F408256

General Info

Members Datasets Scaffolds Average Seq Length
326 177 652 230

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10270946|Ga0075433_102709462
Length 251
Sequence MGCYAAHSSSLSRPCEGAHVTVETGRLSAPEVQSMFDRIAPVYDAMNRSMTVGLDRRWRRLTAEAVVRPGDRVLDACCGTGDLALACARAGAREVVGLDFAEQMLERARRKEQVTDCYLRWVRGDLLELPFEDGSFDAATVGFGVRNVEDLDRALAELRRVLRVGGRLGILEITQPRGLLAPFYRLWFDTVVPVAGKLLRGGSAYTYLPASVRRFPGPEALSNRLLLARFEGVRYRLLAGGIVALHTGAAA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 8.59
Rhizosphere 89.57
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10270946 3300006852 Unclassified 1504
2 JGI25406J46586_10018956 3300003203 Bacteria 2815
3 JGI25407J50210_10045186 3300003373 Bacteria 1123
4 Ga0070676_10106372 3300005328 Bacteria 1741
5 Ga0070683_100596689 3300005329 Bacteria 1057
6 Ga0070690_100149970 3300005330 Bacteria 1590
7 Ga0070689_100252234 3300005340 Bacteria 1456
8 Ga0070691_10228083 3300005341 Bacteria 990
9 Ga0070668_100224453 3300005347 Bacteria 1551
10 Ga0070675_100046737 3300005354 Bacteria 3546
11 Ga0070671_100075069 3300005355 Bacteria 2824
12 Ga0070674_100098175 3300005356 Bacteria 2129
13 Ga0070674_100224160 3300005356 Bacteria 1464
14 Ga0070673_100031323 3300005364 Bacteria 3990
15 Ga0070711_100023702 3300005439 Bacteria 3995
16 Ga0070705_100052183 3300005440 Bacteria 2388
17 Ga0070708_100024383 3300005445 Bacteria 5160
18 Ga0070663_100126016 3300005455 Bacteria 1940
19 Ga0070678_100009818 3300005456 Bacteria 5820
20 Ga0068867_100612777 3300005459 Bacteria 951
21 Ga0070685_10115016 3300005466 Bacteria 1663
22 Ga0070684_100439429 3300005535 Bacteria 1205
23 Ga0070686_100006320 3300005544 Bacteria 6578
24 Ga0070696_100280722 3300005546 Bacteria 1269
25 Ga0070665_100207262 3300005548 Bacteria 1961
26 Ga0070704_100005253 3300005549 Bacteria 7541
27 Ga0068856_100250299 3300005614 Bacteria 1787
28 Ga0068856_100300787 3300005614 Bacteria 1622
29 Ga0070702_100002243 3300005615 Bacteria 8256
30 Ga0070702_100158302 3300005615 Bacteria 1461
31 Ga0068866_10062666 3300005718 Bacteria 1935
32 Ga0068860_100680427 3300005843 Bacteria 1038
33 Ga0081455_10003746 3300005937 Bacteria 17377
34 Ga0081455_10006338 3300005937 Bacteria 12706
35 Ga0081455_10079013 3300005937 Bacteria 2702
36 Ga0081455_10155493 3300005937 Bacteria 1758
37 Ga0081538_10000052 3300005981 Bacteria 109642
38 Ga0081538_10000151 3300005981 Bacteria 72583
39 Ga0081538_10000429 3300005981 Bacteria 47236
40 Ga0081538_10001689 3300005981 Bacteria 22493
41 Ga0081538_10003411 3300005981 Bacteria 15033
42 Ga0081538_10070556 3300005981 Bacteria 1928
43 Ga0081538_10185050 3300005981 Bacteria 884
44 Ga0081539_10000397 3300005985 Bacteria 93458
45 Ga0081539_10001630 3300005985 Bacteria 36632
46 Ga0075364_10348550 3300006051 Unclassified 1009
47 Ga0075432_10076562 3300006058 Bacteria 1208
48 Ga0070716_100089913 3300006173 Bacteria 1856
49 Ga0070712_100000323 3300006175 Bacteria 27025
50 Ga0070712_100003967 3300006175 Bacteria 9101
51 Ga0097621_100019180 3300006237 Bacteria 5244
52 Ga0068871_100156694 3300006358 Bacteria 1945
53 Ga0075428_100004060 3300006844 Bacteria 16091
54 Ga0075428_100036340 3300006844 Bacteria 5425
55 Ga0075430_100082115 3300006846 Bacteria 2700
56 Ga0075430_100156746 3300006846 Bacteria 1895
57 Ga0075430_100174139 3300006846 Bacteria 1790
58 Ga0075431_100039934 3300006847 Bacteria 4834
59 Ga0075429_100036771 3300006880 Bacteria 4260
60 Ga0075429_100548244 3300006880 Bacteria 1013
61 Ga0068865_100046436 3300006881 Bacteria 2980
62 Ga0105245_10005617 3300009098 Bacteria 11016
63 Ga0105247_10029668 3300009101 Bacteria 3316
64 Ga0105247_10038826 3300009101 Bacteria 2908
65 Ga0114129_10048123 3300009147 Bacteria 5992
66 Ga0114129_10303153 3300009147 Bacteria 2128
67 Ga0114129_10567323 3300009147 Bacteria 1474
68 Ga0114129_11188766 3300009147 Unclassified 950
69 Ga0105243_10146183 3300009148 Bacteria 2022
70 Ga0105243_10293169 3300009148 Bacteria 1471
71 Ga0105242_10030828 3300009176 Bacteria 4284
72 Ga0105248_10053950 3300009177 Bacteria 4509
73 Ga0105249_10114865 3300009553 Bacteria 2549
74 Ga0157378_10051856 3300013297 Bacteria 3650
75 Ga0157378_10091690 3300013297 Bacteria 2763
76 Ga0163162_10553031 3300013306 Bacteria 1279
77 Ga0157375_10129273 3300013308 Bacteria 2644
78 Ga0157375_10146555 3300013308 Bacteria 2492
79 Ga0157380_10972203 3300014326 Bacteria 880
80 Ga0182008_10053047 3300014497 Bacteria 2008
81 Ga0157379_10033838 3300014968 Bacteria 4558
82 Ga0157376_10029001 3300014969 Bacteria 4406
83 Ga0157376_10445228 3300014969 Bacteria 1262
84 Ga0213875_10144195 3300021388 Unclassified 1115
85 Ga0207710_10059943 3300025900 Bacteria 1723
86 Ga0207643_10139092 3300025908 Bacteria 1449
87 Ga0207684_10234526 3300025910 Archaea 1583
88 Ga0207693_10000871 3300025915 Bacteria 26983
89 Ga0207693_10002071 3300025915 Bacteria 17531
90 Ga0207663_10013387 3300025916 Bacteria 4458
91 Ga0207659_10032926 3300025926 Bacteria 3562
92 Ga0207659_10058743 3300025926 Bacteria 2762
93 Ga0207687_10007909 3300025927 Bacteria 6966
94 Ga0207687_10397960 3300025927 Bacteria 1132
95 Ga0207664_10729673 3300025929 Bacteria 891
96 Ga0207644_10092831 3300025931 Bacteria 2253
97 Ga0207686_10049883 3300025934 Bacteria 2600
98 Ga0207686_10052803 3300025934 Bacteria 2538
99 Ga0207709_10330008 3300025935 Bacteria 1145
100 Ga0207709_10382288 3300025935 Bacteria 1072
101 Ga0207670_10210451 3300025936 Bacteria 1483
102 Ga0207669_10109889 3300025937 Bacteria 1845
103 Ga0207704_10193700 3300025938 Bacteria 1481
104 Ga0207665_10111064 3300025939 Bacteria 1926
105 Ga0207691_10106944 3300025940 Bacteria 2491
106 Ga0207661_10341262 3300025944 Bacteria 1350
107 Ga0207640_10472005 3300025981 Bacteria 1039
108 Ga0207658_10241763 3300025986 Bacteria 1530
109 Ga0207703_10086358 3300026035 Bacteria 2628
110 Ga0207703_10124069 3300026035 Bacteria 2221
111 Ga0207678_10076069 3300026067 Bacteria 2875
112 Ga0207708_10257113 3300026075 Bacteria 1409
113 Ga0207648_10516222 3300026089 Bacteria 1094
114 Ga0207676_10849462 3300026095 Bacteria 893
115 Ga0207683_10000079 3300026121 Bacteria 76688
116 Ga0268266_10404213 3300028379 Bacteria 1292
117 Ga0265319_1117361 3300028563 Bacteria 830
118 Ga0265338_10066909 3300028800 Bacteria 3107
119 Ga0265320_10080919 3300031240 Bacteria 1516
120 Ga0307416_100085187 3300032002 Bacteria 2689
121 Ga0373929_0036527 3300035085 Bacteria 1074
122 Ga0373947_0143047 3300035725 Bacteria 1536
123 Ga0395899_0020579 3300037312 Bacteria 5001
124 Ga0395899_0054834 3300037312 Bacteria 2949
125 Ga0395900_0030484 3300037418 Bacteria 5539
126 Ga0395900_0037958 3300037418 Bacteria 4966
127 Ga0395900_0046567 3300037418 Bacteria 4466
128 Ga0395900_0093244 3300037418 Bacteria 3093
129 Ga0395898_0002611 3300037466 Bacteria 21002
130 Ga0395898_0042059 3300037466 Bacteria 4510
131 Ga0395905_0031865 3300037471 Bacteria 4960
132 Ga0395905_0057662 3300037471 Bacteria 3633
133 Ga0395905_0729144 3300037471 Bacteria 893
134 Ga0395901_0032615 3300038443 Bacteria 5372
135 Ga0395901_0203516 3300038443 Bacteria 2074
136 Ga0395901_0322170 3300038443 Unclassified 1599
137 Ga0395901_0574632 3300038443 Unclassified 1139
138 Ga0452271_02580 3300041916 Eukaryota 845
139 Ga0466963_0029462 3300044694 Bacteria 3534
140 Ga0466963_0066557 3300044694 Bacteria 2417
141 Ga0466957_0084367 3300044842 Bacteria 1983
142 Ga0466967_0007581 3300045976 Bacteria 7845
143 Ga0466967_0134649 3300045976 Bacteria 2297
144 Ga0466967_0418014 3300045976 Bacteria 1306
145 Ga0466967_0734934 3300045976 Bacteria 978
146 Ga0495603_0011655 3300046455 Bacteria 5321
147 Ga0495603_0022329 3300046455 Bacteria 3833
148 Ga0495629_0171967 3300046459 Bacteria 1503
149 Ga0495629_0448625 3300046459 Bacteria 873
150 Ga0495641_0095956 3300046461 Bacteria 1323
151 Ga0495582_0014026 3300046473 Bacteria 4413
152 Ga0495618_0117141 3300046514 Bacteria 1706
153 Ga0495598_0043440 3300046537 Bacteria 1324
154 Ga0495645_0057815 3300046543 Bacteria 2814
155 Ga0495656_0051518 3300046615 Bacteria 1762
156 Ga0495656_0307816 3300046615 Bacteria 813
157 Ga0495656_0364659 3300046615 Unclassified 751
158 Ga0495634_0000187 3300046642 Bacteria 57203
159 Ga0495634_0034334 3300046642 Bacteria 3482
160 Ga0495635_0212586 3300046663 Bacteria 1309
161 Ga0495657_0350743 3300046675 Bacteria 873
162 Ga0495613_0334041 3300046689 Bacteria 1044
163 Ga0495624_0157624 3300046690 Bacteria 1387
164 Ga0495589_0140611 3300046794 Bacteria 1156
165 Ga0495581_0256360 3300047315 Bacteria 1023
166 Ga0495604_0127174 3300047317 Bacteria 1836
167 Ga0495680_0009780 3300047322 Bacteria 8600
168 Ga0496101_0020700 3300048904 Bacteria 4510
169 Ga0496101_0023439 3300048904 Bacteria 4264
170 Ga0496102_0004436 3300048905 Bacteria 11850
171 Ga0496103_0008154 3300048906 Bacteria 6219
172 Ga0496103_0135749 3300048906 Bacteria 1572
173 Ga0496104_0023222 3300048907 Bacteria 5702
174 Ga0496104_0254011 3300048907 Bacteria 1671
175 Ga0496105_0017248 3300048908 Bacteria 5783
176 Ga0496106_0005117 3300048909 Bacteria 9713
177 Ga0496106_0019334 3300048909 Bacteria 5050
178 Ga0496107_0005231 3300048910 Bacteria 8860
179 Ga0496107_0086485 3300048910 Bacteria 2288
180 Ga0496108_0029103 3300048911 Bacteria 4572
181 Ga0496108_0084738 3300048911 Bacteria 2690
182 Ga0496108_0133073 3300048911 Bacteria 2138
183 Ga0496109_0052036 3300048912 Bacteria 3732
184 Ga0496109_0477485 3300048912 Unclassified 1177
185 Ga0496110_0003088 3300048913 Bacteria 12630
186 Ga0496110_0116576 3300048913 Bacteria 2404
187 Ga0496110_0832667 3300048913 Bacteria 828
188 Ga0496111_0059397 3300048914 Bacteria 2770
189 Ga0496111_0229911 3300048914 Bacteria 1378
190 Ga0496112_0068735 3300048915 Bacteria 3498
191 Ga0496112_0284303 3300048915 Bacteria 1601
192 Ga0496112_0598704 3300048915 Bacteria 1034
193 Ga0496113_0357312 3300048916 Bacteria 1172
194 Ga0496114_0007417 3300048917 Bacteria 8668
195 Ga0496115_0006044 3300048918 Bacteria 8839
196 Ga0496126_0199969 3300048929 Bacteria 1688
197 Ga0501031_0000184 3300049568 Bacteria 35190
198 Ga0501031_0018632 3300049568 Bacteria 4520
199 Ga0501032_0000609 3300049569 Bacteria 28961
200 Ga0501033_0000196 3300049570 Bacteria 57814
201 Ga0501033_0020961 3300049570 Bacteria 4935
202 Ga0501033_0172473 3300049570 Bacteria 1553
203 Ga0501033_0383670 3300049570 Unclassified 981
204 Ga0501034_0004633 3300049571 Bacteria 15230
205 Ga0501036_0000907 3300049572 Bacteria 22187
206 Ga0501036_0052432 3300049572 Bacteria 3454
207 Ga0501036_0058159 3300049572 Bacteria 3275
208 Ga0501037_0003828 3300049573 Bacteria 10918
209 Ga0501037_0027194 3300049573 Bacteria 4225
210 Ga0501038_0002399 3300049574 Bacteria 17460
211 Ga0501038_0016333 3300049574 Bacteria 6729
212 Ga0501038_0025715 3300049574 Bacteria 5244
213 Ga0501038_0376615 3300049574 Bacteria 1102
214 Ga0501039_0004602 3300049575 Bacteria 10432
215 Ga0501039_0014209 3300049575 Bacteria 6095
216 Ga0501039_0137132 3300049575 Bacteria 1921
217 Ga0501040_0002195 3300049576 Bacteria 12567
218 Ga0501040_0002433 3300049576 Bacteria 11983
219 Ga0501040_0069666 3300049576 Bacteria 2426
220 Ga0501041_0000184 3300049577 Bacteria 28387
221 Ga0501041_0002423 3300049577 Bacteria 10577
222 Ga0501041_0145342 3300049577 Bacteria 1479
223 Ga0501041_0442998 3300049577 Bacteria 824
224 Ga0501042_0002278 3300049578 Bacteria 11716
225 Ga0501042_0013556 3300049578 Bacteria 5548
226 Ga0501042_0036273 3300049578 Bacteria 3497
227 Ga0501042_0107139 3300049578 Bacteria 2012
228 Ga0501043_0000092 3300049579 Bacteria 80825
229 Ga0501043_0018848 3300049579 Bacteria 5416
230 Ga0501046_0004080 3300049580 Bacteria 13316
231 Ga0501046_0046259 3300049580 Bacteria 3454
232 Ga0501047_0003252 3300049581 Bacteria 15413
233 Ga0501047_0006464 3300049581 Bacteria 11026
234 Ga0501048_0001148 3300049582 Bacteria 19885
235 Ga0501048_0014901 3300049582 Bacteria 5749
236 Ga0501048_0043097 3300049582 Bacteria 3230
237 Ga0501048_0066306 3300049582 Bacteria 2552
238 Ga0501048_0555823 3300049582 Unclassified 823
239 Ga0501067_0186278 3300049583 Bacteria 1156
240 Ga0501068_0000009 3300049584 Bacteria 67122
241 Ga0501069_0024931 3300049585 Bacteria 3265
242 Ga0501069_0113941 3300049585 Bacteria 1541
243 Ga0501070_0023229 3300049586 Bacteria 5194
244 Ga0501070_0058696 3300049586 Bacteria 3189
245 Ga0501070_0318591 3300049586 Bacteria 1265
246 Ga0501070_0522870 3300049586 Bacteria 952
247 Ga0501071_0000712 3300049587 Bacteria 17456
248 Ga0501071_0017060 3300049587 Bacteria 5002
249 Ga0501071_0046143 3300049587 Bacteria 3129
250 Ga0501071_0229664 3300049587 Unclassified 1398
251 Ga0501071_0503206 3300049587 Bacteria 929
252 Ga0501071_0700578 3300049587 Bacteria 780
253 Ga0501071_0768397 3300049587 Unclassified 742
254 Ga0501072_0001048 3300049588 Bacteria 20472
255 Ga0501072_0007771 3300049588 Bacteria 8143
256 Ga0501072_0028370 3300049588 Bacteria 4370
257 Ga0501072_0099326 3300049588 Bacteria 2314
258 Ga0501072_0397401 3300049588 Bacteria 1093
259 Ga0501073_0001656 3300049589 Bacteria 16515
260 Ga0501073_0024710 3300049589 Bacteria 4313
261 Ga0501074_0000215 3300049590 Bacteria 31741
262 Ga0501074_0002506 3300049590 Bacteria 12796
263 Ga0501074_0114051 3300049590 Bacteria 1933
264 Ga0501074_0225817 3300049590 Bacteria 1333
265 Ga0501074_0615639 3300049590 Bacteria 768
266 Ga0501075_0000006 3300049591 Bacteria 111683
267 Ga0501075_0014069 3300049591 Bacteria 5729
268 Ga0501075_0047616 3300049591 Bacteria 3221
269 Ga0501075_0110264 3300049591 Bacteria 2092
270 Ga0501076_0000083 3300049592 Bacteria 49438
271 Ga0501076_0022653 3300049592 Bacteria 4829
272 Ga0501076_0052759 3300049592 Bacteria 3221
273 Ga0501076_0080698 3300049592 Bacteria 2611
274 Ga0501076_0097348 3300049592 Bacteria 2370
275 Ga0501077_0000048 3300049593 Bacteria 61935
276 Ga0501077_0010384 3300049593 Bacteria 5792
277 Ga0501077_0212536 3300049593 Bacteria 1229
278 Ga0501079_0000902 3300049741 Bacteria 20349
279 Ga0501079_0001040 3300049741 Bacteria 19219
280 Ga0501079_0005736 3300049741 Bacteria 9278
281 Ga0501079_0041720 3300049741 Bacteria 3543
282 Ga0501079_0118257 3300049741 Bacteria 2060
283 Ga0501080_0000026 3300049742 Bacteria 89548
284 Ga0501080_0122683 3300049742 Bacteria 2407
285 Ga0501081_0000069 3300049743 Bacteria 39558
286 Ga0501081_0142759 3300049743 Bacteria 1716
287 Ga0501081_0398731 3300049743 Bacteria 1018
288 Ga0501083_0000136 3300049744 Bacteria 49859
289 Ga0501083_0059303 3300049744 Bacteria 2560
290 Ga0501035_0000499 3300049822 Bacteria 44174
291 Ga0501035_0005126 3300049822 Bacteria 12401
292 Ga0501035_0099594 3300049822 Bacteria 2551
293 Ga0501044_0006519 3300049823 Bacteria 12891
294 Ga0501044_0067718 3300049823 Bacteria 3637
295 Ga0501045_0000110 3300049824 Bacteria 41325
296 Ga0501045_0002438 3300049824 Bacteria 12646
297 Ga0501045_0020333 3300049824 Bacteria 4742
298 nmdc:mga00v17_306080_c1 3300050491 Unclassified 1032
299 nmdc:mga0yw44_131988_c1 3300050492 Unclassified 1618
300 nmdc:mga05p37_139696_c1 3300050507 Bacteria 2968
301 nmdc:mga05p37_5744_c1 3300050507 Bacteria 14596
302 nmdc:mga05p37_849185_c1 3300050507 Unclassified 992
303 nmdc:mga09592_44691_c1 3300050508 Bacteria 3730
304 nmdc:mga09592_754672_c1 3300050508 Bacteria 825
305 nmdc:mga0qj67_32858_c1 3300050509 Bacteria 4047
306 nmdc:mga0qj67_87269_c1 3300050509 Bacteria 2504
307 nmdc:mga06r32_141786_c1 3300050510 Bacteria 2380
308 nmdc:mga0a205_38325_c1 3300050515 Bacteria 4610
309 Ga0495601_0246064 3300053077 Bacteria 1168
310 Ga0501084_0000105 3300054114 Bacteria 62464
311 Ga0501084_0002078 3300054114 Bacteria 15981
312 Ga0501084_0055828 3300054114 Bacteria 3304
313 Ga0501084_0099292 3300054114 Bacteria 2444
314 Ga0501084_0160352 3300054114 Bacteria 1897
315 Ga0501084_0397281 3300054114 Bacteria 1165
316 Ga0590077_037299 3300059426 Unclassified 1074
317 Ga0501082_0000645 3300060353 Bacteria 30754
318 Ga0501082_0002754 3300060353 Bacteria 15358
319 Ga0501082_0088741 3300060353 Bacteria 2668
320 Ga0501082_0094042 3300060353 Bacteria 2590
321 Ga0501082_0110070 3300060353 Bacteria 2384
322 Ga0530510_0000145 3300061734 Bacteria 41886
323 Ga0530510_0001636 3300061734 Bacteria 15137
324 Ga0530510_0009475 3300061734 Bacteria 6828
325 Ga0530510_0051617 3300061734 Bacteria 2972
326 Ga0530510_0129548 3300061734 Bacteria 1855
327 Ga0075433_10270946
328 JGI25406J46586_10018956
329 JGI25407J50210_10045186
330 Ga0070676_10106372
331 Ga0070683_100596689
332 Ga0070690_100149970
333 Ga0070689_100252234
334 Ga0070691_10228083
335 Ga0070668_100224453
336 Ga0070675_100046737
337 Ga0070671_100075069
338 Ga0070674_100098175
339 Ga0070674_100224160
340 Ga0070673_100031323
341 Ga0070711_100023702
342 Ga0070705_100052183
343 Ga0070708_100024383
344 Ga0070663_100126016
345 Ga0070678_100009818
346 Ga0068867_100612777
347 Ga0070685_10115016
348 Ga0070684_100439429
349 Ga0070686_100006320
350 Ga0070696_100280722
351 Ga0070665_100207262
352 Ga0070704_100005253
353 Ga0068856_100250299
354 Ga0068856_100300787
355 Ga0070702_100002243
356 Ga0070702_100158302
357 Ga0068866_10062666
358 Ga0068860_100680427
359 Ga0081455_10003746
360 Ga0081455_10006338
361 Ga0081455_10079013
362 Ga0081455_10155493
363 Ga0081538_10000052
364 Ga0081538_10000151
365 Ga0081538_10000429
366 Ga0081538_10001689
367 Ga0081538_10003411
368 Ga0081538_10070556
369 Ga0081538_10185050
370 Ga0081539_10000397
371 Ga0081539_10001630
372 Ga0075364_10348550
373 Ga0075432_10076562
374 Ga0070716_100089913
375 Ga0070712_100000323
376 Ga0070712_100003967
377 Ga0097621_100019180
378 Ga0068871_100156694
379 Ga0075428_100004060
380 Ga0075428_100036340
381 Ga0075430_100082115
382 Ga0075430_100156746
383 Ga0075430_100174139
384 Ga0075431_100039934
385 Ga0075429_100036771
386 Ga0075429_100548244
387 Ga0068865_100046436
388 Ga0105245_10005617
389 Ga0105247_10029668
390 Ga0105247_10038826
391 Ga0114129_10048123
392 Ga0114129_10303153
393 Ga0114129_10567323
394 Ga0114129_11188766
395 Ga0105243_10146183
396 Ga0105243_10293169
397 Ga0105242_10030828
398 Ga0105248_10053950
399 Ga0105249_10114865
400 Ga0157378_10051856
401 Ga0157378_10091690
402 Ga0163162_10553031
403 Ga0157375_10129273
404 Ga0157375_10146555
405 Ga0157380_10972203
406 Ga0182008_10053047
407 Ga0157379_10033838
408 Ga0157376_10029001
409 Ga0157376_10445228
410 Ga0213875_10144195
411 Ga0207710_10059943
412 Ga0207643_10139092
413 Ga0207684_10234526
414 Ga0207693_10000871
415 Ga0207693_10002071
416 Ga0207663_10013387
417 Ga0207659_10032926
418 Ga0207659_10058743
419 Ga0207687_10007909
420 Ga0207687_10397960
421 Ga0207664_10729673
422 Ga0207644_10092831
423 Ga0207686_10049883
424 Ga0207686_10052803
425 Ga0207709_10330008
426 Ga0207709_10382288
427 Ga0207670_10210451
428 Ga0207669_10109889
429 Ga0207704_10193700
430 Ga0207665_10111064
431 Ga0207691_10106944
432 Ga0207661_10341262
433 Ga0207640_10472005
434 Ga0207658_10241763
435 Ga0207703_10086358
436 Ga0207703_10124069
437 Ga0207678_10076069
438 Ga0207708_10257113
439 Ga0207648_10516222
440 Ga0207676_10849462
441 Ga0207683_10000079
442 Ga0268266_10404213
443 Ga0265319_1117361
444 Ga0265338_10066909
445 Ga0265320_10080919
446 Ga0307416_100085187
447 Ga0373929_0036527
448 Ga0373947_0143047
449 Ga0395899_0020579
450 Ga0395899_0054834
451 Ga0395900_0030484
452 Ga0395900_0037958
453 Ga0395900_0046567
454 Ga0395900_0093244
455 Ga0395898_0002611
456 Ga0395898_0042059
457 Ga0395905_0031865
458 Ga0395905_0057662
459 Ga0395905_0729144
460 Ga0395901_0032615
461 Ga0395901_0203516
462 Ga0395901_0322170
463 Ga0395901_0574632
464 Ga0452271_02580
465 Ga0466963_0029462
466 Ga0466963_0066557
467 Ga0466957_0084367
468 Ga0466967_0007581
469 Ga0466967_0134649
470 Ga0466967_0418014
471 Ga0466967_0734934
472 Ga0495603_0011655
473 Ga0495603_0022329
474 Ga0495629_0171967
475 Ga0495629_0448625
476 Ga0495641_0095956
477 Ga0495582_0014026
478 Ga0495618_0117141
479 Ga0495598_0043440
480 Ga0495645_0057815
481 Ga0495656_0051518
482 Ga0495656_0307816
483 Ga0495656_0364659
484 Ga0495634_0000187
485 Ga0495634_0034334
486 Ga0495635_0212586
487 Ga0495657_0350743
488 Ga0495613_0334041
489 Ga0495624_0157624
490 Ga0495589_0140611
491 Ga0495581_0256360
492 Ga0495604_0127174
493 Ga0495680_0009780
494 Ga0496101_0020700
495 Ga0496101_0023439
496 Ga0496102_0004436
497 Ga0496103_0008154
498 Ga0496103_0135749
499 Ga0496104_0023222
500 Ga0496104_0254011
501 Ga0496105_0017248
502 Ga0496106_0005117
503 Ga0496106_0019334
504 Ga0496107_0005231
505 Ga0496107_0086485
506 Ga0496108_0029103
507 Ga0496108_0084738
508 Ga0496108_0133073
509 Ga0496109_0052036
510 Ga0496109_0477485
511 Ga0496110_0003088
512 Ga0496110_0116576
513 Ga0496110_0832667
514 Ga0496111_0059397
515 Ga0496111_0229911
516 Ga0496112_0068735
517 Ga0496112_0284303
518 Ga0496112_0598704
519 Ga0496113_0357312
520 Ga0496114_0007417
521 Ga0496115_0006044
522 Ga0496126_0199969
523 Ga0501031_0000184
524 Ga0501031_0018632
525 Ga0501032_0000609
526 Ga0501033_0000196
527 Ga0501033_0020961
528 Ga0501033_0172473
529 Ga0501033_0383670
530 Ga0501034_0004633
531 Ga0501036_0000907
532 Ga0501036_0052432
533 Ga0501036_0058159
534 Ga0501037_0003828
535 Ga0501037_0027194
536 Ga0501038_0002399
537 Ga0501038_0016333
538 Ga0501038_0025715
539 Ga0501038_0376615
540 Ga0501039_0004602
541 Ga0501039_0014209
542 Ga0501039_0137132
543 Ga0501040_0002195
544 Ga0501040_0002433
545 Ga0501040_0069666
546 Ga0501041_0000184
547 Ga0501041_0002423
548 Ga0501041_0145342
549 Ga0501041_0442998
550 Ga0501042_0002278
551 Ga0501042_0013556
552 Ga0501042_0036273
553 Ga0501042_0107139
554 Ga0501043_0000092
555 Ga0501043_0018848
556 Ga0501046_0004080
557 Ga0501046_0046259
558 Ga0501047_0003252
559 Ga0501047_0006464
560 Ga0501048_0001148
561 Ga0501048_0014901
562 Ga0501048_0043097
563 Ga0501048_0066306
564 Ga0501048_0555823
565 Ga0501067_0186278
566 Ga0501068_0000009
567 Ga0501069_0024931
568 Ga0501069_0113941
569 Ga0501070_0023229
570 Ga0501070_0058696
571 Ga0501070_0318591
572 Ga0501070_0522870
573 Ga0501071_0000712
574 Ga0501071_0017060
575 Ga0501071_0046143
576 Ga0501071_0229664
577 Ga0501071_0503206
578 Ga0501071_0700578
579 Ga0501071_0768397
580 Ga0501072_0001048
581 Ga0501072_0007771
582 Ga0501072_0028370
583 Ga0501072_0099326
584 Ga0501072_0397401
585 Ga0501073_0001656
586 Ga0501073_0024710
587 Ga0501074_0000215
588 Ga0501074_0002506
589 Ga0501074_0114051
590 Ga0501074_0225817
591 Ga0501074_0615639
592 Ga0501075_0000006
593 Ga0501075_0014069
594 Ga0501075_0047616
595 Ga0501075_0110264
596 Ga0501076_0000083
597 Ga0501076_0022653
598 Ga0501076_0052759
599 Ga0501076_0080698
600 Ga0501076_0097348
601 Ga0501077_0000048
602 Ga0501077_0010384
603 Ga0501077_0212536
604 Ga0501079_0000902
605 Ga0501079_0001040
606 Ga0501079_0005736
607 Ga0501079_0041720
608 Ga0501079_0118257
609 Ga0501080_0000026
610 Ga0501080_0122683
611 Ga0501081_0000069
612 Ga0501081_0142759
613 Ga0501081_0398731
614 Ga0501083_0000136
615 Ga0501083_0059303
616 Ga0501035_0000499
617 Ga0501035_0005126
618 Ga0501035_0099594
619 Ga0501044_0006519
620 Ga0501044_0067718
621 Ga0501045_0000110
622 Ga0501045_0002438
623 Ga0501045_0020333
624 nmdc:mga00v17_306080_c1
625 nmdc:mga0yw44_131988_c1
626 nmdc:mga05p37_139696_c1
627 nmdc:mga05p37_5744_c1
628 nmdc:mga05p37_849185_c1
629 nmdc:mga09592_44691_c1
630 nmdc:mga09592_754672_c1
631 nmdc:mga0qj67_32858_c1
632 nmdc:mga0qj67_87269_c1
633 nmdc:mga06r32_141786_c1
634 nmdc:mga0a205_38325_c1
635 Ga0495601_0246064
636 Ga0501084_0000105
637 Ga0501084_0002078
638 Ga0501084_0055828
639 Ga0501084_0099292
640 Ga0501084_0160352
641 Ga0501084_0397281
642 Ga0590077_037299
643 Ga0501082_0000645
644 Ga0501082_0002754
645 Ga0501082_0088741
646 Ga0501082_0094042
647 Ga0501082_0110070
648 Ga0530510_0000145
649 Ga0530510_0001636
650 Ga0530510_0009475
651 Ga0530510_0051617
652 Ga0530510_0129548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

74

170

0.97

PF13649

Methyltransf_25

Methyltransferase domain

73

166

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

24

250

0.93

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

61

129

0.9

PF13847

Methyltransf_31

Methyltransferase domain

67

191

0.89

PF13489

Methyltransf_23

Methyltransferase domain

48

225

0.86

PF08242

Methyltransf_12

Methyltransferase domain

74

168

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9185 18 225
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8486 18 225
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8438 46 89
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8212 13 148
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8175 46 212
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9578 18 225 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9545 19 225 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9541 46 225 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9519 18 225 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9517 18 225 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V5FHF0-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9707 15 224 GO:0009234
GO:0032259
GO:0043770
AF-A0A7C2JA05-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9691 15 225 GO:0009234
GO:0032259
GO:0043770
AF-A0A7X1TTZ2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9685 9 223 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A091FE67-F1-model_v4 Demethylmenaquinone methyltransferase 0.9667 51 225 GO:0008168
GO:0032259
AF-A0A6L8HGE4-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9636 9 224 GO:0009234
GO:0032259
GO:0043770

Map