F408278

General Info

Members Datasets Scaffolds Average Seq Length
326 120 652 313

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10159423|Ga0114129_101594232
Length 337
Sequence VTDSGYAIRDLGRERLLTVRGAEYRTYYSERLIRMLIERKGIDRAPLYFPFKETRGRHFLERLFSYLETQDVGSLTVLEVGCSFGHITEYLVEQPLVRAIHTFDVDRAFAEIARAKVEELGLHKVREVLHLSDEETTRLPFPDAAFDLVLAVGVIEHLPARHRRRYVDEYYRVLRPGGHIAILDTPNRAFPLETHSVGLPGIQWLPSRLAFRYARLLRAQRLDGVPFEEFDAGAWRNASWRELFPADGAEALEDVTEQAGYGWRFFRDTARSRLRRAALPLFRAASAGLAATGRPPSLALPYFNVVFRKRASPARRRGRGCSSPRCGPRWPWSRSCG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.92
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10159423 3300009147 Bacteria 3084
2 Ga0070676_10114609 3300005328 Bacteria 1683
3 Ga0068869_100007201 3300005334 Bacteria 7092
4 Ga0068869_100425628 3300005334 Bacteria 1096
5 Ga0070680_100012683 3300005336 Bacteria 6551
6 Ga0070680_100013825 3300005336 Bacteria 6296
7 Ga0070691_10070554 3300005341 Bacteria 1695
8 Ga0070668_100074833 3300005347 Bacteria 2643
9 Ga0070669_100019286 3300005353 Bacteria 4871
10 Ga0070703_10006809 3300005406 Unclassified 3208
11 Ga0070705_100030162 3300005440 Bacteria 2991
12 Ga0070705_100067188 3300005440 Bacteria 2153
13 Ga0070694_100004727 3300005444 Bacteria 8201
14 Ga0070694_100060986 3300005444 Bacteria 2574
15 Ga0070708_100011184 3300005445 Bacteria 7298
16 Ga0070708_100022549 3300005445 Bacteria 5341
17 Ga0070708_100043878 3300005445 Bacteria 3930
18 Ga0070708_100044059 3300005445 Bacteria 3922
19 Ga0070708_100078941 3300005445 Bacteria 2976
20 Ga0070708_100121797 3300005445 Bacteria 2407
21 Ga0070708_100276445 3300005445 Bacteria 1580
22 Ga0070708_100409378 3300005445 Bacteria 1279
23 Ga0070662_100234534 3300005457 Bacteria 1469
24 Ga0070662_100267443 3300005457 Bacteria 1379
25 Ga0070681_10074681 3300005458 Bacteria 3351
26 Ga0070706_100004614 3300005467 Bacteria 13225
27 Ga0070706_100010332 3300005467 Bacteria 8671
28 Ga0070706_100011767 3300005467 Bacteria 8120
29 Ga0070706_100013353 3300005467 Bacteria 7593
30 Ga0070706_100021187 3300005467 Bacteria 5986
31 Ga0070706_100106813 3300005467 Bacteria 2604
32 Ga0070706_100127641 3300005467 Bacteria 2372
33 Ga0070707_100002645 3300005468 Bacteria 17038
34 Ga0070707_100008301 3300005468 Bacteria 9638
35 Ga0070707_100034544 3300005468 Bacteria 4823
36 Ga0070707_100044529 3300005468 Bacteria 4249
37 Ga0070707_100070633 3300005468 Bacteria 3363
38 Ga0070707_100096179 3300005468 Bacteria 2868
39 Ga0070707_100175100 3300005468 Bacteria 2091
40 Ga0070707_100296426 3300005468 Bacteria 1571
41 Ga0070698_100017624 3300005471 Bacteria 7525
42 Ga0070698_100062326 3300005471 Bacteria 3762
43 Ga0070698_100069875 3300005471 Bacteria 3525
44 Ga0070698_100127269 3300005471 Bacteria 2504
45 Ga0070698_100132749 3300005471 Unclassified 2444
46 Ga0070699_100013404 3300005518 Bacteria 7062
47 Ga0070699_100026155 3300005518 Bacteria 5034
48 Ga0070699_100027063 3300005518 Unclassified 4946
49 Ga0070697_100006691 3300005536 Bacteria 8943
50 Ga0070697_100073733 3300005536 Bacteria 2803
51 Ga0070697_100132431 3300005536 Bacteria 2092
52 Ga0070697_100181008 3300005536 Bacteria 1786
53 Ga0070697_100275928 3300005536 Bacteria 1441
54 Ga0070672_100003766 3300005543 Bacteria 9867
55 Ga0070686_100025429 3300005544 Bacteria 3563
56 Ga0070695_100002686 3300005545 Bacteria 10294
57 Ga0070695_100005954 3300005545 Bacteria 7198
58 Ga0070695_100034877 3300005545 Bacteria 3158
59 Ga0070696_100331053 3300005546 Bacteria 1174
60 Ga0070704_100072152 3300005549 Bacteria 2511
61 Ga0070702_100045374 3300005615 Bacteria 2486
62 Ga0070702_100145821 3300005615 Bacteria 1513
63 Ga0068859_100040450 3300005617 Bacteria 4680
64 Ga0068859_100059222 3300005617 Bacteria 3858
65 Ga0068866_10111672 3300005718 Bacteria 1526
66 Ga0068861_100145968 3300005719 Unclassified 1936
67 Ga0068861_100146618 3300005719 Bacteria 1932
68 Ga0068863_100083846 3300005841 Bacteria 3020
69 Ga0068860_100202063 3300005843 Bacteria 1926
70 Ga0068860_100246263 3300005843 Bacteria 1739
71 Ga0068860_100280699 3300005843 Bacteria 1627
72 Ga0068860_100316448 3300005843 Bacteria 1531
73 Ga0068862_100035870 3300005844 Bacteria 4202
74 Ga0068862_100063437 3300005844 Bacteria 3179
75 Ga0081540_1049597 3300005983 Bacteria 2093
76 Ga0081539_10000141 3300005985 Bacteria 166050
77 Ga0075432_10013900 3300006058 Bacteria 2740
78 Ga0070715_10012695 3300006163 Unclassified 3074
79 Ga0075428_100000158 3300006844 Bacteria 61841
80 Ga0075428_100000773 3300006844 Bacteria 33312
81 Ga0075428_100002983 3300006844 Bacteria 18440
82 Ga0075428_100024566 3300006844 Bacteria 6668
83 Ga0075428_100031325 3300006844 Bacteria 5881
84 Ga0075428_100036135 3300006844 Bacteria 5444
85 Ga0075428_100164218 3300006844 Bacteria 2409
86 Ga0075428_100370695 3300006844 Bacteria 1535
87 Ga0075428_100563754 3300006844 Bacteria 1217
88 Ga0075430_100000266 3300006846 Bacteria 36870
89 Ga0075430_100000973 3300006846 Bacteria 22586
90 Ga0075430_100004323 3300006846 Bacteria 12000
91 Ga0075431_100000912 3300006847 Bacteria 26037
92 Ga0075431_100001041 3300006847 Bacteria 24739
93 Ga0075431_100001043 3300006847 Bacteria 24714
94 Ga0075431_100001691 3300006847 Bacteria 20710
95 Ga0075431_100003849 3300006847 Bacteria 14594
96 Ga0075431_100025696 3300006847 Bacteria 6035
97 Ga0075431_100314547 3300006847 Bacteria 1580
98 Ga0075433_10000249 3300006852 Bacteria 31205
99 Ga0075433_10003092 3300006852 Bacteria 12798
100 Ga0075433_10005610 3300006852 Bacteria 9862
101 Ga0075433_10006952 3300006852 Bacteria 8967
102 Ga0075433_10012805 3300006852 Bacteria 6795
103 Ga0075433_10013250 3300006852 Bacteria 6697
104 Ga0075433_10051807 3300006852 Bacteria 3576
105 Ga0075433_10082096 3300006852 Bacteria 2842
106 Ga0075433_10332695 3300006852 Bacteria 1343
107 Ga0075434_100000081 3300006871 Bacteria 51958
108 Ga0075434_100002565 3300006871 Bacteria 16038
109 Ga0075434_100017930 3300006871 Bacteria 6830
110 Ga0075434_100021598 3300006871 Bacteria 6259
111 Ga0075434_100074516 3300006871 Bacteria 3387
112 Ga0075434_100084780 3300006871 Bacteria 3167
113 Ga0075434_100093761 3300006871 Bacteria 3006
114 Ga0075434_100140222 3300006871 Bacteria 2437
115 Ga0075434_100260012 3300006871 Bacteria 1755
116 Ga0075429_100000035 3300006880 Bacteria 62940
117 Ga0075429_100000882 3300006880 Bacteria 23700
118 Ga0075429_100001267 3300006880 Bacteria 20553
119 Ga0075429_100035608 3300006880 Bacteria 4330
120 Ga0075429_100426483 3300006880 Bacteria 1161
121 Ga0075436_100004919 3300006914 Bacteria 9182
122 Ga0075436_100026222 3300006914 Bacteria 4012
123 Ga0075436_100205889 3300006914 Bacteria 1394
124 Ga0097620_100040450 3300006931 Bacteria 4680
125 Ga0097620_100059221 3300006931 Bacteria 3858
126 Ga0075435_100001297 3300007076 Bacteria 16072
127 Ga0075435_100001609 3300007076 Bacteria 14596
128 Ga0075435_100007639 3300007076 Bacteria 7721
129 Ga0075435_100028050 3300007076 Bacteria 4412
130 Ga0075435_100030887 3300007076 Bacteria 4216
131 Ga0075435_100054859 3300007076 Bacteria 3218
132 Ga0075435_100441723 3300007076 Unclassified 1121
133 Ga0099794_10144397 3300007265 Bacteria 1206
134 Ga0111539_10001127 3300009094 Bacteria 35338
135 Ga0111539_10001468 3300009094 Bacteria 31504
136 Ga0111539_10010648 3300009094 Bacteria 11581
137 Ga0111539_10144506 3300009094 Bacteria 2785
138 Ga0111539_10325738 3300009094 Unclassified 1788
139 Ga0111539_10594243 3300009094 Bacteria 1289
140 Ga0111539_10692736 3300009094 Unclassified 1186
141 Ga0114129_10000003 3300009147 Bacteria 183186
142 Ga0114129_10000207 3300009147 Bacteria 65630
143 Ga0114129_10000810 3300009147 Bacteria 40217
144 Ga0114129_10001757 3300009147 Bacteria 29522
145 Ga0114129_10002705 3300009147 Bacteria 24694
146 Ga0114129_10031281 3300009147 Bacteria 7526
147 Ga0114129_10033103 3300009147 Bacteria 7305
148 Ga0114129_10043578 3300009147 Bacteria 6313
149 Ga0114129_10067629 3300009147 Bacteria 4983
150 Ga0114129_10110040 3300009147 Bacteria 3803
151 Ga0114129_10145001 3300009147 Bacteria 3253
152 Ga0114129_10166459 3300009147 Archaea 3008
153 Ga0114129_10193626 3300009147 Bacteria 2759
154 Ga0114129_10344015 3300009147 Bacteria 1977
155 Ga0114129_10725242 3300009147 Bacteria 1275
156 Ga0105243_10081319 3300009148 Bacteria 2645
157 Ga0105243_10425723 3300009148 Unclassified 1239
158 Ga0105242_10020496 3300009176 Bacteria 5184
159 Ga0105248_10211745 3300009177 Bacteria 2184
160 Ga0105249_10066205 3300009553 Bacteria 3326
161 Ga0105249_10451714 3300009553 Bacteria 1324
162 Ga0157378_10257826 3300013297 Bacteria 1672
163 Ga0157378_10410882 3300013297 Bacteria 1336
164 Ga0163162_10044823 3300013306 Bacteria 4430
165 Ga0157372_10295719 3300013307 Bacteria 1883
166 Ga0207653_10019932 3300025885 Bacteria 2118
167 Ga0207685_10083234 3300025905 Archaea 1329
168 Ga0207645_10056288 3300025907 Bacteria 2511
169 Ga0207684_10010067 3300025910 Bacteria 8328
170 Ga0207684_10025493 3300025910 Bacteria 5039
171 Ga0207684_10032101 3300025910 Bacteria 4466
172 Ga0207684_10090323 3300025910 Bacteria 2610
173 Ga0207707_10057158 3300025912 Bacteria 3396
174 Ga0207693_10028902 3300025915 Bacteria 4381
175 Ga0207660_10012506 3300025917 Bacteria 5555
176 Ga0207646_10016639 3300025922 Bacteria 6898
177 Ga0207646_10019616 3300025922 Bacteria 6280
178 Ga0207646_10020926 3300025922 Bacteria 6052
179 Ga0207646_10038540 3300025922 Bacteria 4304
180 Ga0207646_10082143 3300025922 Bacteria 2881
181 Ga0207646_10311145 3300025922 Bacteria 1423
182 Ga0207681_10026992 3300025923 Bacteria 3709
183 Ga0207709_10004297 3300025935 Bacteria 8256
184 Ga0207709_10386563 3300025935 Unclassified 1066
185 Ga0207691_10027248 3300025940 Bacteria 5361
186 Ga0207689_10049155 3300025942 Unclassified 3479
187 Ga0207689_10257044 3300025942 Bacteria 1445
188 Ga0207712_10407049 3300025961 Bacteria 1145
189 Ga0207668_10010048 3300025972 Bacteria 5700
190 Ga0207648_10106471 3300026089 Bacteria 2461
191 Ga0207648_10124442 3300026089 Bacteria 2268
192 Ga0207428_10000035 3300027907 Bacteria 229100
193 Ga0207428_10007460 3300027907 Bacteria 9969
194 Ga0268265_10049002 3300028380 Bacteria 3175
195 Ga0268265_10065805 3300028380 Bacteria 2799
196 Ga0268264_10303608 3300028381 Bacteria 1503
197 Ga0307408_100008450 3300031548 Bacteria 6798
198 Ga0307416_100071031 3300032002 Bacteria 2890
199 Ga0307411_10011394 3300032005 Bacteria 4798
200 Ga0373940_0020947 3300035088 Bacteria 1666
201 Ga0373932_0015584 3300035112 Bacteria 1928
202 Ga0373931_0119711 3300035691 Bacteria 1503
203 Ga0395899_0052041 3300037312 Bacteria 3037
204 Ga0395900_0005878 3300037418 Bacteria 12812
205 Ga0395898_0090228 3300037466 Bacteria 2949
206 Ga0395905_0316186 3300037471 Bacteria 1451
207 Ga0395901_0000854 3300038443 Bacteria 33520
208 Ga0451577_0006961 3300042876 Bacteria 11168
209 Ga0451577_0038762 3300042876 Bacteria 4285
210 Ga0453684_0052921 3300044712 Bacteria 5304
211 Ga0451576_0079485 3300045051 Bacteria 3412
212 Ga0451576_0157615 3300045051 Bacteria 2368
213 Ga0451576_0227073 3300045051 Unclassified 1949
214 Ga0451576_0347266 3300045051 Bacteria 1553
215 Ga0451576_0597005 3300045051 Bacteria 1160
216 Ga0495580_0000359 3300046472 Bacteria 37195
217 Ga0495642_0046598 3300046528 Bacteria 1774
218 Ga0495621_0057930 3300046539 Bacteria 1400
219 Ga0495669_0098099 3300046684 Bacteria 1359
220 Ga0496106_0123590 3300048909 Bacteria 2025
221 Ga0496106_0320725 3300048909 Bacteria 1244
222 Ga0496107_0096027 3300048910 Unclassified 2169
223 Ga0501031_0091647 3300049568 Bacteria 1983
224 Ga0501031_0104859 3300049568 Bacteria 1845
225 Ga0501038_0084578 3300049574 Bacteria 2669
226 Ga0501039_0027929 3300049575 Bacteria 4340
227 Ga0501040_0027915 3300049576 Bacteria 3802
228 Ga0501040_0281098 3300049576 Unclassified 1189
229 Ga0501040_0346024 3300049576 Bacteria 1065
230 Ga0501041_0035911 3300049577 Bacteria 3003
231 Ga0501041_0177275 3300049577 Bacteria 1334
232 Ga0501042_0017659 3300049578 Bacteria 4925
233 Ga0501042_0067739 3300049578 Bacteria 2552
234 Ga0501042_0259366 3300049578 Bacteria 1255
235 Ga0501043_0106534 3300049579 Bacteria 2202
236 Ga0501048_0025789 3300049582 Bacteria 4282
237 Ga0501048_0075440 3300049582 Bacteria 2379
238 Ga0501072_0028272 3300049588 Bacteria 4377
239 Ga0501072_0051590 3300049588 Bacteria 3239
240 Ga0501074_0133479 3300049590 Bacteria 1776
241 Ga0501074_0151960 3300049590 Unclassified 1655
242 Ga0501075_0049559 3300049591 Bacteria 3157
243 Ga0501075_0059783 3300049591 Bacteria 2871
244 Ga0501076_0020299 3300049592 Bacteria 5085
245 Ga0501076_0038479 3300049592 Bacteria 3755
246 Ga0501077_0002263 3300049593 Bacteria 11614
247 Ga0501079_0005519 3300049741 Bacteria 9431
248 Ga0501079_0285907 3300049741 Bacteria 1289
249 Ga0501080_0147997 3300049742 Unclassified 2171
250 Ga0501081_0000876 3300049743 Bacteria 17751
251 Ga0501081_0018148 3300049743 Bacteria 4670
252 Ga0501081_0099980 3300049743 Bacteria 2049
253 Ga0501083_0260242 3300049744 Unclassified 1129
254 Ga0501045_0031667 3300049824 Bacteria 3830
255 Ga0501045_0108343 3300049824 Unclassified 2059
256 nmdc:mga05p37_1127_c1 3300050507 Bacteria 30695
257 nmdc:mga05p37_13067_c1 3300050507 Bacteria 9936
258 nmdc:mga05p37_141506_c1 3300050507 Bacteria 2947
259 nmdc:mga05p37_154245_c2 3300050507 Bacteria 2012
260 nmdc:mga05p37_1719_c1 3300050507 Bacteria 25525
261 nmdc:mga05p37_1750_c1 3300050507 Bacteria 25352
262 nmdc:mga05p37_200918_c1 3300050507 Unclassified 2414
263 nmdc:mga05p37_24379_c1 3300050507 Bacteria 7351
264 nmdc:mga05p37_279_c1 3300050507 Bacteria 53447
265 nmdc:mga05p37_44823_c1 3300050507 Bacteria 5441
266 nmdc:mga05p37_56408_c1 3300050507 Bacteria 4837
267 nmdc:mga05p37_5936_c1 3300050507 Bacteria 14367
268 nmdc:mga09592_1206_c1 3300050508 Bacteria 20717
269 nmdc:mga09592_1472_c1 3300050508 Bacteria 18918
270 nmdc:mga09592_17179_c1 3300050508 Bacteria 5925
271 nmdc:mga09592_198681_c1 3300050508 Bacteria 1736
272 nmdc:mga09592_4637_c1 3300050508 Bacteria 11131
273 nmdc:mga09592_95502_c1 3300050508 Archaea 2543
274 nmdc:mga09592_95994_c1 3300050508 Bacteria 2536
275 nmdc:mga0qj67_428878_c1 3300050509 Unclassified 1066
276 nmdc:mga0qj67_451236_c1 3300050509 Bacteria 1036
277 nmdc:mga0qj67_758_c1 3300050509 Bacteria 21969
278 nmdc:mga0qj67_816_c1 3300050509 Bacteria 21261
279 nmdc:mga06r32_11715_c1 3300050510 Bacteria 7893
280 nmdc:mga06r32_2270_c1 3300050510 Bacteria 17188
281 nmdc:mga06r32_231126_c1 3300050510 Bacteria 1837
282 nmdc:mga06r32_301_c1 3300050510 Bacteria 40902
283 nmdc:mga06r32_304994_c1 3300050510 Bacteria 1578
284 nmdc:mga06r32_52005_c1 3300050510 Bacteria 3922
285 nmdc:mga06r32_56295_c1 3300050510 Bacteria 3775
286 nmdc:mga06r32_60632_c1 3300050510 Bacteria 3641
287 nmdc:mga08y16_203354_c1 3300050511 Unclassified 2052
288 nmdc:mga08y16_22534_c1 3300050511 Bacteria 6650
289 nmdc:mga08y16_9990_c1 3300050511 Bacteria 9959
290 nmdc:mga0n895_26237_c1 3300050512 Bacteria 5515
291 nmdc:mga0n895_3598_c1 3300050512 Bacteria 12529
292 nmdc:mga0n895_42919_c1 3300050512 Bacteria 4403
293 nmdc:mga0n895_4363_c1 3300050512 Bacteria 11598
294 nmdc:mga0n895_4488_c1 3300050512 Bacteria 11473
295 nmdc:mga0n895_51996_c1 3300050512 Bacteria 4021
296 nmdc:mga0n895_53099_c1 3300050512 Bacteria 3981
297 nmdc:mga0n895_80849_c2 3300050512 Archaea 2018
298 nmdc:mga0rr50_11409_c1 3300050513 Bacteria 5689
299 nmdc:mga0rr50_11677_c1 3300050513 Bacteria 5637
300 nmdc:mga0rr50_1359_c1 3300050513 Bacteria 13370
301 nmdc:mga0rr50_16670_c1 3300050513 Bacteria 4886
302 nmdc:mga0rr50_30629_c1 3300050513 Bacteria 3811
303 nmdc:mga0rr50_4932_c1 3300050513 Bacteria 7899
304 nmdc:mga0rr50_6851_c1 3300050513 Bacteria 6983
305 nmdc:mga0rr50_78491_c1 3300050513 Bacteria 2541
306 nmdc:mga08x19_20349_c1 3300050514 Bacteria 4086
307 nmdc:mga08x19_20398_c1 3300050514 Bacteria 4081
308 nmdc:mga08x19_20877_c1 3300050514 Bacteria 4037
309 nmdc:mga0a205_16704_c1 3300050515 Bacteria 6873
310 nmdc:mga0a205_1794_c1 3300050515 Bacteria 17954
311 nmdc:mga0a205_199578_c1 3300050515 Bacteria 1891
312 nmdc:mga0a205_208_c1 3300050515 Bacteria 41024
313 nmdc:mga0a205_435669_c1 3300050515 Bacteria 1172
314 nmdc:mga0a205_4573_c1 3300050515 Bacteria 12409
315 nmdc:mga0a205_482626_c1 3300050515 Bacteria 1097
316 nmdc:mga0a205_73324_c1 3300050515 Bacteria 3308
317 nmdc:mga0a205_93440_c1 3300050515 Bacteria 2906
318 nmdc:mga0a205_9419_c1 3300050515 Bacteria 8929
319 Ga0501084_0013433 3300054114 Bacteria 6776
320 Ga0501084_0077432 3300054114 Bacteria 2788
321 Ga0501084_0122458 3300054114 Bacteria 2187
322 Ga0501084_0183893 3300054114 Unclassified 1764
323 Ga0501082_0024640 3300060353 Bacteria 5186
324 Ga0501082_0214596 3300060353 Bacteria 1674
325 Ga0530510_0093649 3300061734 Bacteria 2194
326 Ga0530510_0133768 3300061734 Bacteria 1825
327 Ga0114129_10159423
328 Ga0070676_10114609
329 Ga0068869_100007201
330 Ga0068869_100425628
331 Ga0070680_100012683
332 Ga0070680_100013825
333 Ga0070691_10070554
334 Ga0070668_100074833
335 Ga0070669_100019286
336 Ga0070703_10006809
337 Ga0070705_100030162
338 Ga0070705_100067188
339 Ga0070694_100004727
340 Ga0070694_100060986
341 Ga0070708_100011184
342 Ga0070708_100022549
343 Ga0070708_100043878
344 Ga0070708_100044059
345 Ga0070708_100078941
346 Ga0070708_100121797
347 Ga0070708_100276445
348 Ga0070708_100409378
349 Ga0070662_100234534
350 Ga0070662_100267443
351 Ga0070681_10074681
352 Ga0070706_100004614
353 Ga0070706_100010332
354 Ga0070706_100011767
355 Ga0070706_100013353
356 Ga0070706_100021187
357 Ga0070706_100106813
358 Ga0070706_100127641
359 Ga0070707_100002645
360 Ga0070707_100008301
361 Ga0070707_100034544
362 Ga0070707_100044529
363 Ga0070707_100070633
364 Ga0070707_100096179
365 Ga0070707_100175100
366 Ga0070707_100296426
367 Ga0070698_100017624
368 Ga0070698_100062326
369 Ga0070698_100069875
370 Ga0070698_100127269
371 Ga0070698_100132749
372 Ga0070699_100013404
373 Ga0070699_100026155
374 Ga0070699_100027063
375 Ga0070697_100006691
376 Ga0070697_100073733
377 Ga0070697_100132431
378 Ga0070697_100181008
379 Ga0070697_100275928
380 Ga0070672_100003766
381 Ga0070686_100025429
382 Ga0070695_100002686
383 Ga0070695_100005954
384 Ga0070695_100034877
385 Ga0070696_100331053
386 Ga0070704_100072152
387 Ga0070702_100045374
388 Ga0070702_100145821
389 Ga0068859_100040450
390 Ga0068859_100059222
391 Ga0068866_10111672
392 Ga0068861_100145968
393 Ga0068861_100146618
394 Ga0068863_100083846
395 Ga0068860_100202063
396 Ga0068860_100246263
397 Ga0068860_100280699
398 Ga0068860_100316448
399 Ga0068862_100035870
400 Ga0068862_100063437
401 Ga0081540_1049597
402 Ga0081539_10000141
403 Ga0075432_10013900
404 Ga0070715_10012695
405 Ga0075428_100000158
406 Ga0075428_100000773
407 Ga0075428_100002983
408 Ga0075428_100024566
409 Ga0075428_100031325
410 Ga0075428_100036135
411 Ga0075428_100164218
412 Ga0075428_100370695
413 Ga0075428_100563754
414 Ga0075430_100000266
415 Ga0075430_100000973
416 Ga0075430_100004323
417 Ga0075431_100000912
418 Ga0075431_100001041
419 Ga0075431_100001043
420 Ga0075431_100001691
421 Ga0075431_100003849
422 Ga0075431_100025696
423 Ga0075431_100314547
424 Ga0075433_10000249
425 Ga0075433_10003092
426 Ga0075433_10005610
427 Ga0075433_10006952
428 Ga0075433_10012805
429 Ga0075433_10013250
430 Ga0075433_10051807
431 Ga0075433_10082096
432 Ga0075433_10332695
433 Ga0075434_100000081
434 Ga0075434_100002565
435 Ga0075434_100017930
436 Ga0075434_100021598
437 Ga0075434_100074516
438 Ga0075434_100084780
439 Ga0075434_100093761
440 Ga0075434_100140222
441 Ga0075434_100260012
442 Ga0075429_100000035
443 Ga0075429_100000882
444 Ga0075429_100001267
445 Ga0075429_100035608
446 Ga0075429_100426483
447 Ga0075436_100004919
448 Ga0075436_100026222
449 Ga0075436_100205889
450 Ga0097620_100040450
451 Ga0097620_100059221
452 Ga0075435_100001297
453 Ga0075435_100001609
454 Ga0075435_100007639
455 Ga0075435_100028050
456 Ga0075435_100030887
457 Ga0075435_100054859
458 Ga0075435_100441723
459 Ga0099794_10144397
460 Ga0111539_10001127
461 Ga0111539_10001468
462 Ga0111539_10010648
463 Ga0111539_10144506
464 Ga0111539_10325738
465 Ga0111539_10594243
466 Ga0111539_10692736
467 Ga0114129_10000003
468 Ga0114129_10000207
469 Ga0114129_10000810
470 Ga0114129_10001757
471 Ga0114129_10002705
472 Ga0114129_10031281
473 Ga0114129_10033103
474 Ga0114129_10043578
475 Ga0114129_10067629
476 Ga0114129_10110040
477 Ga0114129_10145001
478 Ga0114129_10166459
479 Ga0114129_10193626
480 Ga0114129_10344015
481 Ga0114129_10725242
482 Ga0105243_10081319
483 Ga0105243_10425723
484 Ga0105242_10020496
485 Ga0105248_10211745
486 Ga0105249_10066205
487 Ga0105249_10451714
488 Ga0157378_10257826
489 Ga0157378_10410882
490 Ga0163162_10044823
491 Ga0157372_10295719
492 Ga0207653_10019932
493 Ga0207685_10083234
494 Ga0207645_10056288
495 Ga0207684_10010067
496 Ga0207684_10025493
497 Ga0207684_10032101
498 Ga0207684_10090323
499 Ga0207707_10057158
500 Ga0207693_10028902
501 Ga0207660_10012506
502 Ga0207646_10016639
503 Ga0207646_10019616
504 Ga0207646_10020926
505 Ga0207646_10038540
506 Ga0207646_10082143
507 Ga0207646_10311145
508 Ga0207681_10026992
509 Ga0207709_10004297
510 Ga0207709_10386563
511 Ga0207691_10027248
512 Ga0207689_10049155
513 Ga0207689_10257044
514 Ga0207712_10407049
515 Ga0207668_10010048
516 Ga0207648_10106471
517 Ga0207648_10124442
518 Ga0207428_10000035
519 Ga0207428_10007460
520 Ga0268265_10049002
521 Ga0268265_10065805
522 Ga0268264_10303608
523 Ga0307408_100008450
524 Ga0307416_100071031
525 Ga0307411_10011394
526 Ga0373940_0020947
527 Ga0373932_0015584
528 Ga0373931_0119711
529 Ga0395899_0052041
530 Ga0395900_0005878
531 Ga0395898_0090228
532 Ga0395905_0316186
533 Ga0395901_0000854
534 Ga0451577_0006961
535 Ga0451577_0038762
536 Ga0453684_0052921
537 Ga0451576_0079485
538 Ga0451576_0157615
539 Ga0451576_0227073
540 Ga0451576_0347266
541 Ga0451576_0597005
542 Ga0495580_0000359
543 Ga0495642_0046598
544 Ga0495621_0057930
545 Ga0495669_0098099
546 Ga0496106_0123590
547 Ga0496106_0320725
548 Ga0496107_0096027
549 Ga0501031_0091647
550 Ga0501031_0104859
551 Ga0501038_0084578
552 Ga0501039_0027929
553 Ga0501040_0027915
554 Ga0501040_0281098
555 Ga0501040_0346024
556 Ga0501041_0035911
557 Ga0501041_0177275
558 Ga0501042_0017659
559 Ga0501042_0067739
560 Ga0501042_0259366
561 Ga0501043_0106534
562 Ga0501048_0025789
563 Ga0501048_0075440
564 Ga0501072_0028272
565 Ga0501072_0051590
566 Ga0501074_0133479
567 Ga0501074_0151960
568 Ga0501075_0049559
569 Ga0501075_0059783
570 Ga0501076_0020299
571 Ga0501076_0038479
572 Ga0501077_0002263
573 Ga0501079_0005519
574 Ga0501079_0285907
575 Ga0501080_0147997
576 Ga0501081_0000876
577 Ga0501081_0018148
578 Ga0501081_0099980
579 Ga0501083_0260242
580 Ga0501045_0031667
581 Ga0501045_0108343
582 nmdc:mga05p37_1127_c1
583 nmdc:mga05p37_13067_c1
584 nmdc:mga05p37_141506_c1
585 nmdc:mga05p37_154245_c2
586 nmdc:mga05p37_1719_c1
587 nmdc:mga05p37_1750_c1
588 nmdc:mga05p37_200918_c1
589 nmdc:mga05p37_24379_c1
590 nmdc:mga05p37_279_c1
591 nmdc:mga05p37_44823_c1
592 nmdc:mga05p37_56408_c1
593 nmdc:mga05p37_5936_c1
594 nmdc:mga09592_1206_c1
595 nmdc:mga09592_1472_c1
596 nmdc:mga09592_17179_c1
597 nmdc:mga09592_198681_c1
598 nmdc:mga09592_4637_c1
599 nmdc:mga09592_95502_c1
600 nmdc:mga09592_95994_c1
601 nmdc:mga0qj67_428878_c1
602 nmdc:mga0qj67_451236_c1
603 nmdc:mga0qj67_758_c1
604 nmdc:mga0qj67_816_c1
605 nmdc:mga06r32_11715_c1
606 nmdc:mga06r32_2270_c1
607 nmdc:mga06r32_231126_c1
608 nmdc:mga06r32_301_c1
609 nmdc:mga06r32_304994_c1
610 nmdc:mga06r32_52005_c1
611 nmdc:mga06r32_56295_c1
612 nmdc:mga06r32_60632_c1
613 nmdc:mga08y16_203354_c1
614 nmdc:mga08y16_22534_c1
615 nmdc:mga08y16_9990_c1
616 nmdc:mga0n895_26237_c1
617 nmdc:mga0n895_3598_c1
618 nmdc:mga0n895_42919_c1
619 nmdc:mga0n895_4363_c1
620 nmdc:mga0n895_4488_c1
621 nmdc:mga0n895_51996_c1
622 nmdc:mga0n895_53099_c1
623 nmdc:mga0n895_80849_c2
624 nmdc:mga0rr50_11409_c1
625 nmdc:mga0rr50_11677_c1
626 nmdc:mga0rr50_1359_c1
627 nmdc:mga0rr50_16670_c1
628 nmdc:mga0rr50_30629_c1
629 nmdc:mga0rr50_4932_c1
630 nmdc:mga0rr50_6851_c1
631 nmdc:mga0rr50_78491_c1
632 nmdc:mga08x19_20349_c1
633 nmdc:mga08x19_20398_c1
634 nmdc:mga08x19_20877_c1
635 nmdc:mga0a205_16704_c1
636 nmdc:mga0a205_1794_c1
637 nmdc:mga0a205_199578_c1
638 nmdc:mga0a205_208_c1
639 nmdc:mga0a205_435669_c1
640 nmdc:mga0a205_4573_c1
641 nmdc:mga0a205_482626_c1
642 nmdc:mga0a205_73324_c1
643 nmdc:mga0a205_93440_c1
644 nmdc:mga0a205_9419_c1
645 Ga0501084_0013433
646 Ga0501084_0077432
647 Ga0501084_0122458
648 Ga0501084_0183893
649 Ga0501082_0024640
650 Ga0501082_0214596
651 Ga0530510_0093649
652 Ga0530510_0133768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

78

182

0.94

PF13649

Methyltransf_25

Methyltransferase domain

77

178

0.91

PF08242

Methyltransf_12

Methyltransferase domain

78

180

0.9

PF02353

CMAS

Mycolic acid cyclopropane synthetase

60

206

0.87

PF13847

Methyltransf_31

Methyltransferase domain

71

199

0.8

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

55

205

0.77

PF13489

Methyltransf_23

Methyltransferase domain

51

261

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8448 61 182
3m70-assembly1.cif.gz_A crystal structure of tehb from haemophilus influenzae 0.827 61 182
1r8y-assembly1.cif.gz_C crystal structure of mouse glycine n-methyltransferase (monoclinic form) 0.8235 63 182
1r8y-assembly2.cif.gz_G crystal structure of mouse glycine n-methyltransferase (monoclinic form) 0.8213 58 182
2i6g-assembly2.cif.gz_B crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8189 61 187
ID Description Score Start End Superfamily
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8511 56 187 3.40.50.150
3m70A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8411 61 182 3.40.50.150
af_A8KBL7_49_349_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8378 72 184 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8375 71 135 3.40.50.150
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8349 75 129 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V7TSX1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9469 36 312 GO:0008757
AF-A0A2V6ZFJ4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9431 6 311 GO:0008757
AF-A0A2V7CS13-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.937 1 311 GO:0008757
GO:0032259
AF-A0A2V7TSX1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9338 36 312 GO:0008757
AF-A0A2V7CS13-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9283 1 311 GO:0008757
GO:0032259

Map