F408314

General Info

Members Datasets Scaffolds Average Seq Length
326 145 320 508

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10030381|Ga0157372_100303814
Length 555
Sequence MTETFSPEPDRSTDHLARADQTTFDKALRRGTFSRENASQSGMAKPRLHKTFKGKRRRHSIIAFEMIRLDRAAAEPLHQQLYRQIRDELISGNVNDGAARLPSSRSLAHDLGISRLTVNLALSKLTTEGYLRSRVGSGTFVAHPLPETYLSAQKPTSNRQVERPPRLSNRVRNIQDKRAGKQFDFGIAGAPGVSFVPALAALDEFPIDTWERLRAQVLSRKGAHLLQYASSRGDVDLRKAIAAYLCDYRGARCHPDQIIITAGTQQAMMIAAMALVNRGEIAWMEDPGFYQARRVFSFAGATVVPRPVDREGIVIGHPTKKSSPKIIYVTPSHQFPLGMTMSLARRTALIDFARDRDAYIFEDDHNSEFRFTGPPLPCLQGLDHCGRVIYAGTFSKILYPSLRLGYLLVPEQLVDAMIKIRAVTDQHSPAIDQATMARFLTEGFFLSHIKRMRKLYSDRREFFIEHFNGLLGKYFRLEIPEAGLHFVAWVKRPKDLPGIMAVCSEIGIRPTPLSSCFIKAKLDPALTFGFAAWSRAQIREGLTKFASALHARLRG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.06
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10000065 3300003911 Bacteria 11716
2 JGI25405J52794_10002978 3300003911 Bacteria 2946
3 JGI25405J52794_10004178 3300003911 Bacteria 2566
4 Ga0065704_10103115 3300005289 Unclassified 2182
5 Ga0065712_10002575 3300005290 Bacteria 5054
6 Ga0065712_10003383 3300005290 Bacteria 5339
7 Ga0065712_10008555 3300005290 Bacteria 3119
8 Ga0065712_10011966 3300005290 Bacteria 2633
9 Ga0065712_10012170 3300005290 Bacteria 2092
10 Ga0065715_10002096 3300005293 Bacteria 9330
11 Ga0065715_10004216 3300005293 Bacteria 6468
12 Ga0065715_10005624 3300005293 Bacteria 6006
13 Ga0065715_10017433 3300005293 Unclassified 1801
14 Ga0065707_10008501 3300005295 Unclassified 2628
15 Ga0070676_10017439 3300005328 Bacteria 3974
16 Ga0070690_100034239 3300005330 Bacteria 3183
17 Ga0070690_100053844 3300005330 Bacteria 2575
18 Ga0070690_100062563 3300005330 Bacteria 2400
19 Ga0070670_100006841 3300005331 Bacteria 9660
20 Ga0070670_100098462 3300005331 Unclassified 2516
21 Ga0070666_10013040 3300005335 Bacteria 5263
22 Ga0068868_100016118 3300005338 Bacteria 5544
23 Ga0070689_100022157 3300005340 Unclassified 4741
24 Ga0070689_100048388 3300005340 Bacteria 3279
25 Ga0070668_100008317 3300005347 Bacteria 7702
26 Ga0070668_100038713 3300005347 Bacteria 3646
27 Ga0070668_100053100 3300005347 Bacteria 3126
28 Ga0070669_100016893 3300005353 Bacteria 5210
29 Ga0070669_100085870 3300005353 Bacteria 2350
30 Ga0070669_100131033 3300005353 Bacteria 1924
31 Ga0070675_100005376 3300005354 Bacteria 9786
32 Ga0070675_100015131 3300005354 Bacteria 6092
33 Ga0070675_100021297 3300005354 Bacteria 5180
34 Ga0070675_100110174 3300005354 Bacteria 2328
35 Ga0070675_100144591 3300005354 Bacteria 2035
36 Ga0070671_100005953 3300005355 Bacteria 9715
37 Ga0070671_100010467 3300005355 Bacteria 7441
38 Ga0070671_100037401 3300005355 Bacteria 4025
39 Ga0070671_100125271 3300005355 Unclassified 2163
40 Ga0070674_100007164 3300005356 Bacteria 6560
41 Ga0070674_100052354 3300005356 Bacteria 2816
42 Ga0070673_100020120 3300005364 Unclassified 4807
43 Ga0070673_100050852 3300005364 Bacteria 3242
44 Ga0070673_100097531 3300005364 Unclassified 2414
45 Ga0070688_100002046 3300005365 Bacteria 10174
46 Ga0070667_100034922 3300005367 Bacteria 4210
47 Ga0070709_10035564 3300005434 Bacteria 3028
48 Ga0070709_10088446 3300005434 Unclassified 2038
49 Ga0070713_100078269 3300005436 Bacteria 2814
50 Ga0070713_100173416 3300005436 Bacteria 1933
51 Ga0070710_10044735 3300005437 Bacteria 2457
52 Ga0070701_10042325 3300005438 Unclassified 2324
53 Ga0070711_100025431 3300005439 Bacteria 3874
54 Ga0070711_100051857 3300005439 Bacteria 2820
55 Ga0070711_100072791 3300005439 Bacteria 2425
56 Ga0070711_100088316 3300005439 Bacteria 2227
57 Ga0070700_100053050 3300005441 Unclassified 2530
58 Ga0070708_100091989 3300005445 Bacteria 2763
59 Ga0070708_100096898 3300005445 Bacteria 2695
60 Ga0070708_100124293 3300005445 Bacteria 2383
61 Ga0070708_100153088 3300005445 Bacteria 2145
62 Ga0070663_100020482 3300005455 Unclassified 4380
63 Ga0070678_100006535 3300005456 Bacteria 6846
64 Ga0070678_100063855 3300005456 Unclassified 2726
65 Ga0070662_100036090 3300005457 Bacteria 3495
66 Ga0070662_100036463 3300005457 Bacteria 3479
67 Ga0070662_100044456 3300005457 Unclassified 3181
68 Ga0070706_100001926 3300005467 Bacteria 21396
69 Ga0070706_100003303 3300005467 Bacteria 15949
70 Ga0070706_100003887 3300005467 Bacteria 14581
71 Ga0070706_100009594 3300005467 Bacteria 9000
72 Ga0070706_100044260 3300005467 Bacteria 4111
73 Ga0070706_100052223 3300005467 Bacteria 3773
74 Ga0070707_100016201 3300005468 Bacteria 6995
75 Ga0070707_100021654 3300005468 Bacteria 6077
76 Ga0070707_100034193 3300005468 Bacteria 4847
77 Ga0070707_100036095 3300005468 Bacteria 4716
78 Ga0070707_100044955 3300005468 Bacteria 4227
79 Ga0070707_100052442 3300005468 Bacteria 3910
80 Ga0070707_100081247 3300005468 Bacteria 3129
81 Ga0070707_100084790 3300005468 Unclassified 3062
82 Ga0070707_100169065 3300005468 Bacteria 2131
83 Ga0070698_100064178 3300005471 Bacteria 3701
84 Ga0070698_100173178 3300005471 Unclassified 2098
85 Ga0070698_100241548 3300005471 Bacteria 1739
86 Ga0070699_100060773 3300005518 Bacteria 3275
87 Ga0070699_100063486 3300005518 Unclassified 3203
88 Ga0070684_100001068 3300005535 Bacteria 19615
89 Ga0070684_100030455 3300005535 Unclassified 4584
90 Ga0070684_100070234 3300005535 Bacteria 3081
91 Ga0070697_100027671 3300005536 Bacteria 4537
92 Ga0070697_100069096 3300005536 Unclassified 2893
93 Ga0070672_100067701 3300005543 Bacteria 2830
94 Ga0070686_100067379 3300005544 Bacteria 2332
95 Ga0070696_100035418 3300005546 Bacteria 3437
96 Ga0070665_100074168 3300005548 Unclassified 3408
97 Ga0070665_100151898 3300005548 Bacteria 2318
98 Ga0070665_100238555 3300005548 Bacteria 1819
99 Ga0070664_100017227 3300005564 Bacteria 5933
100 Ga0070664_100095855 3300005564 Unclassified 2574
101 Ga0068856_100140996 3300005614 Bacteria 2418
102 Ga0068859_100003179 3300005617 Bacteria 16711
103 Ga0068866_10046564 3300005718 Bacteria 2182
104 Ga0081455_10000385 3300005937 Bacteria 58366
105 Ga0081455_10002288 3300005937 Bacteria 22855
106 Ga0081455_10007236 3300005937 Bacteria 11721
107 Ga0081455_10014762 3300005937 Bacteria 7623
108 Ga0081455_10018839 3300005937 Bacteria 6547
109 Ga0081455_10034009 3300005937 Bacteria 4573
110 Ga0081455_10070788 3300005937 Bacteria 2894
111 Ga0081455_10175306 3300005937 Unclassified 1629
112 Ga0081540_1000152 3300005983 Bacteria 70858
113 Ga0081540_1030042 3300005983 Unclassified 3016
114 Ga0081539_10014875 3300005985 Bacteria 5712
115 Ga0070717_10014397 3300006028 Bacteria 6085
116 Ga0070717_10029758 3300006028 Bacteria 4385
117 Ga0070717_10083697 3300006028 Bacteria 2683
118 Ga0070715_10014135 3300006163 Bacteria 2949
119 Ga0070715_10046064 3300006163 Unclassified 1852
120 Ga0070712_100006774 3300006175 Bacteria 7128
121 Ga0070712_100008603 3300006175 Bacteria 6423
122 Ga0070712_100037541 3300006175 Unclassified 3304
123 Ga0070712_100145428 3300006175 Bacteria 1814
124 Ga0097621_100012301 3300006237 Bacteria 6335
125 Ga0097621_100173375 3300006237 Unclassified 1860
126 Ga0068871_100042299 3300006358 Bacteria 3657
127 Ga0075428_100104683 3300006844 Bacteria 3086
128 Ga0097620_100003179 3300006931 Bacteria 16711
129 Ga0099795_10008251 3300007788 Bacteria 2960
130 Ga0111539_10109024 3300009094 Unclassified 3249
131 Ga0111539_10208875 3300009094 Bacteria 2275
132 Ga0105245_10154885 3300009098 Bacteria 2170
133 Ga0114129_10009497 3300009147 Bacteria 13870
134 Ga0114129_10015127 3300009147 Bacteria 10981
135 Ga0114129_10184161 3300009147 Bacteria 2840
136 Ga0105242_10072543 3300009176 Bacteria 2859
137 Ga0105249_10037239 3300009553 Unclassified 4415
138 Ga0105239_10238907 3300010375 Unclassified 2039
139 Ga0157374_10012955 3300013296 Bacteria 7269
140 Ga0157374_10037864 3300013296 Unclassified 4430
141 Ga0157374_10098288 3300013296 Bacteria 2802
142 Ga0157374_10157158 3300013296 Unclassified 2213
143 Ga0157378_10065871 3300013297 Bacteria 3243
144 Ga0157378_10125277 3300013297 Bacteria 2373
145 Ga0157378_10191327 3300013297 Unclassified 1930
146 Ga0163162_10020409 3300013306 Bacteria 6511
147 Ga0163162_10029487 3300013306 Bacteria 5430
148 Ga0163162_10037428 3300013306 Unclassified 4842
149 Ga0163162_10038017 3300013306 Bacteria 4804
150 Ga0163162_10044220 3300013306 Unclassified 4460
151 Ga0163162_10197465 3300013306 Bacteria 2141
152 Ga0157372_10030381 3300013307 Bacteria 5912
153 Ga0157375_10001548 3300013308 Bacteria 19783
154 Ga0157375_10009424 3300013308 Bacteria 8569
155 Ga0157375_10106556 3300013308 Bacteria 2895
156 Ga0157375_10132379 3300013308 Unclassified 2614
157 Ga0157375_10150048 3300013308 Unclassified 2466
158 Ga0163163_10064253 3300014325 Bacteria 3641
159 Ga0163163_10124995 3300014325 Unclassified 2609
160 Ga0157379_10028693 3300014968 Unclassified 4949
161 Ga0163161_10013937 3300017792 Bacteria 5599
162 Ga0163161_10098919 3300017792 Bacteria 2169
163 Ga0207666_1000279 3300025271 Bacteria 7292
164 Ga0207673_1000356 3300025290 Unclassified 4624
165 Ga0207673_1001430 3300025290 Unclassified 2608
166 Ga0207697_10000438 3300025315 Bacteria 23468
167 Ga0207697_10001111 3300025315 Bacteria 14826
168 Ga0207697_10002314 3300025315 Bacteria 9919
169 Ga0207697_10003112 3300025315 Bacteria 8298
170 Ga0207697_10005743 3300025315 Bacteria 5720
171 Ga0207697_10005972 3300025315 Bacteria 5580
172 Ga0207697_10011556 3300025315 Bacteria 3732
173 Ga0207697_10011792 3300025315 Bacteria 3687
174 Ga0207697_10012855 3300025315 Unclassified 3502
175 Ga0207697_10013116 3300025315 Bacteria 3462
176 Ga0207642_10019935 3300025899 Bacteria 2608
177 Ga0207688_10004490 3300025901 Bacteria 7597
178 Ga0207688_10005408 3300025901 Bacteria 6941
179 Ga0207680_10022996 3300025903 Bacteria 3398
180 Ga0207680_10056588 3300025903 Bacteria 2369
181 Ga0207647_10004405 3300025904 Bacteria 10442
182 Ga0207685_10020559 3300025905 Bacteria 2197
183 Ga0207699_10100654 3300025906 Unclassified 1833
184 Ga0207645_10008104 3300025907 Bacteria 7363
185 Ga0207645_10017146 3300025907 Unclassified 4784
186 Ga0207645_10076144 3300025907 Unclassified 2148
187 Ga0207645_10078699 3300025907 Bacteria 2112
188 Ga0207684_10000086 3300025910 Bacteria 173807
189 Ga0207684_10000186 3300025910 Bacteria 98342
190 Ga0207684_10002487 3300025910 Bacteria 18534
191 Ga0207684_10003013 3300025910 Bacteria 16696
192 Ga0207684_10017955 3300025910 Bacteria 6062
193 Ga0207684_10031620 3300025910 Unclassified 4501
194 Ga0207684_10036340 3300025910 Bacteria 4182
195 Ga0207684_10175736 3300025910 Bacteria 1846
196 Ga0207707_10009207 3300025912 Bacteria 8571
197 Ga0207693_10016156 3300025915 Bacteria 5970
198 Ga0207693_10043785 3300025915 Bacteria 3519
199 Ga0207693_10077665 3300025915 Bacteria 2600
200 Ga0207693_10078066 3300025915 Bacteria 2592
201 Ga0207663_10054719 3300025916 Bacteria 2500
202 Ga0207662_10006736 3300025918 Bacteria 6214
203 Ga0207657_10028248 3300025919 Bacteria 5120
204 Ga0207646_10041444 3300025922 Bacteria 4139
205 Ga0207646_10062566 3300025922 Bacteria 3322
206 Ga0207646_10082233 3300025922 Bacteria 2880
207 Ga0207646_10145304 3300025922 Bacteria 2137
208 Ga0207681_10045208 3300025923 Unclassified 2955
209 Ga0207681_10061286 3300025923 Bacteria 2585
210 Ga0207681_10105371 3300025923 Unclassified 2041
211 Ga0207659_10005881 3300025926 Bacteria 7487
212 Ga0207659_10024637 3300025926 Bacteria 4035
213 Ga0207659_10059505 3300025926 Unclassified 2746
214 Ga0207659_10077748 3300025926 Unclassified 2443
215 Ga0207700_10021405 3300025928 Unclassified 4414
216 Ga0207700_10025689 3300025928 Bacteria 4095
217 Ga0207644_10003514 3300025931 Bacteria 10145
218 Ga0207644_10028673 3300025931 Bacteria 3856
219 Ga0207644_10029126 3300025931 Unclassified 3828
220 Ga0207644_10110253 3300025931 Unclassified 2080
221 Ga0207690_10004400 3300025932 Bacteria 8317
222 Ga0207690_10058584 3300025932 Bacteria 2605
223 Ga0207706_10015831 3300025933 Bacteria 6819
224 Ga0207706_10039457 3300025933 Bacteria 4186
225 Ga0207706_10050499 3300025933 Bacteria 3675
226 Ga0207706_10056365 3300025933 Bacteria 3465
227 Ga0207706_10062114 3300025933 Bacteria 3290
228 Ga0207686_10118131 3300025934 Bacteria 1800
229 Ga0207670_10022473 3300025936 Unclassified 3910
230 Ga0207670_10053287 3300025936 Unclassified 2724
231 Ga0207665_10004292 3300025939 Bacteria 9477
232 Ga0207665_10007042 3300025939 Bacteria 7448
233 Ga0207665_10018787 3300025939 Unclassified 4542
234 Ga0207665_10020888 3300025939 Unclassified 4304
235 Ga0207665_10023343 3300025939 Bacteria 4075
236 Ga0207691_10006878 3300025940 Bacteria 10974
237 Ga0207691_10010382 3300025940 Bacteria 8934
238 Ga0207691_10106313 3300025940 Bacteria 2500
239 Ga0207691_10129956 3300025940 Unclassified 2225
240 Ga0207691_10162759 3300025940 Bacteria 1957
241 Ga0207679_10064249 3300025945 Unclassified 2743
242 Ga0207651_10044404 3300025960 Bacteria 2974
243 Ga0207668_10024684 3300025972 Unclassified 3883
244 Ga0207668_10105235 3300025972 Unclassified 2105
245 Ga0207677_10055080 3300026023 Unclassified 2717
246 Ga0207677_10090952 3300026023 Bacteria 2218
247 Ga0207703_10149241 3300026035 Unclassified 2037
248 Ga0207678_10009753 3300026067 Bacteria 8444
249 Ga0207678_10050828 3300026067 Bacteria 3580
250 Ga0207708_10120133 3300026075 Unclassified 2047
251 Ga0207702_10021761 3300026078 Bacteria 5310
252 Ga0207641_10012208 3300026088 Bacteria 7050
253 Ga0207641_10233741 3300026088 Bacteria 1710
254 Ga0207648_10024001 3300026089 Bacteria 5450
255 Ga0207648_10061793 3300026089 Unclassified 3266
256 Ga0207683_10005253 3300026121 Bacteria 11117
257 Ga0207683_10046023 3300026121 Unclassified 3817
258 Ga0207683_10050846 3300026121 Bacteria 3631
259 Ga0207683_10057482 3300026121 Unclassified 3415
260 Ga0207683_10064239 3300026121 Bacteria 3235
261 Ga0207683_10148694 3300026121 Unclassified 2113
262 Ga0268266_10094816 3300028379 Unclassified 2620
263 Ga0268266_10112498 3300028379 Bacteria 2414
264 Ga0268266_10121934 3300028379 Bacteria 2321
265 Ga0268266_10148741 3300028379 Unclassified 2109
266 Ga0373943_0066994 3300035170 Bacteria 1810
267 Ga0373946_0031616 3300035171 Bacteria 2122
268 Ga0373935_0033064 3300035692 Bacteria 3218
269 Ga0373935_0102637 3300035692 Bacteria 1887
270 Ga0373947_0010962 3300035725 Bacteria 5203
271 Ga0373947_0050943 3300035725 Bacteria 2490
272 Ga0373947_0081955 3300035725 Bacteria 1999
273 Ga0373937_0010351 3300036401 Bacteria 8143
274 Ga0373925_0137227 3300037068 Bacteria 1912
275 Ga0395900_0005968 3300037418 Bacteria 12719
276 Ga0395900_0005988 3300037418 Bacteria 12697
277 Ga0395900_0043365 3300037418 Unclassified 4637
278 Ga0395898_0001597 3300037466 Bacteria 30926
279 Ga0395905_0003973 3300037471 Bacteria 15553
280 Ga0395901_0000525 3300038443 Bacteria 44276
281 Ga0451576_0192172 3300045051 Bacteria 2132
282 Ga0495630_0027818 3300046517 Unclassified 4199
283 Ga0495630_0045933 3300046517 Bacteria 3264
284 Ga0495598_0012921 3300046537 Unclassified 2060
285 Ga0495598_0014826 3300046537 Unclassified 1956
286 Ga0495647_0016698 3300046681 Bacteria 2589
287 Ga0495658_0047380 3300046683 Bacteria 2420
288 Ga0495669_0079604 3300046684 Unclassified 1502
289 Ga0495624_0034609 3300046690 Bacteria 3266
290 Ga0495581_0072310 3300047315 Bacteria 1995
291 Ga0495674_0055425 3300047319 Bacteria 3477
292 Ga0495676_0037624 3300047321 Bacteria 4026
293 Ga0495684_0080998 3300047471 Bacteria 2464
294 Ga0496100_0026830 3300048903 Bacteria 3535
295 Ga0496101_0003554 3300048904 Bacteria 9723
296 Ga0496102_0088162 3300048905 Bacteria 2868
297 Ga0496103_0018870 3300048906 Bacteria 4141
298 Ga0496104_0025427 3300048907 Bacteria 5458
299 Ga0496104_0054285 3300048907 Bacteria 3787
300 Ga0496104_0187380 3300048907 Bacteria 1980
301 Ga0496105_0071125 3300048908 Unclassified 2876
302 Ga0496106_0046962 3300048909 Bacteria 3248
303 Ga0496107_0012485 3300048910 Bacteria 5928
304 Ga0496108_0109590 3300048911 Bacteria 2360
305 Ga0496109_0074684 3300048912 Unclassified 3117
306 Ga0496109_0105364 3300048912 Bacteria 2619
307 Ga0496109_0238545 3300048912 Unclassified 1711
308 Ga0496110_0065458 3300048913 Bacteria 3213
309 Ga0496112_0003138 3300048915 Bacteria 13560
310 Ga0496112_0063129 3300048915 Bacteria 3654
311 Ga0496112_0160802 3300048915 Bacteria 2212
312 Ga0496114_0124004 3300048917 Bacteria 2225
313 Ga0496114_0151304 3300048917 Bacteria 2013
314 Ga0496115_0005758 3300048918 Bacteria 9025
315 Ga0496115_0019542 3300048918 Bacteria 5214
316 Ga0496115_0043240 3300048918 Bacteria 3592
317 nmdc:mga05p37_134225_c1 3300050507 Bacteria 3036
318 nmdc:mga05p37_1970_c1 3300050507 Bacteria 23955
319 nmdc:mga0rr50_38897_c1 3300050513 Bacteria 3446
320 nmdc:mga0a205_157468_c1 3300050515 Bacteria 2169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0074684 Ga0496109_0074684_1672_2979 415
2 3300035725 Ga0373947_0050943 Ga0373947_0050943_73_1413 446
3 3300037418 Ga0395900_0043365 Ga0395900_0043365_1276_2616 446
4 3300013306 Ga0163162_10020409 Ga0163162_100204095 464
5 3300025903 Ga0207680_10056588 Ga0207680_100565883 464
6 3300005355 Ga0070671_100010467 Ga0070671_1000104673 466
7 3300005347 Ga0070668_100008317 Ga0070668_1000083173 468
8 3300005356 Ga0070674_100052354 Ga0070674_1000523541 468
9 3300013296 Ga0157374_10157158 Ga0157374_101571582 470
10 3300025315 Ga0207697_10012855 Ga0207697_100128553 470
11 3300025926 Ga0207659_10077748 Ga0207659_100777481 470
12 3300025945 Ga0207679_10064249 Ga0207679_100642492 470
13 3300006237 Ga0097621_100012301 Ga0097621_1000123013 471
14 3300048907 Ga0496104_0025427 Ga0496104_0025427_2382_3905 471
15 3300048908 Ga0496105_0071125 Ga0496105_0071125_241_1764 471
16 3300048917 Ga0496114_0151304 Ga0496114_0151304_254_1777 471
17 3300048918 Ga0496115_0005758 Ga0496115_0005758_2210_3733 471
18 3300026089 Ga0207648_10024001 Ga0207648_100240014 479
19 3300005468 Ga0070707_100084790 Ga0070707_1000847902 482
20 3300005364 Ga0070673_100097531 Ga0070673_1000975312 483
21 3300046517 Ga0495630_0045933 Ga0495630_0045933_1136_2593 485
22 3300046681 Ga0495647_0016698 Ga0495647_0016698_357_1814 485
23 3300046683 Ga0495658_0047380 Ga0495658_0047380_774_2231 485
24 3300046690 Ga0495624_0034609 Ga0495624_0034609_80_1537 485
25 3300047315 Ga0495581_0072310 Ga0495581_0072310_423_1880 485
26 3300047319 Ga0495674_0055425 Ga0495674_0055425_556_2013 485
27 3300047321 Ga0495676_0037624 Ga0495676_0037624_1251_2708 485
28 3300005290 Ga0065712_10011966 Ga0065712_100119663 486
29 3300005290 Ga0065712_10012170 Ga0065712_100121701 486
30 3300005293 Ga0065715_10002096 Ga0065715_100020967 486
31 3300005293 Ga0065715_10017433 Ga0065715_100174331 486
32 3300005439 Ga0070711_100072791 Ga0070711_1000727912 486
33 3300005468 Ga0070707_100169065 Ga0070707_1001690652 486
34 3300005471 Ga0070698_100064178 Ga0070698_1000641782 486
35 3300013306 Ga0163162_10044220 Ga0163162_100442206 486
36 3300013308 Ga0157375_10132379 Ga0157375_101323792 486
37 3300025907 Ga0207645_10078699 Ga0207645_100786992 486
38 3300025922 Ga0207646_10145304 Ga0207646_101453041 486
39 3300025933 Ga0207706_10062114 Ga0207706_100621142 486
40 3300025939 Ga0207665_10007042 Ga0207665_100070427 486
41 3300025940 Ga0207691_10106313 Ga0207691_101063132 486
42 3300026088 Ga0207641_10233741 Ga0207641_102337411 486
43 3300026121 Ga0207683_10050846 Ga0207683_100508462 486
44 3300035171 Ga0373946_0031616 Ga0373946_0031616_364_1824 486
45 3300037068 Ga0373925_0137227 Ga0373925_0137227_93_1553 486
46 3300046684 Ga0495669_0079604 Ga0495669_0079604_24_1484 486
47 3300047471 Ga0495684_0080998 Ga0495684_0080998_231_1691 486
48 3300048915 Ga0496112_0160802 Ga0496112_0160802_610_2070 486
49 3300005467 Ga0070706_100052223 Ga0070706_1000522232 487
50 3300005468 Ga0070707_100044955 Ga0070707_1000449554 487
51 3300005536 Ga0070697_100027671 Ga0070697_1000276714 487
52 3300025315 Ga0207697_10011556 Ga0207697_100115562 487
53 3300009094 Ga0111539_10208875 Ga0111539_102088751 488
54 3300037418 Ga0395900_0005988 Ga0395900_0005988_1819_3285 488
55 3300003911 JGI25405J52794_10002978 JGI25405J52794_100029782 489
56 3300005436 Ga0070713_100078269 Ga0070713_1000782693 489
57 3300005548 Ga0070665_100238555 Ga0070665_1002385552 489
58 3300006175 Ga0070712_100145428 Ga0070712_1001454281 489
59 3300009098 Ga0105245_10154885 Ga0105245_101548852 489
60 3300013296 Ga0157374_10098288 Ga0157374_100982882 489
61 3300013297 Ga0157378_10125277 Ga0157378_101252772 489
62 3300025915 Ga0207693_10043785 Ga0207693_100437853 489
63 3300025922 Ga0207646_10082233 Ga0207646_100822332 489
64 3300026121 Ga0207683_10046023 Ga0207683_100460233 489
65 3300028379 Ga0268266_10112498 Ga0268266_101124982 489
66 3300046537 Ga0495598_0014826 Ga0495598_0014826_30_1499 489
67 3300050513 nmdc:mga0rr50_38897_c1 nmdc:mga0rr50_38897_c1_612_2081 489
68 3300005330 Ga0070690_100034239 Ga0070690_1000342391 490
69 3300005546 Ga0070696_100035418 Ga0070696_1000354184 490
70 3300005718 Ga0068866_10046564 Ga0068866_100465642 490
71 3300017792 Ga0163161_10013937 Ga0163161_100139372 490
72 3300025899 Ga0207642_10019935 Ga0207642_100199352 490
73 3300025905 Ga0207685_10020559 Ga0207685_100205592 490
74 3300025907 Ga0207645_10008104 Ga0207645_100081046 490
75 3300025931 Ga0207644_10028673 Ga0207644_100286732 490
76 3300025939 Ga0207665_10004292 Ga0207665_100042927 490
77 3300025960 Ga0207651_10044404 Ga0207651_100444042 490
78 3300035692 Ga0373935_0033064 Ga0373935_0033064_1314_2816 490
79 3300036401 Ga0373937_0010351 Ga0373937_0010351_4730_6205 490
80 3300005290 Ga0065712_10003383 Ga0065712_100033833 491
81 3300005293 Ga0065715_10004216 Ga0065715_100042163 491
82 3300005340 Ga0070689_100048388 Ga0070689_1000483882 491
83 3300005353 Ga0070669_100131033 Ga0070669_1001310331 491
84 3300005434 Ga0070709_10088446 Ga0070709_100884462 491
85 3300005457 Ga0070662_100044456 Ga0070662_1000444562 491
86 3300005535 Ga0070684_100030455 Ga0070684_1000304554 491
87 3300006163 Ga0070715_10014135 Ga0070715_100141353 491
88 3300006175 Ga0070712_100037541 Ga0070712_1000375412 491
89 3300007788 Ga0099795_10008251 Ga0099795_100082512 491
90 3300009147 Ga0114129_10015127 Ga0114129_100151277 491
91 3300009147 Ga0114129_10184161 Ga0114129_101841614 491
92 3300014325 Ga0163163_10064253 Ga0163163_100642533 491
93 3300014325 Ga0163163_10124995 Ga0163163_101249952 491
94 3300025915 Ga0207693_10016156 Ga0207693_100161566 491
95 3300026035 Ga0207703_10149241 Ga0207703_101492412 491
96 3300045051 Ga0451576_0192172 Ga0451576_0192172_590_2095 491
97 3300046517 Ga0495630_0027818 Ga0495630_0027818_969_2468 491
98 3300050507 nmdc:mga05p37_134225_c1 nmdc:mga05p37_134225_c1_554_2053 491
99 3300050507 nmdc:mga05p37_1970_c1 nmdc:mga05p37_1970_c1_5741_7222 491
100 3300050515 nmdc:mga0a205_157468_c1 nmdc:mga0a205_157468_c1_368_1867 491
101 3300005330 Ga0070690_100053844 Ga0070690_1000538441 492
102 3300005365 Ga0070688_100002046 Ga0070688_10000204612 492
103 3300005467 Ga0070706_100001926 Ga0070706_10000192613 492
104 3300005544 Ga0070686_100067379 Ga0070686_1000673792 492
105 3300005614 Ga0068856_100140996 Ga0068856_1001409962 492
106 3300025290 Ga0207673_1000356 Ga0207673_10003566 492
107 3300025315 Ga0207697_10011792 Ga0207697_100117923 492
108 3300025910 Ga0207684_10000186 Ga0207684_1000018623 492
109 3300025910 Ga0207684_10017955 Ga0207684_100179552 492
110 3300025915 Ga0207693_10078066 Ga0207693_100780662 492
111 3300025939 Ga0207665_10023343 Ga0207665_100233432 492
112 3300026121 Ga0207683_10057482 Ga0207683_100574824 492
113 3300046537 Ga0495598_0012921 Ga0495598_0012921_448_1968 492
114 3300048905 Ga0496102_0088162 Ga0496102_0088162_461_1981 492
115 3300048911 Ga0496108_0109590 Ga0496108_0109590_300_1820 492
116 3300048912 Ga0496109_0105364 Ga0496109_0105364_730_2250 492
117 3300005355 Ga0070671_100125271 Ga0070671_1001252712 493
118 3300005434 Ga0070709_10035564 Ga0070709_100355641 493
119 3300005439 Ga0070711_100088316 Ga0070711_1000883162 493
120 3300005445 Ga0070708_100096898 Ga0070708_1000968982 493
121 3300005468 Ga0070707_100034193 Ga0070707_1000341935 493
122 3300005471 Ga0070698_100241548 Ga0070698_1002415481 493
123 3300006175 Ga0070712_100006774 Ga0070712_1000067746 493
124 3300009147 Ga0114129_10009497 Ga0114129_100094977 493
125 3300013306 Ga0163162_10038017 Ga0163162_100380173 493
126 3300025315 Ga0207697_10013116 Ga0207697_100131163 493
127 3300025906 Ga0207699_10100654 Ga0207699_101006541 493
128 3300025910 Ga0207684_10002487 Ga0207684_1000248712 493
129 3300025916 Ga0207663_10054719 Ga0207663_100547193 493
130 3300025922 Ga0207646_10062566 Ga0207646_100625662 493
131 3300025931 Ga0207644_10110253 Ga0207644_101102531 493
132 3300025939 Ga0207665_10020888 Ga0207665_100208884 493
133 3300005290 Ga0065712_10002575 Ga0065712_100025753 494
134 3300005331 Ga0070670_100006841 Ga0070670_1000068416 494
135 3300005335 Ga0070666_10013040 Ga0070666_100130402 494
136 3300005338 Ga0068868_100016118 Ga0068868_1000161182 494
137 3300005340 Ga0070689_100022157 Ga0070689_1000221574 494
138 3300005354 Ga0070675_100015131 Ga0070675_1000151314 494
139 3300005354 Ga0070675_100144591 Ga0070675_1001445912 494
140 3300005355 Ga0070671_100005953 Ga0070671_1000059534 494
141 3300005364 Ga0070673_100050852 Ga0070673_1000508522 494
142 3300005367 Ga0070667_100034922 Ga0070667_1000349222 494
143 3300005439 Ga0070711_100051857 Ga0070711_1000518572 494
144 3300005445 Ga0070708_100153088 Ga0070708_1001530882 494
145 3300005455 Ga0070663_100020482 Ga0070663_1000204823 494
146 3300005457 Ga0070662_100036463 Ga0070662_1000364631 494
147 3300005536 Ga0070697_100069096 Ga0070697_1000690962 494
148 3300005543 Ga0070672_100067701 Ga0070672_1000677012 494
149 3300005548 Ga0070665_100074168 Ga0070665_1000741682 494
150 3300006028 Ga0070717_10029758 Ga0070717_100297586 494
151 3300006175 Ga0070712_100008603 Ga0070712_1000086035 494
152 3300006237 Ga0097621_100173375 Ga0097621_1001733751 494
153 3300006358 Ga0068871_100042299 Ga0068871_1000422993 494
154 3300013306 Ga0163162_10037428 Ga0163162_100374282 494
155 3300013306 Ga0163162_10197465 Ga0163162_101974652 494
156 3300013308 Ga0157375_10009424 Ga0157375_100094245 494
157 3300013308 Ga0157375_10150048 Ga0157375_101500482 494
158 3300025315 Ga0207697_10000438 Ga0207697_1000043817 494
159 3300025315 Ga0207697_10002314 Ga0207697_100023142 494
160 3300025315 Ga0207697_10005972 Ga0207697_100059724 494
161 3300025901 Ga0207688_10005408 Ga0207688_100054084 494
162 3300025910 Ga0207684_10000086 Ga0207684_10000086117 494
163 3300025923 Ga0207681_10061286 Ga0207681_100612862 494
164 3300025926 Ga0207659_10024637 Ga0207659_100246372 494
165 3300025926 Ga0207659_10059505 Ga0207659_100595052 494
166 3300025928 Ga0207700_10025689 Ga0207700_100256892 494
167 3300025931 Ga0207644_10003514 Ga0207644_100035146 494
168 3300025933 Ga0207706_10050499 Ga0207706_100504991 494
169 3300025934 Ga0207686_10118131 Ga0207686_101181312 494
170 3300025936 Ga0207670_10053287 Ga0207670_100532872 494
171 3300025940 Ga0207691_10006878 Ga0207691_100068788 494
172 3300025940 Ga0207691_10010382 Ga0207691_100103827 494
173 3300025972 Ga0207668_10105235 Ga0207668_101052352 494
174 3300026023 Ga0207677_10090952 Ga0207677_100909522 494
175 3300026067 Ga0207678_10009753 Ga0207678_100097534 494
176 3300026121 Ga0207683_10064239 Ga0207683_100642392 494
177 3300028379 Ga0268266_10148741 Ga0268266_101487412 494
178 3300035725 Ga0373947_0081955 Ga0373947_0081955_421_1962 494
179 3300048915 Ga0496112_0063129 Ga0496112_0063129_618_2153 494
180 3300005293 Ga0065715_10005624 Ga0065715_100056242 495
181 3300005328 Ga0070676_10017439 Ga0070676_100174393 495
182 3300005347 Ga0070668_100053100 Ga0070668_1000531002 495
183 3300005353 Ga0070669_100016893 Ga0070669_1000168933 495
184 3300005354 Ga0070675_100021297 Ga0070675_1000212974 495
185 3300005355 Ga0070671_100037401 Ga0070671_1000374013 495
186 3300005445 Ga0070708_100091989 Ga0070708_1000919892 495
187 3300005457 Ga0070662_100036090 Ga0070662_1000360901 495
188 3300005467 Ga0070706_100003303 Ga0070706_10000330317 495
189 3300005467 Ga0070706_100009594 Ga0070706_1000095945 495
190 3300005468 Ga0070707_100021654 Ga0070707_1000216545 495
191 3300005471 Ga0070698_100173178 Ga0070698_1001731782 495
192 3300005518 Ga0070699_100063486 Ga0070699_1000634863 495
193 3300009176 Ga0105242_10072543 Ga0105242_100725432 495
194 3300013297 Ga0157378_10065871 Ga0157378_100658712 495
195 3300013306 Ga0163162_10029487 Ga0163162_100294871 495
196 3300013308 Ga0157375_10106556 Ga0157375_101065562 495
197 3300025315 Ga0207697_10003112 Ga0207697_100031122 495
198 3300025907 Ga0207645_10076144 Ga0207645_100761441 495
199 3300025910 Ga0207684_10003013 Ga0207684_1000301318 495
200 3300025918 Ga0207662_10006736 Ga0207662_100067368 495
201 3300025923 Ga0207681_10105371 Ga0207681_101053711 495
202 3300025933 Ga0207706_10039457 Ga0207706_100394574 495
203 3300025940 Ga0207691_10162759 Ga0207691_101627592 495
204 3300035170 Ga0373943_0066994 Ga0373943_0066994_89_1657 495
205 3300035725 Ga0373947_0010962 Ga0373947_0010962_3225_4826 495
206 3300048903 Ga0496100_0026830 Ga0496100_0026830_1004_2572 495
207 3300048904 Ga0496101_0003554 Ga0496101_0003554_5758_7326 495
208 3300048906 Ga0496103_0018870 Ga0496103_0018870_944_2512 495
209 3300048909 Ga0496106_0046962 Ga0496106_0046962_929_2497 495
210 3300048910 Ga0496107_0012485 Ga0496107_0012485_3674_5242 495
211 3300048917 Ga0496114_0124004 Ga0496114_0124004_387_1955 495
212 3300048918 Ga0496115_0043240 Ga0496115_0043240_1145_2713 495
213 3300005354 Ga0070675_100110174 Ga0070675_1001101741 496
214 3300005467 Ga0070706_100044260 Ga0070706_1000442602 496
215 3300005535 Ga0070684_100070234 Ga0070684_1000702342 496
216 3300005548 Ga0070665_100151898 Ga0070665_1001518982 496
217 3300005564 Ga0070664_100017227 Ga0070664_1000172273 496
218 3300006028 Ga0070717_10014397 Ga0070717_100143974 496
219 3300013296 Ga0157374_10012955 Ga0157374_100129554 496
220 3300025903 Ga0207680_10022996 Ga0207680_100229962 496
221 3300025910 Ga0207684_10031620 Ga0207684_100316204 496
222 3300025910 Ga0207684_10175736 Ga0207684_101757361 496
223 3300026067 Ga0207678_10050828 Ga0207678_100508285 496
224 3300048907 Ga0496104_0054285 Ga0496104_0054285_846_2378 496
225 3300048912 Ga0496109_0238545 Ga0496109_0238545_173_1663 496
226 3300048915 Ga0496112_0003138 Ga0496112_0003138_8204_9694 496
227 3300048918 Ga0496115_0019542 Ga0496115_0019542_2630_4162 496
228 3300005290 Ga0065712_10008555 Ga0065712_100085552 497
229 3300005330 Ga0070690_100062563 Ga0070690_1000625632 497
230 3300005331 Ga0070670_100098462 Ga0070670_1000984621 497
231 3300005347 Ga0070668_100038713 Ga0070668_1000387133 497
232 3300005353 Ga0070669_100085870 Ga0070669_1000858701 497
233 3300005356 Ga0070674_100007164 Ga0070674_1000071647 497
234 3300005364 Ga0070673_100020120 Ga0070673_1000201203 497
235 3300005436 Ga0070713_100173416 Ga0070713_1001734161 497
236 3300005437 Ga0070710_10044735 Ga0070710_100447352 497
237 3300005438 Ga0070701_10042325 Ga0070701_100423251 497
238 3300005441 Ga0070700_100053050 Ga0070700_1000530502 497
239 3300005445 Ga0070708_100124293 Ga0070708_1001242932 497
240 3300005456 Ga0070678_100063855 Ga0070678_1000638552 497
241 3300005467 Ga0070706_100003887 Ga0070706_1000038877 497
242 3300005468 Ga0070707_100016201 Ga0070707_1000162014 497
243 3300005468 Ga0070707_100036095 Ga0070707_1000360955 497
244 3300005468 Ga0070707_100081247 Ga0070707_1000812472 497
245 3300005518 Ga0070699_100060773 Ga0070699_1000607734 497
246 3300005564 Ga0070664_100095855 Ga0070664_1000958552 497
247 3300005617 Ga0068859_100003179 Ga0068859_1000031799 497
248 3300005937 Ga0081455_10007236 Ga0081455_1000723612 497
249 3300005937 Ga0081455_10034009 Ga0081455_100340093 497
250 3300005937 Ga0081455_10070788 Ga0081455_100707884 497
251 3300005937 Ga0081455_10175306 Ga0081455_101753061 497
252 3300005983 Ga0081540_1000152 Ga0081540_100015270 497
253 3300005985 Ga0081539_10014875 Ga0081539_100148752 497
254 3300006028 Ga0070717_10083697 Ga0070717_100836972 497
255 3300006163 Ga0070715_10046064 Ga0070715_100460642 497
256 3300006931 Ga0097620_100003179 Ga0097620_1000031799 497
257 3300009094 Ga0111539_10109024 Ga0111539_101090242 497
258 3300009553 Ga0105249_10037239 Ga0105249_100372392 497
259 3300010375 Ga0105239_10238907 Ga0105239_102389072 497
260 3300013296 Ga0157374_10037864 Ga0157374_100378644 497
261 3300013308 Ga0157375_10001548 Ga0157375_100015489 497
262 3300014968 Ga0157379_10028693 Ga0157379_100286935 497
263 3300017792 Ga0163161_10098919 Ga0163161_100989192 497
264 3300025271 Ga0207666_1000279 Ga0207666_10002793 497
265 3300025290 Ga0207673_1001430 Ga0207673_10014302 497
266 3300025315 Ga0207697_10005743 Ga0207697_100057432 497
267 3300025901 Ga0207688_10004490 Ga0207688_100044903 497
268 3300025904 Ga0207647_10004405 Ga0207647_1000440510 497
269 3300025907 Ga0207645_10017146 Ga0207645_100171462 497
270 3300025912 Ga0207707_10009207 Ga0207707_100092072 497
271 3300025922 Ga0207646_10041444 Ga0207646_100414441 497
272 3300025923 Ga0207681_10045208 Ga0207681_100452082 497
273 3300025926 Ga0207659_10005881 Ga0207659_100058812 497
274 3300025928 Ga0207700_10021405 Ga0207700_100214052 497
275 3300025931 Ga0207644_10029126 Ga0207644_100291262 497
276 3300025932 Ga0207690_10004400 Ga0207690_100044009 497
277 3300025932 Ga0207690_10058584 Ga0207690_100585842 497
278 3300025933 Ga0207706_10015831 Ga0207706_100158314 497
279 3300025933 Ga0207706_10056365 Ga0207706_100563652 497
280 3300025939 Ga0207665_10018787 Ga0207665_100187872 497
281 3300025940 Ga0207691_10129956 Ga0207691_101299562 497
282 3300025972 Ga0207668_10024684 Ga0207668_100246842 497
283 3300026023 Ga0207677_10055080 Ga0207677_100550803 497
284 3300026075 Ga0207708_10120133 Ga0207708_101201332 497
285 3300026078 Ga0207702_10021761 Ga0207702_100217613 497
286 3300026088 Ga0207641_10012208 Ga0207641_100122086 497
287 3300026089 Ga0207648_10061793 Ga0207648_100617932 497
288 3300026121 Ga0207683_10148694 Ga0207683_101486942 497
289 3300028379 Ga0268266_10094816 Ga0268266_100948163 497
290 3300028379 Ga0268266_10121934 Ga0268266_101219341 497
291 3300035692 Ga0373935_0102637 Ga0373935_0102637_152_1711 497
292 3300037418 Ga0395900_0005968 Ga0395900_0005968_1414_2949 497
293 3300037466 Ga0395898_0001597 Ga0395898_0001597_3349_4884 497
294 3300037471 Ga0395905_0003973 Ga0395905_0003973_13334_14869 497
295 3300038443 Ga0395901_0000525 Ga0395901_0000525_28885_30420 497
296 3300048907 Ga0496104_0187380 Ga0496104_0187380_49_1608 497
297 3300048913 Ga0496110_0065458 Ga0496110_0065458_114_1673 497
298 3300005468 Ga0070707_100052442 Ga0070707_1000524422 498
299 3300025910 Ga0207684_10036340 Ga0207684_100363405 498
300 3300013307 Ga0157372_10030381 Ga0157372_100303814 499
301 3300005354 Ga0070675_100005376 Ga0070675_1000053762 500
302 3300005535 Ga0070684_100001068 Ga0070684_1000010689 500
303 3300005937 Ga0081455_10014762 Ga0081455_100147623 500
304 3300025919 Ga0207657_10028248 Ga0207657_100282484 500
305 3300025936 Ga0207670_10022473 Ga0207670_100224732 500
306 3300005456 Ga0070678_100006535 Ga0070678_1000065353 504
307 3300013297 Ga0157378_10191327 Ga0157378_101913271 504
308 3300026121 Ga0207683_10005253 Ga0207683_100052533 504
309 3300003911 JGI25405J52794_10004178 JGI25405J52794_100041782 506
310 3300005289 Ga0065704_10103115 Ga0065704_101031152 506
311 3300005439 Ga0070711_100025431 Ga0070711_1000254311 506
312 3300005937 Ga0081455_10000385 Ga0081455_1000038525 506
313 3300005937 Ga0081455_10002288 Ga0081455_1000228823 506
314 3300005937 Ga0081455_10018839 Ga0081455_100188395 506
315 3300005983 Ga0081540_1030042 Ga0081540_10300422 506
316 3300006844 Ga0075428_100104683 Ga0075428_1001046832 506
317 3300009147 Ga0114129_10015127 Ga0114129_100151276 506
318 3300025315 Ga0207697_10001111 Ga0207697_1000111110 506
319 3300025915 Ga0207693_10077665 Ga0207693_100776652 506
320 3300037418 Ga0395900_0005968 Ga0395900_0005968_2967_4529 506
321 3300037466 Ga0395898_0001597 Ga0395898_0001597_4902_6464 506
322 3300038443 Ga0395901_0000525 Ga0395901_0000525_30438_32000 506
323 3300050507 nmdc:mga05p37_1970_c1 nmdc:mga05p37_1970_c1_7233_8795 506
324 3300005295 Ga0065707_10008501 Ga0065707_100085012 509
325 3300003911 JGI25405J52794_10000065 JGI25405J52794_100000654 510
326 3300005937 Ga0081455_10000385 Ga0081455_1000038526 510

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

77

141

0.96

PF00155

Aminotran_1_2

Aminotransferase class I and II

202

545

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r1h-assembly1.cif.gz_B gntr family transcriptional regulator from listeria monocytogenes 0.9129 17 86
6sbs-assembly1.cif.gz_A ytra from sulfolobus acidocaldarius, a gntr-family transcription factor 0.9063 9 86
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9063 12 86
3neu-assembly1.cif.gz_A-2 the crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262 0.9009 12 86
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.8975 19 86
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.979 44 85 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 22 86 1.10.10.10
af_Q2FWW6_10_126_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 19 86 1.10.10.10
2wv0J01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 19 88 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.916 44 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7I8CMK8-F1-model_v4 GntR family transcriptional regulator 0.9164 388 508
AF-A0A2E7HFL5-F1-model_v4 GntR family transcriptional regulator 0.9091 281 452
AF-A0A4Y9RM15-F1-model_v4 PLP-dependent aminotransferase family protein 0.9087 188 505 GO:0008483
GO:0009058
GO:0030170
AF-A0A2R7TDR9-F1-model_v4 deleted 0.8997 215 506
AF-A0A4Y9RM15-F1-model_v4 PLP-dependent aminotransferase family protein 0.898 188 505 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
75.53 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map