497 |
| 277 | 3300025932 | Ga0207690_10058584 | Ga0207690_100585842 | 497 |
| 278 | 3300025933 | Ga0207706_10015831 | Ga0207706_100158314 | 497 |
| 279 | 3300025933 | Ga0207706_10056365 | Ga0207706_100563652 | 497 |
| 280 | 3300025939 | Ga0207665_10018787 | Ga0207665_100187872 | 497 |
| 281 | 3300025940 | Ga0207691_10129956 | Ga0207691_101299562 | 497 |
| 282 | 3300025972 | Ga0207668_10024684 | Ga0207668_100246842 | 497 |
| 283 | 3300026023 | Ga0207677_10055080 | Ga0207677_100550803 | 497 |
| 284 | 3300026075 | Ga0207708_10120133 | Ga0207708_101201332 | 497 |
| 285 | 3300026078 | Ga0207702_10021761 | Ga0207702_100217613 | 497 |
| 286 | 3300026088 | Ga0207641_10012208 | Ga0207641_100122086 | 497 |
| 287 | 3300026089 | Ga0207648_10061793 | Ga0207648_100617932 | 497 |
| 288 | 3300026121 | Ga0207683_10148694 | Ga0207683_101486942 | 497 |
| 289 | 3300028379 | Ga0268266_10094816 | Ga0268266_100948163 | 497 |
| 290 | 3300028379 | Ga0268266_10121934 | Ga0268266_101219341 | 497 |
| 291 | 3300035692 | Ga0373935_0102637 | Ga0373935_0102637_152_1711 | 497 |
| 292 | 3300037418 | Ga0395900_0005968 | Ga0395900_0005968_1414_2949 | 497 |
| 293 | 3300037466 | Ga0395898_0001597 | Ga0395898_0001597_3349_4884 | 497 |
| 294 | 3300037471 | Ga0395905_0003973 | Ga0395905_0003973_13334_14869 | 497 |
| 295 | 3300038443 | Ga0395901_0000525 | Ga0395901_0000525_28885_30420 | 497 |
| 296 | 3300048907 | Ga0496104_0187380 | Ga0496104_0187380_49_1608 | 497 |
| 297 | 3300048913 | Ga0496110_0065458 | Ga0496110_0065458_114_1673 | 497 |
| 298 | 3300005468 | Ga0070707_100052442 | Ga0070707_1000524422 | 498 |
| 299 | 3300025910 | Ga0207684_10036340 | Ga0207684_100363405 | 498 |
| 300 | 3300013307 | Ga0157372_10030381 | Ga0157372_100303814 | 499 |
| 301 | 3300005354 | Ga0070675_100005376 | Ga0070675_1000053762 | 500 |
| 302 | 3300005535 | Ga0070684_100001068 | Ga0070684_1000010689 | 500 |
| 303 | 3300005937 | Ga0081455_10014762 | Ga0081455_100147623 | 500 |
| 304 | 3300025919 | Ga0207657_10028248 | Ga0207657_100282484 | 500 |
| 305 | 3300025936 | Ga0207670_10022473 | Ga0207670_100224732 | 500 |
| 306 | 3300005456 | Ga0070678_100006535 | Ga0070678_1000065353 | 504 |
| 307 | 3300013297 | Ga0157378_10191327 | Ga0157378_101913271 | 504 |
| 308 | 3300026121 | Ga0207683_10005253 | Ga0207683_100052533 | 504 |
| 309 | 3300003911 | JGI25405J52794_10004178 | JGI25405J52794_100041782 | 506 |
| 310 | 3300005289 | Ga0065704_10103115 | Ga0065704_101031152 | 506 |
| 311 | 3300005439 | Ga0070711_100025431 | Ga0070711_1000254311 | 506 |
| 312 | 3300005937 | Ga0081455_10000385 | Ga0081455_1000038525 | 506 |
| 313 | 3300005937 | Ga0081455_10002288 | Ga0081455_1000228823 | 506 |
| 314 | 3300005937 | Ga0081455_10018839 | Ga0081455_100188395 | 506 |
| 315 | 3300005983 | Ga0081540_1030042 | Ga0081540_10300422 | 506 |
| 316 | 3300006844 | Ga0075428_100104683 | Ga0075428_1001046832 | 506 |
| 317 | 3300009147 | Ga0114129_10015127 | Ga0114129_100151276 | 506 |
| 318 | 3300025315 | Ga0207697_10001111 | Ga0207697_1000111110 | 506 |
| 319 | 3300025915 | Ga0207693_10077665 | Ga0207693_100776652 | 506 |
| 320 | 3300037418 | Ga0395900_0005968 | Ga0395900_0005968_2967_4529 | 506 |
| 321 | 3300037466 | Ga0395898_0001597 | Ga0395898_0001597_4902_6464 | 506 |
| 322 | 3300038443 | Ga0395901_0000525 | Ga0395901_0000525_30438_32000 | 506 |
| 323 | 3300050507 | nmdc:mga05p37_1970_c1 | nmdc:mga05p37_1970_c1_7233_8795 | 506 |
| 324 | 3300005295 | Ga0065707_10008501 | Ga0065707_100085012 | 509 |
| 325 | 3300003911 | JGI25405J52794_10000065 | JGI25405J52794_100000654 | 510 |
| 326 | 3300005937 | Ga0081455_10000385 | Ga0081455_1000038526 | 510 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r1h-assembly1.cif.gz_B | gntr family transcriptional regulator from listeria monocytogenes | 0.9129 | 17 | 86 |
| 6sbs-assembly1.cif.gz_A | ytra from sulfolobus acidocaldarius, a gntr-family transcription factor | 0.9063 | 9 | 86 |
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9063 | 12 | 86 |
| 3neu-assembly1.cif.gz_A-2 | the crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262 | 0.9009 | 12 | 86 |
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.8975 | 19 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.979 | 44 | 85 | 1.10.10.10 |
| af_P39389_1_70_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9329 | 22 | 86 | 1.10.10.10 |
| af_Q2FWW6_10_126_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9329 | 19 | 86 | 1.10.10.10 |
| 2wv0J01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.924 | 19 | 88 | 1.10.10.10 |
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.916 | 44 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I8CMK8-F1-model_v4 | GntR family transcriptional regulator | 0.9164 | 388 | 508 |
|
| AF-A0A2E7HFL5-F1-model_v4 | GntR family transcriptional regulator | 0.9091 | 281 | 452 |
|
| AF-A0A4Y9RM15-F1-model_v4 | PLP-dependent aminotransferase family protein | 0.9087 | 188 | 505 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A2R7TDR9-F1-model_v4 | deleted | 0.8997 | 215 | 506 |
|
| AF-A0A4Y9RM15-F1-model_v4 | PLP-dependent aminotransferase family protein | 0.898 | 188 | 505 |
GO:0008483
GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar