F408153

General Info

Members Datasets Scaffolds Average Seq Length
326 159 652 142

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101561334|Ga0068869_1015613341
Length 158
Sequence MKNGLKEDQMKVAKTGVTTSTMKNCQRALITLAGLCIVLVPAAWAHHSQSEYDLRSKVEVVGTMTRLEWRSPHAWIHVDATNDKGENVNWHFELPSPNTLMRRGWTRDSLKPGDRITVVGAPARNFPDIGIANSIKDGNGKPLFTGITEIYEPEAQSK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.92
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 28.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101561334 3300005334 Unclassified 587
2 Ga0065704_10125034 3300005289 Bacteria 1709
3 Ga0065712_10234195 3300005290 Bacteria 1002
4 Ga0065715_10225950 3300005293 Bacteria 1252
5 Ga0065707_10141975 3300005295 Bacteria 1760
6 Ga0070676_10596251 3300005328 Unclassified 796
7 Ga0070683_100149647 3300005329 Bacteria 2213
8 Ga0070690_100003137 3300005330 Bacteria 9004
9 Ga0070690_100012675 3300005330 Bacteria 4964
10 Ga0070690_100136808 3300005330 Bacteria 1660
11 Ga0070670_100012184 3300005331 Bacteria 7353
12 Ga0070670_100014862 3300005331 Bacteria 6677
13 Ga0070670_100020456 3300005331 Bacteria 5690
14 Ga0070670_100406045 3300005331 Unclassified 1203
15 Ga0070670_100623492 3300005331 Unclassified 966
16 Ga0070670_101090296 3300005331 Unclassified 728
17 Ga0068869_100141113 3300005334 Bacteria 1860
18 Ga0068869_100619405 3300005334 Unclassified 916
19 Ga0070666_10002537 3300005335 Bacteria 11047
20 Ga0070666_10008067 3300005335 Bacteria 6519
21 Ga0070666_10015469 3300005335 Bacteria 4868
22 Ga0070666_10402769 3300005335 Unclassified 984
23 Ga0068868_100002565 3300005338 Bacteria 12614
24 Ga0068868_100009301 3300005338 Bacteria 7063
25 Ga0070689_100065444 3300005340 Unclassified 2831
26 Ga0070689_100075347 3300005340 Bacteria 2642
27 Ga0070689_100114905 3300005340 Bacteria 2145
28 Ga0070691_10441780 3300005341 Bacteria 741
29 Ga0070687_100124137 3300005343 Bacteria 1481
30 Ga0070687_100310114 3300005343 Bacteria 1004
31 Ga0070687_100384377 3300005343 Unclassified 916
32 Ga0070661_100019918 3300005344 Unclassified 4782
33 Ga0070661_100223186 3300005344 Bacteria 1446
34 Ga0070669_100176498 3300005353 Bacteria 1669
35 Ga0070669_100179610 3300005353 Unclassified 1655
36 Ga0070669_100523817 3300005353 Bacteria 986
37 Ga0070669_100688846 3300005353 Bacteria 862
38 Ga0070675_100001549 3300005354 Bacteria 17016
39 Ga0070675_100067285 3300005354 Unclassified 2964
40 Ga0070675_100146027 3300005354 Unclassified 2025
41 Ga0070675_100228628 3300005354 Bacteria 1622
42 Ga0070675_100256990 3300005354 Unclassified 1530
43 Ga0070675_100995831 3300005354 Unclassified 769
44 Ga0070671_100001680 3300005355 Bacteria 16767
45 Ga0070671_100014413 3300005355 Bacteria 6387
46 Ga0070671_100093505 3300005355 Bacteria 2520
47 Ga0070674_100324259 3300005356 Bacteria 1236
48 Ga0070674_100679609 3300005356 Unclassified 878
49 Ga0070673_100005440 3300005364 Bacteria 8151
50 Ga0070673_100013242 3300005364 Bacteria 5695
51 Ga0070673_100016358 3300005364 Bacteria 5243
52 Ga0070673_100076762 3300005364 Bacteria 2699
53 Ga0070673_100632996 3300005364 Unclassified 978
54 Ga0070688_100012856 3300005365 Bacteria 4703
55 Ga0070688_100015992 3300005365 Bacteria 4281
56 Ga0070688_100089463 3300005365 Unclassified 2009
57 Ga0070688_100471648 3300005365 Bacteria 942
58 Ga0070659_100477858 3300005366 Bacteria 1060
59 Ga0070667_100002765 3300005367 Bacteria 15165
60 Ga0070667_100004043 3300005367 Bacteria 12402
61 Ga0070667_100004221 3300005367 Bacteria 12128
62 Ga0070713_100514895 3300005436 Unclassified 1130
63 Ga0070694_100027542 3300005444 Bacteria 3691
64 Ga0070663_100281587 3300005455 Bacteria 1325
65 Ga0070678_101192528 3300005456 Bacteria 706
66 Ga0070678_101237170 3300005456 Unclassified 693
67 Ga0070662_100234245 3300005457 Unclassified 1470
68 Ga0070662_100433497 3300005457 Unclassified 1089
69 Ga0070685_10079804 3300005466 Bacteria 1959
70 Ga0070685_10110221 3300005466 Unclassified 1694
71 Ga0070685_10583228 3300005466 Unclassified 802
72 Ga0070672_100014770 3300005543 Bacteria 5541
73 Ga0070672_100015329 3300005543 Bacteria 5455
74 Ga0070672_100306668 3300005543 Unclassified 1347
75 Ga0070672_100995366 3300005543 Unclassified 743
76 Ga0070686_100022439 3300005544 Bacteria 3759
77 Ga0070686_100045045 3300005544 Bacteria 2777
78 Ga0070686_100333580 3300005544 Unclassified 1134
79 Ga0070686_100342826 3300005544 Unclassified 1120
80 Ga0070686_100615996 3300005544 Bacteria 857
81 Ga0070696_101134800 3300005546 Bacteria 658
82 Ga0070665_100027430 3300005548 Bacteria 5737
83 Ga0070664_100002859 3300005564 Bacteria 13978
84 Ga0070664_100014779 3300005564 Bacteria 6374
85 Ga0070664_100618511 3300005564 Bacteria 1005
86 Ga0068856_100722627 3300005614 Unclassified 1016
87 Ga0070702_100045991 3300005615 Bacteria 2472
88 Ga0068859_100021482 3300005617 Bacteria 6480
89 Ga0068859_100039353 3300005617 Bacteria 4743
90 Ga0068859_100053815 3300005617 Bacteria 4048
91 Ga0068859_100078284 3300005617 Bacteria 3346
92 Ga0068864_100001874 3300005618 Bacteria 17274
93 Ga0068864_100054891 3300005618 Bacteria 3438
94 Ga0068864_100099220 3300005618 Bacteria 2580
95 Ga0068864_100127460 3300005618 Bacteria 2282
96 Ga0068861_100395736 3300005719 Bacteria 1225
97 Ga0068861_100746412 3300005719 Unclassified 914
98 Ga0068870_11068600 3300005840 Bacteria 579
99 Ga0068863_100001445 3300005841 Bacteria 23580
100 Ga0068863_100010739 3300005841 Bacteria 8887
101 Ga0068863_100065816 3300005841 Unclassified 3429
102 Ga0068863_100180367 3300005841 Unclassified 2027
103 Ga0068863_100183605 3300005841 Bacteria 2008
104 Ga0068863_100536017 3300005841 Bacteria 1155
105 Ga0068863_101328936 3300005841 Bacteria 726
106 Ga0068858_100003499 3300005842 Bacteria 15573
107 Ga0068858_100009887 3300005842 Bacteria 9062
108 Ga0068858_100070001 3300005842 Unclassified 3252
109 Ga0068860_100018985 3300005843 Bacteria 6677
110 Ga0068860_100839948 3300005843 Bacteria 933
111 Ga0068860_101241673 3300005843 Bacteria 766
112 Ga0068860_101579944 3300005843 Unclassified 678
113 Ga0068862_100371956 3300005844 Bacteria 1331
114 Ga0081455_10732524 3300005937 Bacteria 627
115 Ga0081455_10908413 3300005937 Unclassified 547
116 Ga0097621_100182639 3300006237 Unclassified 1813
117 Ga0097621_100412413 3300006237 Unclassified 1211
118 Ga0097621_100566798 3300006237 Bacteria 1035
119 Ga0068871_100013053 3300006358 Bacteria 6158
120 Ga0068871_100018817 3300006358 Bacteria 5261
121 Ga0068871_100619999 3300006358 Bacteria 985
122 Ga0075428_100061713 3300006844 Bacteria 4105
123 Ga0075428_100240438 3300006844 Bacteria 1953
124 Ga0075428_100548275 3300006844 Unclassified 1236
125 Ga0075430_100141007 3300006846 Bacteria 2007
126 Ga0075430_101125320 3300006846 Unclassified 647
127 Ga0075431_100767015 3300006847 Bacteria 939
128 Ga0075433_10030631 3300006852 Bacteria 4591
129 Ga0075434_100021401 3300006871 Bacteria 6284
130 Ga0075434_100055957 3300006871 Bacteria 3920
131 Ga0075429_100171478 3300006880 Bacteria 1900
132 Ga0068865_100425890 3300006881 Unclassified 1092
133 Ga0068865_101008467 3300006881 Unclassified 729
134 Ga0068865_101520870 3300006881 Bacteria 600
135 Ga0097620_100021483 3300006931 Bacteria 6480
136 Ga0097620_100039356 3300006931 Bacteria 4743
137 Ga0097620_100053813 3300006931 Bacteria 4048
138 Ga0097620_100078283 3300006931 Bacteria 3346
139 Ga0075435_100721415 3300007076 Bacteria 867
140 Ga0105240_10102962 3300009093 Bacteria 3469
141 Ga0111539_10015360 3300009094 Bacteria 9533
142 Ga0111539_10023940 3300009094 Bacteria 7502
143 Ga0111539_10140225 3300009094 Bacteria 2830
144 Ga0111539_12062081 3300009094 Bacteria 662
145 Ga0111539_12423539 3300009094 Unclassified 609
146 Ga0111539_12870941 3300009094 Bacteria 558
147 Ga0105245_10004989 3300009098 Bacteria 11667
148 Ga0105247_10001938 3300009101 Bacteria 14389
149 Ga0105247_10161119 3300009101 Unclassified 1485
150 Ga0114129_10458862 3300009147 Unclassified 1670
151 Ga0114129_12262997 3300009147 Unclassified 653
152 Ga0105242_10365950 3300009176 Unclassified 1336
153 Ga0105242_11988446 3300009176 Bacteria 623
154 Ga0105248_10002534 3300009177 Bacteria 20343
155 Ga0105248_10012792 3300009177 Bacteria 9257
156 Ga0105248_10025235 3300009177 Bacteria 6608
157 Ga0105248_11298561 3300009177 Unclassified 823
158 Ga0105248_12428895 3300009177 Unclassified 597
159 Ga0105238_10042243 3300009551 Bacteria 4617
160 Ga0105249_10543886 3300009553 Bacteria 1211
161 Ga0105239_10091357 3300010375 Bacteria 3359
162 Ga0105246_10010669 3300011119 Bacteria 5691
163 Ga0157374_10014533 3300013296 Bacteria 6890
164 Ga0157378_11788281 3300013297 Unclassified 662
165 Ga0163162_10003570 3300013306 Bacteria 14875
166 Ga0163162_10021611 3300013306 Bacteria 6339
167 Ga0157375_10006778 3300013308 Bacteria 9978
168 Ga0157375_10011697 3300013308 Bacteria 7755
169 Ga0157375_10309271 3300013308 Unclassified 1744
170 Ga0157375_10824187 3300013308 Bacteria 1076
171 Ga0157375_11136400 3300013308 Unclassified 915
172 Ga0163163_10008895 3300014325 Bacteria 8943
173 Ga0163163_10021200 3300014325 Bacteria 6129
174 Ga0163163_10049976 3300014325 Bacteria 4117
175 Ga0163163_10139472 3300014325 Bacteria 2466
176 Ga0163163_11314889 3300014325 Bacteria 785
177 Ga0157380_10004652 3300014326 Bacteria 9548
178 Ga0157380_11676325 3300014326 Unclassified 693
179 Ga0157377_10062952 3300014745 Unclassified 2124
180 Ga0157377_10118381 3300014745 Bacteria 1602
181 Ga0157377_10252119 3300014745 Bacteria 1144
182 Ga0157377_10322561 3300014745 Bacteria 1027
183 Ga0157379_10001862 3300014968 Bacteria 17457
184 Ga0157379_10007202 3300014968 Bacteria 9620
185 Ga0157379_11955501 3300014968 Bacteria 579
186 Ga0157376_10270684 3300014969 Bacteria 1595
187 Ga0163161_10122539 3300017792 Unclassified 1955
188 Ga0163161_10693372 3300017792 Unclassified 847
189 Ga0163161_11094374 3300017792 Bacteria 685
190 Ga0163161_11284994 3300017792 Bacteria 636
191 Ga0207682_10226532 3300025893 Bacteria 866
192 Ga0207710_10044836 3300025900 Bacteria 1971
193 Ga0207688_10319512 3300025901 Bacteria 952
194 Ga0207680_10006879 3300025903 Bacteria 5516
195 Ga0207680_10023516 3300025903 Bacteria 3367
196 Ga0207699_10884223 3300025906 Unclassified 659
197 Ga0207643_10513681 3300025908 Bacteria 767
198 Ga0207643_10639437 3300025908 Unclassified 686
199 Ga0207695_11021730 3300025913 Bacteria 706
200 Ga0207662_10098336 3300025918 Unclassified 1810
201 Ga0207649_10051082 3300025920 Bacteria 2559
202 Ga0207649_10219007 3300025920 Bacteria 1355
203 Ga0207649_10297560 3300025920 Bacteria 1179
204 Ga0207681_10165361 3300025923 Bacteria 1672
205 Ga0207681_10936674 3300025923 Bacteria 726
206 Ga0207694_10024155 3300025924 Bacteria 4616
207 Ga0207650_10007005 3300025925 Bacteria 7688
208 Ga0207650_10012720 3300025925 Bacteria 5811
209 Ga0207650_10049318 3300025925 Unclassified 3108
210 Ga0207650_10558889 3300025925 Unclassified 960
211 Ga0207650_10782880 3300025925 Unclassified 808
212 Ga0207659_10001078 3300025926 Bacteria 16193
213 Ga0207659_10004042 3300025926 Bacteria 8852
214 Ga0207659_10010262 3300025926 Bacteria 5878
215 Ga0207659_10040094 3300025926 Bacteria 3272
216 Ga0207659_10096401 3300025926 Bacteria 2220
217 Ga0207659_10305919 3300025926 Bacteria 1307
218 Ga0207700_10631375 3300025928 Unclassified 954
219 Ga0207644_10010029 3300025931 Bacteria 6235
220 Ga0207644_10117396 3300025931 Bacteria 2021
221 Ga0207644_10136391 3300025931 Unclassified 1884
222 Ga0207706_10274146 3300025933 Unclassified 1472
223 Ga0207706_10443167 3300025933 Unclassified 1124
224 Ga0207670_10056583 3300025936 Bacteria 2656
225 Ga0207669_11539371 3300025937 Unclassified 567
226 Ga0207691_10005288 3300025940 Bacteria 12458
227 Ga0207691_10023026 3300025940 Bacteria 5867
228 Ga0207691_10076410 3300025940 Bacteria 3018
229 Ga0207691_10469533 3300025940 Unclassified 1070
230 Ga0207711_10006984 3300025941 Bacteria 9473
231 Ga0207711_10016050 3300025941 Bacteria 6214
232 Ga0207711_10299523 3300025941 Bacteria 1483
233 Ga0207711_11799726 3300025941 Unclassified 556
234 Ga0207689_10981258 3300025942 Unclassified 713
235 Ga0207661_10138809 3300025944 Bacteria 2090
236 Ga0207679_10024278 3300025945 Bacteria 4156
237 Ga0207679_10146573 3300025945 Bacteria 1915
238 Ga0207679_10195384 3300025945 Bacteria 1686
239 Ga0207679_10235346 3300025945 Unclassified 1549
240 Ga0207651_10035239 3300025960 Bacteria 3251
241 Ga0207651_10074690 3300025960 Unclassified 2415
242 Ga0207651_10133530 3300025960 Bacteria 1904
243 Ga0207651_10289197 3300025960 Bacteria 1358
244 Ga0207712_10358005 3300025961 Bacteria 1215
245 Ga0207712_11161094 3300025961 Unclassified 688
246 Ga0207658_10007849 3300025986 Bacteria 7268
247 Ga0207658_10011508 3300025986 Bacteria 6021
248 Ga0207658_10117826 3300025986 Bacteria 2111
249 Ga0207658_10190369 3300025986 Bacteria 1705
250 Ga0207677_10004916 3300026023 Bacteria 7215
251 Ga0207677_10010541 3300026023 Bacteria 5236
252 Ga0207677_10822269 3300026023 Bacteria 833
253 Ga0207703_10009212 3300026035 Bacteria 7766
254 Ga0207703_10295986 3300026035 Bacteria 1474
255 Ga0207678_10104016 3300026067 Bacteria 2423
256 Ga0207641_10002139 3300026088 Bacteria 18677
257 Ga0207641_10007942 3300026088 Bacteria 8796
258 Ga0207641_10047145 3300026088 Bacteria 3633
259 Ga0207641_10239281 3300026088 Bacteria 1691
260 Ga0207676_10002273 3300026095 Bacteria 13784
261 Ga0207676_10015081 3300026095 Bacteria 5572
262 Ga0207676_10577179 3300026095 Bacteria 1077
263 Ga0207674_10382773 3300026116 Unclassified 1360
264 Ga0207675_102507202 3300026118 Unclassified 526
265 Ga0209971_1083685 3300027682 Unclassified 777
266 Ga0209974_10057807 3300027876 Bacteria 1310
267 Ga0207428_10009159 3300027907 Bacteria 8895
268 Ga0207428_10048224 3300027907 Bacteria 3418
269 Ga0268266_10081152 3300028379 Bacteria 2827
270 Ga0268265_10296428 3300028380 Bacteria 1454
271 Ga0268265_10395198 3300028380 Bacteria 1276
272 Ga0268264_10021049 3300028381 Bacteria 5330
273 Ga0268264_10272950 3300028381 Bacteria 1580
274 Ga0268264_11478286 3300028381 Bacteria 690
275 Ga0307409_100951084 3300031995 Bacteria 875
276 Ga0373939_0072581 3300035114 Unclassified 1124
277 Ga0373954_0135806 3300035118 Bacteria 1198
278 Ga0373924_0261386 3300035410 Unclassified 767
279 Ga0373931_0027266 3300035691 Bacteria 2915
280 Ga0373933_0089561 3300035724 Bacteria 1897
281 Ga0373937_0234769 3300036401 Unclassified 1727
282 Ga0373937_0260782 3300036401 Bacteria 1634
283 Ga0373937_0980148 3300036401 Unclassified 794
284 Ga0373925_0723986 3300037068 Unclassified 820
285 Ga0439443_046757 3300042003 Bacteria 750
286 Ga0453683_0695739 3300044673 Unclassified 666
287 Ga0451576_0114828 3300045051 Bacteria 2803
288 Ga0451576_0459523 3300045051 Bacteria 1337
289 Ga0451576_1914115 3300045051 Unclassified 612
290 Ga0495592_0010245 3300046454 Bacteria 7067
291 Ga0495651_0381669 3300046462 Unclassified 924
292 Ga0495580_0452928 3300046472 Unclassified 861
293 Ga0495639_0048522 3300046475 Unclassified 1925
294 Ga0495618_0024206 3300046514 Bacteria 3758
295 Ga0495630_1221304 3300046517 Unclassified 568
296 Ga0495640_0255550 3300046533 Bacteria 1096
297 Ga0495586_0087229 3300046535 Bacteria 1721
298 Ga0495667_0012597 3300046559 Bacteria 5734
299 Ga0495656_0038934 3300046615 Unclassified 1972
300 Ga0495634_0172813 3300046642 Bacteria 1357
301 Ga0495659_0077630 3300046664 Bacteria 1255
302 Ga0495657_0000661 3300046675 Bacteria 31230
303 Ga0495599_0097295 3300046678 Bacteria 1835
304 Ga0495647_0026928 3300046681 Unclassified 2110
305 Ga0495613_0370202 3300046689 Unclassified 981
306 Ga0495624_0680634 3300046690 Unclassified 611
307 Ga0495670_0520827 3300046691 Unclassified 646
308 Ga0495672_0100776 3300047320 Bacteria 1567
309 Ga0495684_0911880 3300047471 Unclassified 565
310 Ga0496108_0065560 3300048911 Bacteria 3061
311 Ga0496109_0008452 3300048912 Bacteria 8754
312 Ga0496112_0002290 3300048915 Bacteria 15320
313 nmdc:mga05p37_451520_c1 3300050507 Bacteria 1488
314 nmdc:mga09592_112987_c1 3300050508 Unclassified 2331
315 nmdc:mga0qj67_22406_c1 3300050509 Bacteria 4852
316 nmdc:mga06r32_750762_c1 3300050510 Bacteria 939
317 nmdc:mga08y16_1002755_c1 3300050511 Bacteria 815
318 nmdc:mga08y16_1061_c1 3300050511 Bacteria 27042
319 nmdc:mga08y16_220712_c1 3300050511 Bacteria 1963
320 nmdc:mga08y16_969909_c1 3300050511 Bacteria 832
321 nmdc:mga0n895_13079_c1 3300050512 Bacteria 7467
322 nmdc:mga0n895_54647_c1 3300050512 Bacteria 3929
323 nmdc:mga0rr50_24391_c1 3300050513 Bacteria 4188
324 nmdc:mga0a205_6735_c1 3300050515 Bacteria 10390
325 nmdc:mga0a205_88925_c1 3300050515 Bacteria 2986
326 Ga0495601_0106888 3300053077 Bacteria 1810
327 Ga0068869_101561334
328 Ga0065704_10125034
329 Ga0065712_10234195
330 Ga0065715_10225950
331 Ga0065707_10141975
332 Ga0070676_10596251
333 Ga0070683_100149647
334 Ga0070690_100003137
335 Ga0070690_100012675
336 Ga0070690_100136808
337 Ga0070670_100012184
338 Ga0070670_100014862
339 Ga0070670_100020456
340 Ga0070670_100406045
341 Ga0070670_100623492
342 Ga0070670_101090296
343 Ga0068869_100141113
344 Ga0068869_100619405
345 Ga0070666_10002537
346 Ga0070666_10008067
347 Ga0070666_10015469
348 Ga0070666_10402769
349 Ga0068868_100002565
350 Ga0068868_100009301
351 Ga0070689_100065444
352 Ga0070689_100075347
353 Ga0070689_100114905
354 Ga0070691_10441780
355 Ga0070687_100124137
356 Ga0070687_100310114
357 Ga0070687_100384377
358 Ga0070661_100019918
359 Ga0070661_100223186
360 Ga0070669_100176498
361 Ga0070669_100179610
362 Ga0070669_100523817
363 Ga0070669_100688846
364 Ga0070675_100001549
365 Ga0070675_100067285
366 Ga0070675_100146027
367 Ga0070675_100228628
368 Ga0070675_100256990
369 Ga0070675_100995831
370 Ga0070671_100001680
371 Ga0070671_100014413
372 Ga0070671_100093505
373 Ga0070674_100324259
374 Ga0070674_100679609
375 Ga0070673_100005440
376 Ga0070673_100013242
377 Ga0070673_100016358
378 Ga0070673_100076762
379 Ga0070673_100632996
380 Ga0070688_100012856
381 Ga0070688_100015992
382 Ga0070688_100089463
383 Ga0070688_100471648
384 Ga0070659_100477858
385 Ga0070667_100002765
386 Ga0070667_100004043
387 Ga0070667_100004221
388 Ga0070713_100514895
389 Ga0070694_100027542
390 Ga0070663_100281587
391 Ga0070678_101192528
392 Ga0070678_101237170
393 Ga0070662_100234245
394 Ga0070662_100433497
395 Ga0070685_10079804
396 Ga0070685_10110221
397 Ga0070685_10583228
398 Ga0070672_100014770
399 Ga0070672_100015329
400 Ga0070672_100306668
401 Ga0070672_100995366
402 Ga0070686_100022439
403 Ga0070686_100045045
404 Ga0070686_100333580
405 Ga0070686_100342826
406 Ga0070686_100615996
407 Ga0070696_101134800
408 Ga0070665_100027430
409 Ga0070664_100002859
410 Ga0070664_100014779
411 Ga0070664_100618511
412 Ga0068856_100722627
413 Ga0070702_100045991
414 Ga0068859_100021482
415 Ga0068859_100039353
416 Ga0068859_100053815
417 Ga0068859_100078284
418 Ga0068864_100001874
419 Ga0068864_100054891
420 Ga0068864_100099220
421 Ga0068864_100127460
422 Ga0068861_100395736
423 Ga0068861_100746412
424 Ga0068870_11068600
425 Ga0068863_100001445
426 Ga0068863_100010739
427 Ga0068863_100065816
428 Ga0068863_100180367
429 Ga0068863_100183605
430 Ga0068863_100536017
431 Ga0068863_101328936
432 Ga0068858_100003499
433 Ga0068858_100009887
434 Ga0068858_100070001
435 Ga0068860_100018985
436 Ga0068860_100839948
437 Ga0068860_101241673
438 Ga0068860_101579944
439 Ga0068862_100371956
440 Ga0081455_10732524
441 Ga0081455_10908413
442 Ga0097621_100182639
443 Ga0097621_100412413
444 Ga0097621_100566798
445 Ga0068871_100013053
446 Ga0068871_100018817
447 Ga0068871_100619999
448 Ga0075428_100061713
449 Ga0075428_100240438
450 Ga0075428_100548275
451 Ga0075430_100141007
452 Ga0075430_101125320
453 Ga0075431_100767015
454 Ga0075433_10030631
455 Ga0075434_100021401
456 Ga0075434_100055957
457 Ga0075429_100171478
458 Ga0068865_100425890
459 Ga0068865_101008467
460 Ga0068865_101520870
461 Ga0097620_100021483
462 Ga0097620_100039356
463 Ga0097620_100053813
464 Ga0097620_100078283
465 Ga0075435_100721415
466 Ga0105240_10102962
467 Ga0111539_10015360
468 Ga0111539_10023940
469 Ga0111539_10140225
470 Ga0111539_12062081
471 Ga0111539_12423539
472 Ga0111539_12870941
473 Ga0105245_10004989
474 Ga0105247_10001938
475 Ga0105247_10161119
476 Ga0114129_10458862
477 Ga0114129_12262997
478 Ga0105242_10365950
479 Ga0105242_11988446
480 Ga0105248_10002534
481 Ga0105248_10012792
482 Ga0105248_10025235
483 Ga0105248_11298561
484 Ga0105248_12428895
485 Ga0105238_10042243
486 Ga0105249_10543886
487 Ga0105239_10091357
488 Ga0105246_10010669
489 Ga0157374_10014533
490 Ga0157378_11788281
491 Ga0163162_10003570
492 Ga0163162_10021611
493 Ga0157375_10006778
494 Ga0157375_10011697
495 Ga0157375_10309271
496 Ga0157375_10824187
497 Ga0157375_11136400
498 Ga0163163_10008895
499 Ga0163163_10021200
500 Ga0163163_10049976
501 Ga0163163_10139472
502 Ga0163163_11314889
503 Ga0157380_10004652
504 Ga0157380_11676325
505 Ga0157377_10062952
506 Ga0157377_10118381
507 Ga0157377_10252119
508 Ga0157377_10322561
509 Ga0157379_10001862
510 Ga0157379_10007202
511 Ga0157379_11955501
512 Ga0157376_10270684
513 Ga0163161_10122539
514 Ga0163161_10693372
515 Ga0163161_11094374
516 Ga0163161_11284994
517 Ga0207682_10226532
518 Ga0207710_10044836
519 Ga0207688_10319512
520 Ga0207680_10006879
521 Ga0207680_10023516
522 Ga0207699_10884223
523 Ga0207643_10513681
524 Ga0207643_10639437
525 Ga0207695_11021730
526 Ga0207662_10098336
527 Ga0207649_10051082
528 Ga0207649_10219007
529 Ga0207649_10297560
530 Ga0207681_10165361
531 Ga0207681_10936674
532 Ga0207694_10024155
533 Ga0207650_10007005
534 Ga0207650_10012720
535 Ga0207650_10049318
536 Ga0207650_10558889
537 Ga0207650_10782880
538 Ga0207659_10001078
539 Ga0207659_10004042
540 Ga0207659_10010262
541 Ga0207659_10040094
542 Ga0207659_10096401
543 Ga0207659_10305919
544 Ga0207700_10631375
545 Ga0207644_10010029
546 Ga0207644_10117396
547 Ga0207644_10136391
548 Ga0207706_10274146
549 Ga0207706_10443167
550 Ga0207670_10056583
551 Ga0207669_11539371
552 Ga0207691_10005288
553 Ga0207691_10023026
554 Ga0207691_10076410
555 Ga0207691_10469533
556 Ga0207711_10006984
557 Ga0207711_10016050
558 Ga0207711_10299523
559 Ga0207711_11799726
560 Ga0207689_10981258
561 Ga0207661_10138809
562 Ga0207679_10024278
563 Ga0207679_10146573
564 Ga0207679_10195384
565 Ga0207679_10235346
566 Ga0207651_10035239
567 Ga0207651_10074690
568 Ga0207651_10133530
569 Ga0207651_10289197
570 Ga0207712_10358005
571 Ga0207712_11161094
572 Ga0207658_10007849
573 Ga0207658_10011508
574 Ga0207658_10117826
575 Ga0207658_10190369
576 Ga0207677_10004916
577 Ga0207677_10010541
578 Ga0207677_10822269
579 Ga0207703_10009212
580 Ga0207703_10295986
581 Ga0207678_10104016
582 Ga0207641_10002139
583 Ga0207641_10007942
584 Ga0207641_10047145
585 Ga0207641_10239281
586 Ga0207676_10002273
587 Ga0207676_10015081
588 Ga0207676_10577179
589 Ga0207674_10382773
590 Ga0207675_102507202
591 Ga0209971_1083685
592 Ga0209974_10057807
593 Ga0207428_10009159
594 Ga0207428_10048224
595 Ga0268266_10081152
596 Ga0268265_10296428
597 Ga0268265_10395198
598 Ga0268264_10021049
599 Ga0268264_10272950
600 Ga0268264_11478286
601 Ga0307409_100951084
602 Ga0373939_0072581
603 Ga0373954_0135806
604 Ga0373924_0261386
605 Ga0373931_0027266
606 Ga0373933_0089561
607 Ga0373937_0234769
608 Ga0373937_0260782
609 Ga0373937_0980148
610 Ga0373925_0723986
611 Ga0439443_046757
612 Ga0453683_0695739
613 Ga0451576_0114828
614 Ga0451576_0459523
615 Ga0451576_1914115
616 Ga0495592_0010245
617 Ga0495651_0381669
618 Ga0495580_0452928
619 Ga0495639_0048522
620 Ga0495618_0024206
621 Ga0495630_1221304
622 Ga0495640_0255550
623 Ga0495586_0087229
624 Ga0495667_0012597
625 Ga0495656_0038934
626 Ga0495634_0172813
627 Ga0495659_0077630
628 Ga0495657_0000661
629 Ga0495599_0097295
630 Ga0495647_0026928
631 Ga0495613_0370202
632 Ga0495624_0680634
633 Ga0495670_0520827
634 Ga0495672_0100776
635 Ga0495684_0911880
636 Ga0496108_0065560
637 Ga0496109_0008452
638 Ga0496112_0002290
639 nmdc:mga05p37_451520_c1
640 nmdc:mga09592_112987_c1
641 nmdc:mga0qj67_22406_c1
642 nmdc:mga06r32_750762_c1
643 nmdc:mga08y16_1002755_c1
644 nmdc:mga08y16_1061_c1
645 nmdc:mga08y16_220712_c1
646 nmdc:mga08y16_969909_c1
647 nmdc:mga0n895_13079_c1
648 nmdc:mga0n895_54647_c1
649 nmdc:mga0rr50_24391_c1
650 nmdc:mga0a205_6735_c1
651 nmdc:mga0a205_88925_c1
652 Ga0495601_0106888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

35

132

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.803 46 76
7c4l-assembly1.cif.gz_A anncestral l-amino acid oxidase (anclaao-n5) l-gln binding form 0.8025 46 76
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7747 42 75
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7734 42 75
2pqa-assembly1.cif.gz_A crystal structure of full-length human rpa 14/32 heterodimer 0.7609 38 124
ID Description Score Start End Superfamily
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8371 45 77 2.130.10.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8278 40 78 2.40.50.140
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7889 45 76 2.120.10.80
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7881 45 85 2.30.29.30
af_C3JXD8_846_1160_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.78 46 78 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9732 34 127
AF-A0A2E2HBI4-F1-model_v4 Uncharacterized protein 0.9571 34 125
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9515 34 121
AF-A0A2E5NMG3-F1-model_v4 Polyketide cyclase 0.9513 31 124
AF-A0A6I4SZ04-F1-model_v4 DUF5666 domain-containing protein 0.9486 34 131

Map