F408182

General Info

Members Datasets Scaffolds Average Seq Length
326 239 652 193

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100007205|Ga0070700_1000072052
Length 227
Sequence MPSYGRTSSGQCDEFAVGFWSEFFDTRRTAREEGIVTATYTFDVFSSLDGFGAAGGDWTGYWGKQGPELLDHRLAQYGEEQRMVFGANTFRAFVRMLASSSDESEVRDPWVTRMTSLPATVVSTTLEGPLDWPDANCVSGDAVDVVARLKAESEVPLRSHGSLSMNRALMAAGLVDRVQVTLFPVITGQTGLDPIFQDAADFDLELLERRTLDDHIQELIYRPALHA

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
171 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
172 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
173 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
223 2643221546 Microbacterium sp. Root53 Isolate Unclassified
224 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
225 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
226 2808606394 Promicromonospora sp. C35 Isolate Unclassified
227 2808606448 Streptomyces sp. 193411 Isolate Unclassified
228 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
229 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
230 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
231 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
232 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
233 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
234 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
235 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
236 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
237 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
238 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
239 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 1.84
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0.61
Rhizoplane 8.59
Rhizosphere 80.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100007205 3300005441 Bacteria 5990
2 ARcpr5yngRDRAFT_c009144 3300000043 Bacteria 850
3 JGI24743J22301_10063396 3300001991 Bacteria 764
4 JGI24748J21848_1018670 3300002074 Bacteria 832
5 JGI24033J26618_1020985 3300002155 Bacteria 837
6 JGI24742J22300_10048064 3300002244 Bacteria 769
7 rootL2_10109803 3300003322 Bacteria 1718
8 Ga0006562J51391_1064869 3300003578 Bacteria 4397
9 Ga0006562J51391_1064870 3300003578 Bacteria 6160
10 Ga0006562J51391_1080491 3300003578 Bacteria 2060
11 Ga0006562J51391_1080493 3300003578 Bacteria 1410
12 Ga0070658_10046948 3300005327 Bacteria 3495
13 Ga0070658_10081853 3300005327 Bacteria 2652
14 Ga0070676_10181036 3300005328 Bacteria 1370
15 Ga0070683_100110465 3300005329 Bacteria 2593
16 Ga0070683_100409855 3300005329 Bacteria 1293
17 Ga0070670_100015204 3300005331 Bacteria 6605
18 Ga0068869_100753935 3300005334 Bacteria 834
19 Ga0070680_100068847 3300005336 Bacteria 2905
20 Ga0068868_100142999 3300005338 Bacteria 1965
21 Ga0070660_100003518 3300005339 Bacteria 10795
22 Ga0070660_100028577 3300005339 Bacteria 4174
23 Ga0070660_100090934 3300005339 Bacteria 2407
24 Ga0070689_100029316 3300005340 Bacteria 4164
25 Ga0070661_100029143 3300005344 Bacteria 3983
26 Ga0070661_100298791 3300005344 Bacteria 1253
27 Ga0070692_10004841 3300005345 Bacteria 5664
28 Ga0070668_100209711 3300005347 Bacteria 1602
29 Ga0070668_100248181 3300005347 Bacteria 1477
30 Ga0070669_100122485 3300005353 Bacteria 1986
31 Ga0070675_100088639 3300005354 Bacteria 2589
32 Ga0070671_100143523 3300005355 Bacteria 2015
33 Ga0070674_100009343 3300005356 Bacteria 5870
34 Ga0070674_100811041 3300005356 Bacteria 809
35 Ga0070688_100017777 3300005365 Bacteria 4087
36 Ga0070659_100025350 3300005366 Bacteria 4553
37 Ga0070714_100480179 3300005435 Bacteria 1183
38 Ga0070714_100721844 3300005435 Bacteria 962
39 Ga0070710_10408739 3300005437 Bacteria 911
40 Ga0070701_10002878 3300005438 Bacteria 6714
41 Ga0070705_100069180 3300005440 Bacteria 2127
42 Ga0070663_100101164 3300005455 Bacteria 2150
43 Ga0070678_100984386 3300005456 Bacteria 774
44 Ga0070662_100022890 3300005457 Bacteria 4285
45 Ga0070685_10006509 3300005466 Bacteria 5956
46 Ga0070707_100539496 3300005468 Bacteria 1128
47 Ga0070698_100038820 3300005471 Bacteria 4906
48 Ga0070679_100037283 3300005530 Bacteria 4828
49 Ga0070679_100086797 3300005530 Bacteria 3115
50 Ga0070679_100723765 3300005530 Bacteria 938
51 Ga0070684_100010667 3300005535 Bacteria 7287
52 Ga0068853_100042624 3300005539 Bacteria 3881
53 Ga0068853_100839464 3300005539 Bacteria 881
54 Ga0070672_100010440 3300005543 Bacteria 6444
55 Ga0070696_100060687 3300005546 Bacteria 2644
56 Ga0070693_100490220 3300005547 Bacteria 870
57 Ga0070665_100015536 3300005548 Bacteria 7648
58 Ga0070665_100087794 3300005548 Bacteria 3115
59 Ga0070704_100200150 3300005549 Bacteria 1612
60 Ga0068855_100003166 3300005563 Bacteria 20145
61 Ga0068855_100141491 3300005563 Bacteria 2742
62 Ga0070664_100116745 3300005564 Bacteria 2334
63 Ga0070664_100117658 3300005564 Bacteria 2324
64 Ga0070664_100125397 3300005564 Bacteria 2252
65 Ga0068857_100392185 3300005577 Bacteria 1291
66 Ga0068854_100018157 3300005578 Bacteria 4718
67 Ga0070702_100006136 3300005615 Bacteria 5665
68 Ga0068852_100011803 3300005616 Bacteria 6598
69 Ga0068859_100096806 3300005617 Bacteria 3003
70 Ga0068864_100134550 3300005618 Bacteria 2224
71 Ga0068866_10066713 3300005718 Bacteria 1887
72 Ga0068861_100062428 3300005719 Bacteria 2862
73 Ga0068861_100235601 3300005719 Bacteria 1554
74 Ga0068851_10045712 3300005834 Bacteria 2213
75 Ga0068870_10003693 3300005840 Bacteria 6507
76 Ga0068863_100077473 3300005841 Bacteria 3146
77 Ga0068863_100086398 3300005841 Bacteria 2972
78 Ga0068858_100014745 3300005842 Bacteria 7354
79 Ga0068858_100109081 3300005842 Bacteria 2584
80 Ga0068860_100002073 3300005843 Bacteria 21136
81 Ga0068860_100043104 3300005843 Bacteria 4306
82 Ga0068860_100586138 3300005843 Bacteria 1120
83 Ga0068862_100449114 3300005844 Bacteria 1215
84 Ga0081455_10006337 3300005937 Bacteria 12706
85 Ga0081539_10001890 3300005985 Bacteria 32490
86 Ga0081539_10139958 3300005985 Bacteria 1177
87 Ga0075365_10018031 3300006038 Bacteria 4332
88 Ga0075363_100005432 3300006048 Bacteria 5667
89 Ga0075364_10371345 3300006051 Bacteria 975
90 Ga0070712_100046218 3300006175 Bacteria 3009
91 Ga0097621_100359560 3300006237 Bacteria 1296
92 Ga0068871_100086437 3300006358 Bacteria 2605
93 Ga0068865_100000040 3300006881 Bacteria 72979
94 Ga0068865_100038034 3300006881 Bacteria 3254
95 Ga0097620_100096806 3300006931 Bacteria 3003
96 Ga0111539_10280930 3300009094 Bacteria 1937
97 Ga0105245_10015869 3300009098 Bacteria 6563
98 Ga0105247_10011767 3300009101 Bacteria 5261
99 Ga0105243_10012958 3300009148 Bacteria 6300
100 Ga0105241_10000495 3300009174 Bacteria 29802
101 Ga0105242_10147753 3300009176 Bacteria 2046
102 Ga0105248_10025503 3300009177 Bacteria 6573
103 Ga0105238_10155841 3300009551 Bacteria 2259
104 Ga0105238_10890804 3300009551 Bacteria 908
105 Ga0105249_10206508 3300009553 Bacteria 1925
106 Ga0105239_10014494 3300010375 Bacteria 8746
107 Ga0105239_10108123 3300010375 Bacteria 3081
108 Ga0105246_10058221 3300011119 Bacteria 2676
109 Ga0157369_10011863 3300013105 Bacteria 9896
110 Ga0157369_10825561 3300013105 Bacteria 952
111 Ga0157374_10046752 3300013296 Bacteria 4010
112 Ga0157374_10478215 3300013296 Bacteria 1249
113 Ga0157378_10229472 3300013297 Bacteria 1768
114 Ga0157378_11026192 3300013297 Bacteria 860
115 Ga0163162_10512526 3300013306 Bacteria 1329
116 Ga0157372_10120946 3300013307 Bacteria 3007
117 Ga0157375_10200114 3300013308 Bacteria 2153
118 Ga0157375_10546199 3300013308 Bacteria 1321
119 Ga0163163_10013594 3300014325 Bacteria 7455
120 Ga0163163_10440828 3300014325 Bacteria 1362
121 Ga0157380_10009894 3300014326 Bacteria 6846
122 Ga0157377_10049550 3300014745 Bacteria 2361
123 Ga0157379_10105771 3300014968 Bacteria 2526
124 Ga0157379_10403647 3300014968 Bacteria 1257
125 Ga0157376_10143478 3300014969 Bacteria 2145
126 Ga0157376_11454905 3300014969 Bacteria 718
127 Ga0206350_11173727 3300020080 Bacteria 759
128 Ga0224712_10345230 3300022467 Bacteria 703
129 Ga0207656_10330680 3300025321 Bacteria 758
130 Ga0207642_10286596 3300025899 Bacteria 949
131 Ga0207710_10486271 3300025900 Bacteria 640
132 Ga0207688_10002957 3300025901 Bacteria 9248
133 Ga0207647_10016056 3300025904 Bacteria 5116
134 Ga0207647_10027130 3300025904 Bacteria 3737
135 Ga0207699_10999256 3300025906 Bacteria 618
136 Ga0207645_10186329 3300025907 Bacteria 1363
137 Ga0207643_10044678 3300025908 Bacteria 2501
138 Ga0207654_10028034 3300025911 Bacteria 3067
139 Ga0207695_10000324 3300025913 Bacteria 114066
140 Ga0207671_10000133 3300025914 Bacteria 114011
141 Ga0207660_10014539 3300025917 Bacteria 5178
142 Ga0207660_10120250 3300025917 Bacteria 1988
143 Ga0207662_10137588 3300025918 Bacteria 1545
144 Ga0207657_10004080 3300025919 Bacteria 15504
145 Ga0207657_10024557 3300025919 Bacteria 5575
146 Ga0207649_10302714 3300025920 Bacteria 1169
147 Ga0207652_10284305 3300025921 Bacteria 1492
148 Ga0207646_10492606 3300025922 Bacteria 1105
149 Ga0207694_10000439 3300025924 Bacteria 38608
150 Ga0207694_10174493 3300025924 Bacteria 1741
151 Ga0207659_10323214 3300025926 Bacteria 1273
152 Ga0207687_10626172 3300025927 Bacteria 909
153 Ga0207700_10228063 3300025928 Bacteria 1582
154 Ga0207644_10641746 3300025931 Bacteria 883
155 Ga0207690_10092904 3300025932 Bacteria 2136
156 Ga0207706_10031337 3300025933 Bacteria 4738
157 Ga0207686_10127026 3300025934 Bacteria 1744
158 Ga0207709_10380821 3300025935 Bacteria 1074
159 Ga0207670_10231515 3300025936 Bacteria 1419
160 Ga0207669_10831467 3300025937 Bacteria 767
161 Ga0207704_10000104 3300025938 Bacteria 46614
162 Ga0207704_10787705 3300025938 Bacteria 793
163 Ga0207665_10093974 3300025939 Bacteria 2082
164 Ga0207711_10205262 3300025941 Bacteria 1799
165 Ga0207689_10110430 3300025942 Bacteria 2260
166 Ga0207661_10003421 3300025944 Bacteria 11009
167 Ga0207661_10491007 3300025944 Bacteria 1121
168 Ga0207661_10520998 3300025944 Bacteria 1087
169 Ga0207679_10068071 3300025945 Bacteria 2673
170 Ga0207679_10170149 3300025945 Bacteria 1793
171 Ga0207679_10278118 3300025945 Bacteria 1434
172 Ga0207679_10284646 3300025945 Bacteria 1419
173 Ga0207679_10374537 3300025945 Bacteria 1247
174 Ga0207712_10463801 3300025961 Bacteria 1077
175 Ga0207712_10915940 3300025961 Bacteria 775
176 Ga0207668_10028898 3300025972 Bacteria 3630
177 Ga0207668_10224612 3300025972 Bacteria 1510
178 Ga0207640_10053637 3300025981 Bacteria 2632
179 Ga0207677_10138582 3300026023 Bacteria 1859
180 Ga0207703_10050888 3300026035 Bacteria 3354
181 Ga0207703_10266847 3300026035 Bacteria 1549
182 Ga0207639_10249631 3300026041 Bacteria 1547
183 Ga0207678_10015057 3300026067 Bacteria 6804
184 Ga0207708_10010729 3300026075 Bacteria 6811
185 Ga0207641_10135271 3300026088 Bacteria 2218
186 Ga0207641_10848975 3300026088 Bacteria 905
187 Ga0207676_10412762 3300026095 Bacteria 1264
188 Ga0207676_11293621 3300026095 Bacteria 724
189 Ga0207674_10400060 3300026116 Bacteria 1327
190 Ga0207675_100022299 3300026118 Bacteria 5897
191 Ga0207683_10065715 3300026121 Bacteria 3198
192 Ga0207698_10046055 3300026142 Bacteria 3290
193 Ga0207698_10134157 3300026142 Bacteria 2121
194 Ga0268266_10030271 3300028379 Bacteria 4600
195 Ga0268266_10062891 3300028379 Bacteria 3204
196 Ga0268265_10095227 3300028380 Bacteria 2390
197 Ga0268265_10394604 3300028380 Bacteria 1277
198 Ga0268264_10063638 3300028381 Bacteria 3102
199 Ga0268264_10093753 3300028381 Bacteria 2594
200 Ga0307517_10108161 3300028786 Bacteria 2137
201 Ga0307515_10024969 3300028794 Bacteria 10369
202 Ga0307515_10167506 3300028794 Bacteria 2207
203 Ga0316176_1028264 3300030732 Bacteria 1788
204 Ga0307513_10087659 3300031456 Bacteria 3184
205 Ga0307513_10342895 3300031456 Bacteria 1244
206 Ga0307408_100111736 3300031548 Bacteria 2100
207 Ga0307508_10070785 3300031616 Bacteria 3061
208 Ga0307406_10010665 3300031901 Bacteria 5190
209 Ga0307407_10045756 3300031903 Bacteria 2475
210 Ga0307407_10226561 3300031903 Bacteria 1267
211 Ga0307412_10023304 3300031911 Bacteria 3807
212 Ga0307409_100000112 3300031995 Bacteria 29943
213 Ga0307409_100442692 3300031995 Bacteria 1252
214 Ga0307409_100915230 3300031995 Bacteria 891
215 Ga0307416_100001323 3300032002 Bacteria 13352
216 Ga0307416_100520081 3300032002 Bacteria 1258
217 Ga0307415_100000090 3300032126 Bacteria 38246
218 Ga0307415_100041225 3300032126 Bacteria 3064
219 Ga0373958_0049056 3300034819 Bacteria 887
220 Ga0373951_0031087 3300035091 Bacteria 1259
221 Ga0373952_0068959 3300035092 Bacteria 881
222 Ga0373960_0016205 3300035121 Bacteria 1914
223 Ga0373937_0317671 3300036401 Bacteria 1473
224 Ga0395898_0004097 3300037466 Bacteria 15990
225 Ga0395898_0057751 3300037466 Bacteria 3780
226 Ga0436364_1181210 3300037853 Bacteria 1816
227 Ga0436363_0136356 3300039450 Bacteria 761
228 Ga0436362_0984968 3300039453 Bacteria 1353
229 Ga0451797_0582256 3300041453 Bacteria 687
230 Ga0451845_0828134 3300041501 Bacteria 672
231 Ga0439455_0005193 3300042012 Bacteria 2629
232 Ga0450900_004499 3300042136 Bacteria 1605
233 Ga0450902_001000 3300042137 Bacteria 3721
234 Ga0450916_028305 3300042530 Bacteria 805
235 Ga0450901_002924 3300042533 Bacteria 1809
236 Ga0466965_0431092 3300044683 Bacteria 732
237 Ga0466960_0004237 3300044901 Bacteria 5584
238 Ga0466959_0792487 3300045049 Bacteria 634
239 Ga0495592_0184891 3300046454 Bacteria 1417
240 Ga0495651_0050768 3300046462 Bacteria 3199
241 Ga0495653_0088398 3300046463 Bacteria 2273
242 Ga0495618_0057280 3300046514 Bacteria 2467
243 Ga0495628_0022002 3300046516 Bacteria 5240
244 Ga0495628_0187807 3300046516 Bacteria 1561
245 Ga0495666_0021015 3300046526 Bacteria 3232
246 Ga0495652_0030890 3300046529 Bacteria 4694
247 Ga0495652_0065431 3300046529 Bacteria 3054
248 Ga0495640_0561386 3300046533 Bacteria 691
249 Ga0495587_0045785 3300046536 Bacteria 2599
250 Ga0495645_0017330 3300046543 Bacteria 5159
251 Ga0495611_0004408 3300046648 Bacteria 6092
252 Ga0495657_0032947 3300046675 Bacteria 3612
253 Ga0495646_0084023 3300046680 Bacteria 1849
254 Ga0495680_0008382 3300047322 Bacteria 9400
255 Ga0495687_030591 3300047443 Bacteria 2477
256 Ga0495685_017824 3300047447 Bacteria 2433
257 Ga0495686_0175429 3300047472 Bacteria 1245
258 Ga0495602_0037568 3300048088 Bacteria 4491
259 Ga0496100_0479929 3300048903 Bacteria 956
260 Ga0496101_0007003 3300048904 Bacteria 7282
261 Ga0496104_0016414 3300048907 Bacteria 6726
262 Ga0496104_0077420 3300048907 Bacteria 3169
263 Ga0496104_0191885 3300048907 Bacteria 1955
264 Ga0496104_0268944 3300048907 Bacteria 1617
265 Ga0496105_0004412 3300048908 Bacteria 10594
266 Ga0496105_0107422 3300048908 Bacteria 2304
267 Ga0496106_0013048 3300048909 Bacteria 6131
268 Ga0496107_0057650 3300048910 Bacteria 2808
269 Ga0496108_0011330 3300048911 Bacteria 7246
270 Ga0496108_0133559 3300048911 Bacteria 2134
271 Ga0496108_0261659 3300048911 Bacteria 1505
272 Ga0496108_1049811 3300048911 Bacteria 694
273 Ga0496109_0029178 3300048912 Bacteria 4939
274 Ga0496109_0156543 3300048912 Bacteria 2134
275 Ga0496109_0406660 3300048912 Bacteria 1286
276 Ga0496109_0454166 3300048912 Bacteria 1210
277 Ga0496110_0049491 3300048913 Bacteria 3687
278 Ga0496110_0233098 3300048913 Bacteria 1674
279 Ga0496111_0028965 3300048914 Bacteria 3928
280 Ga0496111_0204596 3300048914 Bacteria 1467
281 Ga0496111_0423164 3300048914 Bacteria 984
282 Ga0496112_0046267 3300048915 Bacteria 4267
283 Ga0496113_0287517 3300048916 Bacteria 1315
284 Ga0496113_0712591 3300048916 Bacteria 800
285 Ga0496114_0024372 3300048917 Bacteria 4938
286 Ga0501038_0000239 3300049574 Bacteria 46316
287 Ga0501043_0036774 3300049579 Bacteria 3852
288 Ga0501047_0258866 3300049581 Bacteria 1588
289 Ga0501035_0000238 3300049822 Bacteria 65886
290 Ga0501035_0048800 3300049822 Bacteria 3795
291 Ga0501035_0242089 3300049822 Bacteria 1534
292 Ga0501044_0002163 3300049823 Bacteria 22528
293 Ga0501044_0085537 3300049823 Bacteria 3186
294 Ga0501044_0329639 3300049823 Bacteria 1449
295 nmdc:mga00v17_192612_c1 3300050491 Bacteria 1317
296 nmdc:mga0yw44_244320_c1 3300050492 Bacteria 1194
297 nmdc:mga0yw44_585464_c1 3300050492 Bacteria 758
298 nmdc:mga08y16_498747_c1 3300050511 Bacteria 1237
299 nmdc:mga08y16_635838_c1 3300050511 Bacteria 1073
300 nmdc:mga08y16_844701_c1 3300050511 Bacteria 905
301 nmdc:mga0a205_251558_c1 3300050515 Bacteria 1646
302 nmdc:mga0sz30_203766_c1 3300050516 Bacteria 878
303 Ga0495601_0001248 3300053077 Bacteria 13945
304 Ga0495601_0127143 3300053077 Bacteria 1658
305 Ga0495612_0000828 3300053078 Bacteria 12579
306 Ga0495619_0041298 3300053085 Bacteria 3017
307 Ga0466962_0141157 3300061719 Bacteria 1167
308 2552112664 2551306166 Bacteria 9731570
309 2643751740 2643221546 Bacteria 2910897
310 2760624317 2758568621 Bacteria 5967089
311 2786671226 2786546132 Bacteria 10419719
312 2809027792 2808606394 Bacteria 6248540
313 2809228791 2808606448 Bacteria 8656184
314 2809229162 2808606448 Bacteria 8656184
315 2862389914 2862382967 Bacteria 10317375
316 2867302827 2867302475 Bacteria 7087181
317 2873158610 2873151551 Bacteria 8625867
318 2884702127 2884693830 Bacteria 11273186
319 2895433489 2895427314 Bacteria 13147766
320 2895445331 2895442618 Bacteria 11027144
321 2954677549 2954673503 Bacteria 9685905
322 2954686604 2954682443 Bacteria 9862841
323 8008559115 8008558824 Bacteria 10610750
324 8033690137 8033684223 Bacteria 6906479
325 8056061420 8056060235 Bacteria 7259403
326 8056583845 8056579771 Bacteria 5840325
327 Ga0070700_100007205
328 ARcpr5yngRDRAFT_c009144
329 JGI24743J22301_10063396
330 JGI24748J21848_1018670
331 JGI24033J26618_1020985
332 JGI24742J22300_10048064
333 rootL2_10109803
334 Ga0006562J51391_1064869
335 Ga0006562J51391_1064870
336 Ga0006562J51391_1080491
337 Ga0006562J51391_1080493
338 Ga0070658_10046948
339 Ga0070658_10081853
340 Ga0070676_10181036
341 Ga0070683_100110465
342 Ga0070683_100409855
343 Ga0070670_100015204
344 Ga0068869_100753935
345 Ga0070680_100068847
346 Ga0068868_100142999
347 Ga0070660_100003518
348 Ga0070660_100028577
349 Ga0070660_100090934
350 Ga0070689_100029316
351 Ga0070661_100029143
352 Ga0070661_100298791
353 Ga0070692_10004841
354 Ga0070668_100209711
355 Ga0070668_100248181
356 Ga0070669_100122485
357 Ga0070675_100088639
358 Ga0070671_100143523
359 Ga0070674_100009343
360 Ga0070674_100811041
361 Ga0070688_100017777
362 Ga0070659_100025350
363 Ga0070714_100480179
364 Ga0070714_100721844
365 Ga0070710_10408739
366 Ga0070701_10002878
367 Ga0070705_100069180
368 Ga0070663_100101164
369 Ga0070678_100984386
370 Ga0070662_100022890
371 Ga0070685_10006509
372 Ga0070707_100539496
373 Ga0070698_100038820
374 Ga0070679_100037283
375 Ga0070679_100086797
376 Ga0070679_100723765
377 Ga0070684_100010667
378 Ga0068853_100042624
379 Ga0068853_100839464
380 Ga0070672_100010440
381 Ga0070696_100060687
382 Ga0070693_100490220
383 Ga0070665_100015536
384 Ga0070665_100087794
385 Ga0070704_100200150
386 Ga0068855_100003166
387 Ga0068855_100141491
388 Ga0070664_100116745
389 Ga0070664_100117658
390 Ga0070664_100125397
391 Ga0068857_100392185
392 Ga0068854_100018157
393 Ga0070702_100006136
394 Ga0068852_100011803
395 Ga0068859_100096806
396 Ga0068864_100134550
397 Ga0068866_10066713
398 Ga0068861_100062428
399 Ga0068861_100235601
400 Ga0068851_10045712
401 Ga0068870_10003693
402 Ga0068863_100077473
403 Ga0068863_100086398
404 Ga0068858_100014745
405 Ga0068858_100109081
406 Ga0068860_100002073
407 Ga0068860_100043104
408 Ga0068860_100586138
409 Ga0068862_100449114
410 Ga0081455_10006337
411 Ga0081539_10001890
412 Ga0081539_10139958
413 Ga0075365_10018031
414 Ga0075363_100005432
415 Ga0075364_10371345
416 Ga0070712_100046218
417 Ga0097621_100359560
418 Ga0068871_100086437
419 Ga0068865_100000040
420 Ga0068865_100038034
421 Ga0097620_100096806
422 Ga0111539_10280930
423 Ga0105245_10015869
424 Ga0105247_10011767
425 Ga0105243_10012958
426 Ga0105241_10000495
427 Ga0105242_10147753
428 Ga0105248_10025503
429 Ga0105238_10155841
430 Ga0105238_10890804
431 Ga0105249_10206508
432 Ga0105239_10014494
433 Ga0105239_10108123
434 Ga0105246_10058221
435 Ga0157369_10011863
436 Ga0157369_10825561
437 Ga0157374_10046752
438 Ga0157374_10478215
439 Ga0157378_10229472
440 Ga0157378_11026192
441 Ga0163162_10512526
442 Ga0157372_10120946
443 Ga0157375_10200114
444 Ga0157375_10546199
445 Ga0163163_10013594
446 Ga0163163_10440828
447 Ga0157380_10009894
448 Ga0157377_10049550
449 Ga0157379_10105771
450 Ga0157379_10403647
451 Ga0157376_10143478
452 Ga0157376_11454905
453 Ga0206350_11173727
454 Ga0224712_10345230
455 Ga0207656_10330680
456 Ga0207642_10286596
457 Ga0207710_10486271
458 Ga0207688_10002957
459 Ga0207647_10016056
460 Ga0207647_10027130
461 Ga0207699_10999256
462 Ga0207645_10186329
463 Ga0207643_10044678
464 Ga0207654_10028034
465 Ga0207695_10000324
466 Ga0207671_10000133
467 Ga0207660_10014539
468 Ga0207660_10120250
469 Ga0207662_10137588
470 Ga0207657_10004080
471 Ga0207657_10024557
472 Ga0207649_10302714
473 Ga0207652_10284305
474 Ga0207646_10492606
475 Ga0207694_10000439
476 Ga0207694_10174493
477 Ga0207659_10323214
478 Ga0207687_10626172
479 Ga0207700_10228063
480 Ga0207644_10641746
481 Ga0207690_10092904
482 Ga0207706_10031337
483 Ga0207686_10127026
484 Ga0207709_10380821
485 Ga0207670_10231515
486 Ga0207669_10831467
487 Ga0207704_10000104
488 Ga0207704_10787705
489 Ga0207665_10093974
490 Ga0207711_10205262
491 Ga0207689_10110430
492 Ga0207661_10003421
493 Ga0207661_10491007
494 Ga0207661_10520998
495 Ga0207679_10068071
496 Ga0207679_10170149
497 Ga0207679_10278118
498 Ga0207679_10284646
499 Ga0207679_10374537
500 Ga0207712_10463801
501 Ga0207712_10915940
502 Ga0207668_10028898
503 Ga0207668_10224612
504 Ga0207640_10053637
505 Ga0207677_10138582
506 Ga0207703_10050888
507 Ga0207703_10266847
508 Ga0207639_10249631
509 Ga0207678_10015057
510 Ga0207708_10010729
511 Ga0207641_10135271
512 Ga0207641_10848975
513 Ga0207676_10412762
514 Ga0207676_11293621
515 Ga0207674_10400060
516 Ga0207675_100022299
517 Ga0207683_10065715
518 Ga0207698_10046055
519 Ga0207698_10134157
520 Ga0268266_10030271
521 Ga0268266_10062891
522 Ga0268265_10095227
523 Ga0268265_10394604
524 Ga0268264_10063638
525 Ga0268264_10093753
526 Ga0307517_10108161
527 Ga0307515_10024969
528 Ga0307515_10167506
529 Ga0316176_1028264
530 Ga0307513_10087659
531 Ga0307513_10342895
532 Ga0307408_100111736
533 Ga0307508_10070785
534 Ga0307406_10010665
535 Ga0307407_10045756
536 Ga0307407_10226561
537 Ga0307412_10023304
538 Ga0307409_100000112
539 Ga0307409_100442692
540 Ga0307409_100915230
541 Ga0307416_100001323
542 Ga0307416_100520081
543 Ga0307415_100000090
544 Ga0307415_100041225
545 Ga0373958_0049056
546 Ga0373951_0031087
547 Ga0373952_0068959
548 Ga0373960_0016205
549 Ga0373937_0317671
550 Ga0395898_0004097
551 Ga0395898_0057751
552 Ga0436364_1181210
553 Ga0436363_0136356
554 Ga0436362_0984968
555 Ga0451797_0582256
556 Ga0451845_0828134
557 Ga0439455_0005193
558 Ga0450900_004499
559 Ga0450902_001000
560 Ga0450916_028305
561 Ga0450901_002924
562 Ga0466965_0431092
563 Ga0466960_0004237
564 Ga0466959_0792487
565 Ga0495592_0184891
566 Ga0495651_0050768
567 Ga0495653_0088398
568 Ga0495618_0057280
569 Ga0495628_0022002
570 Ga0495628_0187807
571 Ga0495666_0021015
572 Ga0495652_0030890
573 Ga0495652_0065431
574 Ga0495640_0561386
575 Ga0495587_0045785
576 Ga0495645_0017330
577 Ga0495611_0004408
578 Ga0495657_0032947
579 Ga0495646_0084023
580 Ga0495680_0008382
581 Ga0495687_030591
582 Ga0495685_017824
583 Ga0495686_0175429
584 Ga0495602_0037568
585 Ga0496100_0479929
586 Ga0496101_0007003
587 Ga0496104_0016414
588 Ga0496104_0077420
589 Ga0496104_0191885
590 Ga0496104_0268944
591 Ga0496105_0004412
592 Ga0496105_0107422
593 Ga0496106_0013048
594 Ga0496107_0057650
595 Ga0496108_0011330
596 Ga0496108_0133559
597 Ga0496108_0261659
598 Ga0496108_1049811
599 Ga0496109_0029178
600 Ga0496109_0156543
601 Ga0496109_0406660
602 Ga0496109_0454166
603 Ga0496110_0049491
604 Ga0496110_0233098
605 Ga0496111_0028965
606 Ga0496111_0204596
607 Ga0496111_0423164
608 Ga0496112_0046267
609 Ga0496113_0287517
610 Ga0496113_0712591
611 Ga0496114_0024372
612 Ga0501038_0000239
613 Ga0501043_0036774
614 Ga0501047_0258866
615 Ga0501035_0000238
616 Ga0501035_0048800
617 Ga0501035_0242089
618 Ga0501044_0002163
619 Ga0501044_0085537
620 Ga0501044_0329639
621 nmdc:mga00v17_192612_c1
622 nmdc:mga0yw44_244320_c1
623 nmdc:mga0yw44_585464_c1
624 nmdc:mga08y16_498747_c1
625 nmdc:mga08y16_635838_c1
626 nmdc:mga08y16_844701_c1
627 nmdc:mga0a205_251558_c1
628 nmdc:mga0sz30_203766_c1
629 Ga0495601_0001248
630 Ga0495601_0127143
631 Ga0495612_0000828
632 Ga0495619_0041298
633 Ga0466962_0141157
634 2552112664
635 2643751740
636 2760624317
637 2786671226
638 2809027792
639 2809228791
640 2809229162
641 2862389914
642 2867302827
643 2873158610
644 2884702127
645 2895433489
646 2895445331
647 2954677549
648 2954686604
649 8008559115
650 8033690137
651 8056061420
652 8056583845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

38

217

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8087 3 187
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7916 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7916 3 187
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7878 4 189
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7825 3 187
ID Description Score Start End Superfamily
af_Q4DZ91_511_627_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8564 167 188 3.30.70.240
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8115 3 192 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8029 3 192 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7831 4 187 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7826 3 187 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2S8NGG0-F1-model_v4 deleted 0.9751 105 189
AF-Q0SA27-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9735 2 192 GO:0008703
GO:0009231
AF-A0A1G8Y1E9-F1-model_v4 Putative transposase DNA-binding domain-containing protein 0.9732 2 192 GO:0000150
GO:0003677
GO:0008703
GO:0009231
AF-A0A7Z0ENJ9-F1-model_v4 Dihydrofolate reductase 0.9714 90 192 GO:0008703
GO:0009231
AF-A0A7R7DSQ5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9643 1 192 GO:0008703
GO:0009231

Map