F408092

General Info

Members Datasets Scaffolds Average Seq Length
325 204 650 192

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606375|2808917942
Length 209
Sequence AIARKVIDGRVIAFLCSAGMELIQNTPDLSAYLAADEVIDHHHPLVRRTAARLARDAEDSYAYARLAFEFVRDTIPHSQDSGDPRVTWRASDVLEQGTGICYAKAHALAALLRAEDIPTALCYQKFDVLHGLVAVRFNGAWHRQDPRGNKPGVDAQFSLDGERLAFAPDPEFNELDYPVLYAEPHPAVLDALRSAPDRAYLWKTLPTAL

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
25 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
26 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
40 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
41 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
42 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
43 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
44 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
47 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
51 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
52 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
53 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
54 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
55 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
56 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
162 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
163 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
164 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
170 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
171 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
174 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
177 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
180 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
181 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
182 2643221647 Streptomyces sp. Root369 Isolate Unclassified
183 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
184 2643221714 Streptomyces sp. Root264 Isolate Unclassified
185 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
186 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
187 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
188 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
189 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
190 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
191 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
192 2867428634 Streptomyces sp. RP5T Isolate Unclassified
193 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
194 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
195 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
196 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
197 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
198 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
199 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
200 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
201 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
202 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
203 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
204 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 0.31
Isolates 8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0.62
Rhizoplane 1.23
Rhizosphere 72.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10104391 3300001990 Bacteria 839
2 rootH1_10064481 3300003316 Bacteria 1067
3 rootH1_10086878 3300003316 Bacteria 3197
4 rootL2_10027891 3300003322 Bacteria 6269
5 rootL2_10072352 3300003322 Bacteria 1060
6 rootH1_10014407 3300003323 Bacteria 5599
7 Ga0006562J51391_1103054 3300003578 Bacteria 3290
8 Ga0081455_10041060 3300005937 Bacteria 4074
9 Ga0075365_10144288 3300006038 Bacteria 1654
10 Ga0075363_100102818 3300006048 Bacteria 1582
11 Ga0075363_100116673 3300006048 Bacteria 1487
12 Ga0075367_10013551 3300006178 Bacteria 4387
13 Ga0075370_10031726 3300006353 Bacteria 2950
14 Ga0075370_10105475 3300006353 Bacteria 1634
15 Ga0105244_10099877 3300009036 Bacteria 1420
16 Ga0105250_10087995 3300009092 Bacteria 1261
17 Ga0105245_11011569 3300009098 Bacteria 876
18 Ga0105243_11524042 3300009148 Bacteria 693
19 Ga0105246_10536447 3300011119 Bacteria 1000
20 Ga0157369_11454168 3300013105 Bacteria 697
21 Ga0182008_10001610 3300014497 Bacteria 14983
22 Ga0182007_10001297 3300015262 Bacteria 13519
23 Ga0183367_1003 3300015688 Bacteria 814276
24 Ga0209758_1003249 3300025297 Bacteria 15073
25 Ga0207426_1036375 3300025302 Bacteria 1565
26 Ga0207647_10020158 3300025904 Bacteria 4475
27 Ga0307517_10014742 3300028786 Bacteria 10464
28 Ga0307517_10019851 3300028786 Bacteria 8596
29 Ga0307515_10000633 3300028794 Bacteria 81559
30 Ga0307515_10100684 3300028794 Bacteria 3496
31 Ga0307511_10000474 3300030521 Bacteria 43520
32 Ga0307512_10022518 3300030522 Bacteria 5658
33 Ga0307513_10088437 3300031456 Bacteria 3166
34 Ga0307509_10006938 3300031507 Bacteria 15022
35 Ga0307509_10065803 3300031507 Bacteria 3804
36 Ga0307509_10286580 3300031507 Bacteria 1404
37 Ga0307508_10022789 3300031616 Bacteria 5691
38 Ga0307508_10028866 3300031616 Bacteria 5015
39 Ga0307508_10130043 3300031616 Bacteria 2121
40 Ga0307514_10005798 3300031649 Bacteria 10911
41 Ga0307514_10022291 3300031649 Bacteria 5150
42 Ga0307514_10073880 3300031649 Bacteria 2547
43 Ga0307514_10104654 3300031649 Bacteria 2023
44 Ga0307514_10147833 3300031649 Bacteria 1584
45 Ga0307516_10004895 3300031730 Bacteria 16297
46 Ga0307516_10031853 3300031730 Bacteria 5314
47 Ga0307516_10099326 3300031730 Bacteria 2728
48 Ga0307518_10017864 3300031838 Bacteria 5082
49 Ga0307518_10068595 3300031838 Bacteria 2569
50 Ga0307518_10273600 3300031838 Bacteria 1052
51 Ga0307507_10009406 3300033179 Bacteria 13043
52 Ga0307507_10048642 3300033179 Bacteria 4121
53 Ga0307507_10162973 3300033179 Bacteria 1642
54 Ga0307507_10175023 3300033179 Bacteria 1549
55 Ga0307507_10284509 3300033179 Bacteria 1030
56 Ga0307510_10042130 3300033180 Bacteria 4979
57 Ga0395899_0664378 3300037312 Bacteria 657
58 Ga0395900_0021364 3300037418 Bacteria 6617
59 Ga0395898_0001876 3300037466 Bacteria 26857
60 Ga0395898_0033693 3300037466 Bacteria 5109
61 Ga0395901_1133111 3300038443 Bacteria 751
62 Ga0439436_0006754 3300041404 Bacteria 3526
63 Ga0439439_0003579 3300041406 Bacteria 3437
64 Ga0451789_1026625 3300041443 Bacteria 695
65 Ga0451791_0302357 3300041451 Bacteria 1292
66 Ga0451800_0406909 3300041459 Bacteria 1155
67 Ga0451843_1395988 3300041509 Bacteria 1075
68 Ga0451853_1349418 3300041512 Bacteria 2496
69 Ga0439433_0005230 3300041999 Bacteria 2788
70 Ga0439442_008902 3300042002 Bacteria 2029
71 Ga0439442_012789 3300042002 Bacteria 1718
72 Ga0439449_0058029 3300042007 Bacteria 1429
73 Ga0439457_004841 3300042014 Bacteria 3461
74 Ga0450894_000674 3300042131 Bacteria 5704
75 Ga0450895_001880 3300042132 Bacteria 1515
76 Ga0450898_000558 3300042134 Bacteria 4399
77 Ga0450899_027046 3300042135 Bacteria 688
78 Ga0439458_0109050 3300042157 Bacteria 723
79 Ga0466969_0157719 3300044656 Bacteria 1043
80 Ga0466972_0012946 3300044658 Bacteria 4190
81 Ga0466972_0013336 3300044658 Bacteria 4126
82 Ga0466972_0017690 3300044658 Bacteria 3566
83 Ga0466965_0003597 3300044683 Bacteria 6822
84 Ga0466965_0037836 3300044683 Bacteria 2369
85 Ga0466966_0001512 3300044684 Bacteria 14923
86 Ga0466966_0014789 3300044684 Bacteria 5163
87 Ga0466961_0002718 3300044693 Bacteria 10997
88 Ga0466961_0019921 3300044693 Bacteria 4318
89 Ga0466961_0140966 3300044693 Bacteria 1509
90 Ga0466963_0000266 3300044694 Bacteria 23069
91 Ga0466963_0000924 3300044694 Bacteria 14981
92 Ga0466964_0003312 3300044706 Bacteria 5869
93 Ga0466964_0077623 3300044706 Bacteria 1418
94 Ga0466971_0003312 3300044719 Bacteria 6880
95 Ga0466968_0031634 3300044735 Bacteria 2196
96 Ga0466968_0265172 3300044735 Bacteria 819
97 Ga0466970_0000459 3300044765 Bacteria 20111
98 Ga0466957_0000223 3300044842 Bacteria 26712
99 Ga0466960_0030391 3300044901 Bacteria 2485
100 Ga0466959_0000407 3300045049 Bacteria 25154
101 Ga0466959_0103473 3300045049 Bacteria 2037
102 Ga0466958_0000629 3300045836 Bacteria 15130
103 Ga0466967_0002626 3300045976 Bacteria 11315
104 Ga0466967_0039166 3300045976 Bacteria 4072
105 Ga0495592_0006017 3300046454 Bacteria 9021
106 Ga0495592_0048417 3300046454 Bacteria 3162
107 Ga0495603_0017664 3300046455 Bacteria 4317
108 Ga0495603_0018748 3300046455 Bacteria 4188
109 Ga0495603_0078400 3300046455 Bacteria 1937
110 Ga0495590_0078143 3300046457 Bacteria 1165
111 Ga0495629_0014101 3300046459 Bacteria 5758
112 Ga0495629_0017784 3300046459 Bacteria 5095
113 Ga0495629_0023146 3300046459 Bacteria 4427
114 Ga0495629_0079479 3300046459 Bacteria 2290
115 Ga0495629_0086514 3300046459 Bacteria 2186
116 Ga0495629_0486073 3300046459 Bacteria 833
117 Ga0495651_0002895 3300046462 Bacteria 13283
118 Ga0495653_0624173 3300046463 Bacteria 660
119 Ga0495582_0353707 3300046473 Bacteria 846
120 Ga0495605_0017923 3300046474 Bacteria 3803
121 Ga0495639_0008960 3300046475 Bacteria 4289
122 Ga0495662_0043240 3300046476 Bacteria 2174
123 Ga0495662_0099430 3300046476 Bacteria 1422
124 Ga0495662_0106696 3300046476 Bacteria 1371
125 Ga0495664_0093343 3300046477 Bacteria 1810
126 Ga0495664_0193192 3300046477 Bacteria 1234
127 Ga0495584_0099462 3300046491 Bacteria 1470
128 Ga0495585_0053633 3300046492 Bacteria 2231
129 Ga0495594_0005295 3300046499 Bacteria 6623
130 Ga0495594_0038652 3300046499 Bacteria 2607
131 Ga0495594_0053003 3300046499 Bacteria 2234
132 Ga0495594_0184966 3300046499 Bacteria 1186
133 Ga0495596_0012843 3300046500 Bacteria 3572
134 Ga0495607_0026029 3300046501 Bacteria 3632
135 Ga0495583_0037746 3300046506 Bacteria 2288
136 Ga0495583_0249196 3300046506 Bacteria 712
137 Ga0495606_0015793 3300046507 Bacteria 5795
138 Ga0495610_0030453 3300046512 Bacteria 2829
139 Ga0495616_0022615 3300046513 Bacteria 3394
140 Ga0495618_0281827 3300046514 Bacteria 1036
141 Ga0495620_0018568 3300046515 Bacteria 3441
142 Ga0495620_0047018 3300046515 Bacteria 1859
143 Ga0495628_0140867 3300046516 Bacteria 1840
144 Ga0495628_0209822 3300046516 Bacteria 1465
145 Ga0495631_0002194 3300046518 Bacteria 11237
146 Ga0495643_0002983 3300046522 Bacteria 12782
147 Ga0495643_0003880 3300046522 Bacteria 10742
148 Ga0495648_0038600 3300046524 Bacteria 3051
149 Ga0495648_0076404 3300046524 Bacteria 1923
150 Ga0495640_0029094 3300046533 Bacteria 3971
151 Ga0495640_0048193 3300046533 Bacteria 2945
152 Ga0495587_0018609 3300046536 Bacteria 4307
153 Ga0495609_0057746 3300046538 Bacteria 1717
154 Ga0495609_0194310 3300046538 Bacteria 850
155 Ga0495645_0024429 3300046543 Bacteria 4385
156 Ga0495622_0012569 3300046557 Bacteria 3922
157 Ga0495622_0077774 3300046557 Bacteria 1528
158 Ga0495633_0007410 3300046558 Bacteria 6315
159 Ga0495668_0095025 3300046616 Bacteria 1631
160 Ga0495634_0011182 3300046642 Bacteria 6545
161 Ga0495611_0179116 3300046648 Bacteria 990
162 Ga0495625_0041209 3300046660 Bacteria 3362
163 Ga0495625_0050472 3300046660 Bacteria 2985
164 Ga0495625_0115312 3300046660 Bacteria 1833
165 Ga0495635_0013284 3300046663 Bacteria 5761
166 Ga0495635_0084476 3300046663 Bacteria 2172
167 Ga0495635_0107731 3300046663 Bacteria 1903
168 Ga0495661_0025135 3300046665 Bacteria 3850
169 Ga0495661_0363715 3300046665 Bacteria 710
170 Ga0495588_0000456 3300046674 Bacteria 20551
171 Ga0495588_0010294 3300046674 Bacteria 4344
172 Ga0495657_0002648 3300046675 Bacteria 14971
173 Ga0495657_0043104 3300046675 Bacteria 3078
174 Ga0495657_0044531 3300046675 Bacteria 3018
175 Ga0495657_0286588 3300046675 Bacteria 984
176 Ga0495599_0463275 3300046678 Bacteria 749
177 Ga0495623_0142564 3300046679 Bacteria 1424
178 Ga0495646_0160618 3300046680 Bacteria 1244
179 Ga0495658_0014632 3300046683 Bacteria 4012
180 Ga0495613_0008516 3300046689 Bacteria 7612
181 Ga0495613_0068334 3300046689 Bacteria 2591
182 Ga0495613_0134877 3300046689 Bacteria 1766
183 Ga0495613_0174707 3300046689 Bacteria 1523
184 Ga0495613_0261492 3300046689 Bacteria 1205
185 Ga0495613_0303129 3300046689 Bacteria 1105
186 Ga0495613_0303132 3300046689 Bacteria 1105
187 Ga0495613_0442560 3300046689 Bacteria 881
188 Ga0495624_0083864 3300046690 Bacteria 1970
189 Ga0495624_0312405 3300046690 Bacteria 947
190 Ga0495670_0077484 3300046691 Bacteria 1690
191 Ga0495671_0011582 3300046692 Bacteria 4846
192 Ga0495649_0189367 3300046694 Bacteria 1071
193 Ga0495589_0041315 3300046794 Bacteria 2301
194 Ga0495600_0179770 3300046809 Bacteria 1363
195 Ga0495600_0363414 3300046809 Bacteria 905
196 Ga0495660_0221599 3300046810 Bacteria 891
197 Ga0495660_0250149 3300046810 Bacteria 822
198 Ga0495660_0267593 3300046810 Bacteria 786
199 Ga0495581_0023863 3300047315 Bacteria 3544
200 Ga0495604_0000486 3300047317 Bacteria 34884
201 Ga0495604_0081711 3300047317 Bacteria 2418
202 Ga0495604_0147065 3300047317 Bacteria 1678
203 Ga0495636_0005955 3300047318 Bacteria 4787
204 Ga0495636_0059264 3300047318 Bacteria 1615
205 Ga0495676_0004905 3300047321 Bacteria 12271
206 Ga0495680_0014357 3300047322 Bacteria 6862
207 Ga0495683_0178995 3300047323 Bacteria 969
208 Ga0495683_0318544 3300047323 Bacteria 663
209 Ga0495687_004874 3300047443 Bacteria 8806
210 Ga0495687_008485 3300047443 Bacteria 5877
211 Ga0495687_020842 3300047443 Bacteria 3187
212 Ga0495687_048555 3300047443 Bacteria 1820
213 Ga0495687_060077 3300047443 Bacteria 1569
214 Ga0495687_068273 3300047443 Bacteria 1435
215 Ga0495675_0168446 3300047444 Bacteria 1346
216 Ga0495675_0373698 3300047444 Bacteria 835
217 Ga0495685_000667 3300047447 Bacteria 10480
218 Ga0495685_025773 3300047447 Bacteria 2023
219 Ga0495685_046153 3300047447 Bacteria 1482
220 Ga0495681_0001704 3300047470 Bacteria 16276
221 Ga0495681_0025449 3300047470 Bacteria 3096
222 Ga0495681_0312605 3300047470 Bacteria 605
223 Ga0495684_0086167 3300047471 Bacteria 2381
224 Ga0495684_0352124 3300047471 Bacteria 1045
225 Ga0495686_0073605 3300047472 Bacteria 2098
226 Ga0495686_0178150 3300047472 Bacteria 1233
227 Ga0495593_0017426 3300047673 Bacteria 4043
228 Ga0495593_0090567 3300047673 Bacteria 1575
229 Ga0495614_0026009 3300048089 Bacteria 2522
230 Ga0495614_0290094 3300048089 Bacteria 754
231 Ga0495626_0009880 3300048091 Bacteria 5128
232 Ga0496109_0033541 3300048912 Bacteria 4619
233 Ga0495678_014309 3300049459 Bacteria 3693
234 Ga0495682_0044028 3300049460 Bacteria 1634
235 Ga0501031_0023014 3300049568 Bacteria 4063
236 Ga0501032_0040139 3300049569 Bacteria 3182
237 Ga0501032_0247163 3300049569 Bacteria 1158
238 Ga0501033_0068789 3300049570 Bacteria 2603
239 Ga0501033_0215521 3300049570 Bacteria 1368
240 Ga0501034_0072353 3300049571 Bacteria 3456
241 Ga0501034_0093519 3300049571 Bacteria 3003
242 Ga0501036_0019947 3300049572 Bacteria 5627
243 Ga0501036_0048338 3300049572 Bacteria 3602
244 Ga0501036_0154534 3300049572 Bacteria 1935
245 Ga0501037_0004124 3300049573 Bacteria 10540
246 Ga0501037_0031265 3300049573 Bacteria 3930
247 Ga0501037_0241023 3300049573 Bacteria 1267
248 Ga0501038_0107829 3300049574 Bacteria 2310
249 Ga0501038_0216749 3300049574 Bacteria 1529
250 Ga0501046_0481920 3300049580 Bacteria 890
251 Ga0501046_0490774 3300049580 Bacteria 880
252 Ga0501047_0028622 3300049581 Bacteria 5373
253 Ga0501047_0072268 3300049581 Bacteria 3320
254 Ga0501047_0351750 3300049581 Bacteria 1310
255 Ga0501048_0033541 3300049582 Bacteria 3708
256 Ga0501048_0047266 3300049582 Bacteria 3071
257 Ga0501048_0466625 3300049582 Bacteria 904
258 Ga0501070_0072046 3300049586 Bacteria 2860
259 Ga0501070_0209832 3300049586 Bacteria 1599
260 Ga0501070_0512261 3300049586 Bacteria 963
261 Ga0501080_0031475 3300049742 Bacteria 4943
262 Ga0501035_0020918 3300049822 Bacteria 6012
263 Ga0501035_0031266 3300049822 Bacteria 4848
264 Ga0501035_0129478 3300049822 Bacteria 2201
265 Ga0501035_0317216 3300049822 Bacteria 1310
266 Ga0501044_0009267 3300049823 Bacteria 10751
267 Ga0501044_0037888 3300049823 Bacteria 5038
268 Ga0501044_0075700 3300049823 Bacteria 3417
269 Ga0501045_0299524 3300049824 Bacteria 1197
270 nmdc:mga03n38_87035_c1 3300050490 Bacteria 1480
271 nmdc:mga06z11_7423_c2 3300050494 Bacteria 2690
272 Ga0500644_0182558 3300053088 Bacteria 859
273 Ga0500566_0037972 3300053094 Bacteria 2788
274 Ga0500640_003658 3300053095 Bacteria 5431
275 Ga0500650_0212433 3300053098 Bacteria 878
276 Ga0500654_010192 3300053099 Bacteria 6383
277 Ga0500660_062108 3300053100 Bacteria 1795
278 Ga0500553_074654 3300053101 Bacteria 1547
279 Ga0500560_000396 3300053107 Bacteria 5875
280 Ga0500560_006954 3300053107 Bacteria 2633
281 Ga0500560_009822 3300053107 Bacteria 2368
282 Ga0500614_083088 3300053123 Bacteria 899
283 Ga0500614_084935 3300053123 Bacteria 892
284 Ga0500652_006661 3300053131 Bacteria 3733
285 Ga0500652_057764 3300053131 Bacteria 1593
286 Ga0500561_0000620 3300053137 Bacteria 5674
287 Ga0500573_0028680 3300053140 Bacteria 3207
288 Ga0500579_138101 3300053143 Bacteria 1112
289 Ga0500600_0186129 3300053149 Bacteria 994
290 Ga0500603_049507 3300053150 Bacteria 1146
291 Ga0500616_0130204 3300053153 Bacteria 1189
292 Ga0500624_005022 3300053157 Bacteria 1751
293 Ga0500633_0000247 3300053160 Bacteria 7780
294 Ga0500634_0056570 3300053161 Bacteria 2096
295 Ga0500656_001165 3300053732 Bacteria 2205
296 Ga0500587_000514 3300053739 Bacteria 4696
297 Ga0466962_0000182 3300061719 Bacteria 26106
298 Ga0466962_0088714 3300061719 Bacteria 1481
299 Ga0466962_0128137 3300061719 Bacteria 1226
300 2808917942 2808606375 Bacteria 9466072
301 2547408948 2547132111 Bacteria 8013147
302 2616693301 2616644814 Bacteria 11555299
303 2644263341 2643221647 Bacteria 10741251
304 2644442065 2643221678 Bacteria 9540101
305 2644631662 2643221714 Bacteria 9015452
306 2738887039 2738541308 Bacteria 7020677
307 2785366594 2784746768 Bacteria 10036182
308 2808847135 2808606359 Bacteria 9866990
309 2812360827 2811994879 Bacteria 9313447
310 2852639440 2852635781 Bacteria 8251373
311 2862391924 2862382967 Bacteria 10317375
312 2863408057 2863404153 Bacteria 9672205
313 2867431797 2867428634 Bacteria 9590268
314 2912723147 2912715099 Bacteria 9460473
315 2919469999 2919468124 Bacteria 9133025
316 2939674661 2939674588 Bacteria 4844420
317 2946073476 2946072368 Bacteria 8999607
318 2947232392 2947224130 Bacteria 9938529
319 2954008389 2954002825 Bacteria 9173742
320 2954389253 2954380949 Bacteria 10050426
321 2954673812 2954673503 Bacteria 9685905
322 2954690178 2954682443 Bacteria 9862841
323 8008560624 8008558824 Bacteria 10610750
324 8008581167 8008574985 Bacteria 7815457
325 8056832759 8056829672 Bacteria 9045328
326 JGI24737J22298_10104391
327 rootH1_10064481
328 rootH1_10086878
329 rootL2_10027891
330 rootL2_10072352
331 rootH1_10014407
332 Ga0006562J51391_1103054
333 Ga0081455_10041060
334 Ga0075365_10144288
335 Ga0075363_100102818
336 Ga0075363_100116673
337 Ga0075367_10013551
338 Ga0075370_10031726
339 Ga0075370_10105475
340 Ga0105244_10099877
341 Ga0105250_10087995
342 Ga0105245_11011569
343 Ga0105243_11524042
344 Ga0105246_10536447
345 Ga0157369_11454168
346 Ga0182008_10001610
347 Ga0182007_10001297
348 Ga0183367_1003
349 Ga0209758_1003249
350 Ga0207426_1036375
351 Ga0207647_10020158
352 Ga0307517_10014742
353 Ga0307517_10019851
354 Ga0307515_10000633
355 Ga0307515_10100684
356 Ga0307511_10000474
357 Ga0307512_10022518
358 Ga0307513_10088437
359 Ga0307509_10006938
360 Ga0307509_10065803
361 Ga0307509_10286580
362 Ga0307508_10022789
363 Ga0307508_10028866
364 Ga0307508_10130043
365 Ga0307514_10005798
366 Ga0307514_10022291
367 Ga0307514_10073880
368 Ga0307514_10104654
369 Ga0307514_10147833
370 Ga0307516_10004895
371 Ga0307516_10031853
372 Ga0307516_10099326
373 Ga0307518_10017864
374 Ga0307518_10068595
375 Ga0307518_10273600
376 Ga0307507_10009406
377 Ga0307507_10048642
378 Ga0307507_10162973
379 Ga0307507_10175023
380 Ga0307507_10284509
381 Ga0307510_10042130
382 Ga0395899_0664378
383 Ga0395900_0021364
384 Ga0395898_0001876
385 Ga0395898_0033693
386 Ga0395901_1133111
387 Ga0439436_0006754
388 Ga0439439_0003579
389 Ga0451789_1026625
390 Ga0451791_0302357
391 Ga0451800_0406909
392 Ga0451843_1395988
393 Ga0451853_1349418
394 Ga0439433_0005230
395 Ga0439442_008902
396 Ga0439442_012789
397 Ga0439449_0058029
398 Ga0439457_004841
399 Ga0450894_000674
400 Ga0450895_001880
401 Ga0450898_000558
402 Ga0450899_027046
403 Ga0439458_0109050
404 Ga0466969_0157719
405 Ga0466972_0012946
406 Ga0466972_0013336
407 Ga0466972_0017690
408 Ga0466965_0003597
409 Ga0466965_0037836
410 Ga0466966_0001512
411 Ga0466966_0014789
412 Ga0466961_0002718
413 Ga0466961_0019921
414 Ga0466961_0140966
415 Ga0466963_0000266
416 Ga0466963_0000924
417 Ga0466964_0003312
418 Ga0466964_0077623
419 Ga0466971_0003312
420 Ga0466968_0031634
421 Ga0466968_0265172
422 Ga0466970_0000459
423 Ga0466957_0000223
424 Ga0466960_0030391
425 Ga0466959_0000407
426 Ga0466959_0103473
427 Ga0466958_0000629
428 Ga0466967_0002626
429 Ga0466967_0039166
430 Ga0495592_0006017
431 Ga0495592_0048417
432 Ga0495603_0017664
433 Ga0495603_0018748
434 Ga0495603_0078400
435 Ga0495590_0078143
436 Ga0495629_0014101
437 Ga0495629_0017784
438 Ga0495629_0023146
439 Ga0495629_0079479
440 Ga0495629_0086514
441 Ga0495629_0486073
442 Ga0495651_0002895
443 Ga0495653_0624173
444 Ga0495582_0353707
445 Ga0495605_0017923
446 Ga0495639_0008960
447 Ga0495662_0043240
448 Ga0495662_0099430
449 Ga0495662_0106696
450 Ga0495664_0093343
451 Ga0495664_0193192
452 Ga0495584_0099462
453 Ga0495585_0053633
454 Ga0495594_0005295
455 Ga0495594_0038652
456 Ga0495594_0053003
457 Ga0495594_0184966
458 Ga0495596_0012843
459 Ga0495607_0026029
460 Ga0495583_0037746
461 Ga0495583_0249196
462 Ga0495606_0015793
463 Ga0495610_0030453
464 Ga0495616_0022615
465 Ga0495618_0281827
466 Ga0495620_0018568
467 Ga0495620_0047018
468 Ga0495628_0140867
469 Ga0495628_0209822
470 Ga0495631_0002194
471 Ga0495643_0002983
472 Ga0495643_0003880
473 Ga0495648_0038600
474 Ga0495648_0076404
475 Ga0495640_0029094
476 Ga0495640_0048193
477 Ga0495587_0018609
478 Ga0495609_0057746
479 Ga0495609_0194310
480 Ga0495645_0024429
481 Ga0495622_0012569
482 Ga0495622_0077774
483 Ga0495633_0007410
484 Ga0495668_0095025
485 Ga0495634_0011182
486 Ga0495611_0179116
487 Ga0495625_0041209
488 Ga0495625_0050472
489 Ga0495625_0115312
490 Ga0495635_0013284
491 Ga0495635_0084476
492 Ga0495635_0107731
493 Ga0495661_0025135
494 Ga0495661_0363715
495 Ga0495588_0000456
496 Ga0495588_0010294
497 Ga0495657_0002648
498 Ga0495657_0043104
499 Ga0495657_0044531
500 Ga0495657_0286588
501 Ga0495599_0463275
502 Ga0495623_0142564
503 Ga0495646_0160618
504 Ga0495658_0014632
505 Ga0495613_0008516
506 Ga0495613_0068334
507 Ga0495613_0134877
508 Ga0495613_0174707
509 Ga0495613_0261492
510 Ga0495613_0303129
511 Ga0495613_0303132
512 Ga0495613_0442560
513 Ga0495624_0083864
514 Ga0495624_0312405
515 Ga0495670_0077484
516 Ga0495671_0011582
517 Ga0495649_0189367
518 Ga0495589_0041315
519 Ga0495600_0179770
520 Ga0495600_0363414
521 Ga0495660_0221599
522 Ga0495660_0250149
523 Ga0495660_0267593
524 Ga0495581_0023863
525 Ga0495604_0000486
526 Ga0495604_0081711
527 Ga0495604_0147065
528 Ga0495636_0005955
529 Ga0495636_0059264
530 Ga0495676_0004905
531 Ga0495680_0014357
532 Ga0495683_0178995
533 Ga0495683_0318544
534 Ga0495687_004874
535 Ga0495687_008485
536 Ga0495687_020842
537 Ga0495687_048555
538 Ga0495687_060077
539 Ga0495687_068273
540 Ga0495675_0168446
541 Ga0495675_0373698
542 Ga0495685_000667
543 Ga0495685_025773
544 Ga0495685_046153
545 Ga0495681_0001704
546 Ga0495681_0025449
547 Ga0495681_0312605
548 Ga0495684_0086167
549 Ga0495684_0352124
550 Ga0495686_0073605
551 Ga0495686_0178150
552 Ga0495593_0017426
553 Ga0495593_0090567
554 Ga0495614_0026009
555 Ga0495614_0290094
556 Ga0495626_0009880
557 Ga0496109_0033541
558 Ga0495678_014309
559 Ga0495682_0044028
560 Ga0501031_0023014
561 Ga0501032_0040139
562 Ga0501032_0247163
563 Ga0501033_0068789
564 Ga0501033_0215521
565 Ga0501034_0072353
566 Ga0501034_0093519
567 Ga0501036_0019947
568 Ga0501036_0048338
569 Ga0501036_0154534
570 Ga0501037_0004124
571 Ga0501037_0031265
572 Ga0501037_0241023
573 Ga0501038_0107829
574 Ga0501038_0216749
575 Ga0501046_0481920
576 Ga0501046_0490774
577 Ga0501047_0028622
578 Ga0501047_0072268
579 Ga0501047_0351750
580 Ga0501048_0033541
581 Ga0501048_0047266
582 Ga0501048_0466625
583 Ga0501070_0072046
584 Ga0501070_0209832
585 Ga0501070_0512261
586 Ga0501080_0031475
587 Ga0501035_0020918
588 Ga0501035_0031266
589 Ga0501035_0129478
590 Ga0501035_0317216
591 Ga0501044_0009267
592 Ga0501044_0037888
593 Ga0501044_0075700
594 Ga0501045_0299524
595 nmdc:mga03n38_87035_c1
596 nmdc:mga06z11_7423_c2
597 Ga0500644_0182558
598 Ga0500566_0037972
599 Ga0500640_003658
600 Ga0500650_0212433
601 Ga0500654_010192
602 Ga0500660_062108
603 Ga0500553_074654
604 Ga0500560_000396
605 Ga0500560_006954
606 Ga0500560_009822
607 Ga0500614_083088
608 Ga0500614_084935
609 Ga0500652_006661
610 Ga0500652_057764
611 Ga0500561_0000620
612 Ga0500573_0028680
613 Ga0500579_138101
614 Ga0500600_0186129
615 Ga0500603_049507
616 Ga0500616_0130204
617 Ga0500624_005022
618 Ga0500633_0000247
619 Ga0500634_0056570
620 Ga0500656_001165
621 Ga0500587_000514
622 Ga0466962_0000182
623 Ga0466962_0088714
624 Ga0466962_0128137
625 2808917942
626 2547408948
627 2616693301
628 2644263341
629 2644442065
630 2644631662
631 2738887039
632 2785366594
633 2808847135
634 2812360827
635 2852639440
636 2862391924
637 2863408057
638 2867431797
639 2912723147
640 2919469999
641 2939674661
642 2946073476
643 2947232392
644 2954008389
645 2954389253
646 2954673812
647 2954690178
648 8008560624
649 8008581167
650 8056832759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

47

146

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.776 2 135
1qrk-assembly1.cif.gz_A human factor xiii with strontium bound in the ion site 0.724 20 135
3s3j-assembly1.cif.gz_A transglutaminase 2 in complex with a novel inhibitor 0.7234 20 136
6g4h-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa bound to ethylmercury 0.7228 13 135
8oxy-assembly1.cif.gz_A transglutaminase 3 without calcium in complex with dh patient-derived fab dh63-b02 0.7226 21 136
ID Description Score Start End Superfamily
af_I6XWA9_2_176_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8525 6 140 3.10.620.30
af_Q556I6_323_487_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7943 1 135 3.10.620.30
af_A0A2R8Q272_11_129_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7865 55 135 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7845 4 135 3.10.620.30
af_Q86AX0_679_844_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7612 10 148 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A2C8X0K0-F1-model_v4 deleted 0.993 1 197
AF-A0A2T5BCM6-F1-model_v4 Transglutaminase superfamily protein 0.9909 1 197
AF-A0A4R3IKC4-F1-model_v4 deleted 0.9907 1 197
AF-A0A101C4M5-F1-model_v4 Transglutaminase 0.9904 1 197
AF-A0A7W9H067-F1-model_v4 Transglutaminase-like putative cysteine protease 0.9896 28 197 GO:0006508
GO:0008233

Map